current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [T] COG5170 Serine/threonine protein phosphatase 2A, regulatory subunit, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460
# Score Template Links and tools%idFirst MDDIEDSLDQWKFAQCFGDKGDVEDITEADIISAVEFDHTGDYLATGDKGGRVVLFERNHSKKGCEYKFFTEFQSHEPEFDYLKSLEIEEKINKIRWCKRTNRAHFLLSTNDKTIKLWKLYEKNLKVVAENNLSDSFHSPMQGPLTTPSQLRLPRLNHHDMIIAAYPRRVYANAHAYHINSISVNSDAETYISADDLRINLWNLSISDHSFNIVDIKPENMEELTEVITSAEFHPINCNHLMYSSSKGNIKLLDLRQSALCDNPCKLFEDQEDQDSKSFFSEIISSISDVKFSQNGRYILSRDYLTLKIWDVNMEKAPVKTIPLHDVLRSKLCDLYENDCIFDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLPGDRGQIVLQADKAAFRARKSAANNVPKLNAVKNNDWRSQPQAAMGSASVGLDPDNLDYNKKILHASWHPFEDSVAIAATNNLFVFSKLLast
1 -113.000[T] COG5170 Serine/threonine protein phosphatase 2A, regulatory subunit  ali  100  1MDDIEDSLDQWKFAQCFGDKGDVEDITEADIISAVEFDHTGDYLATGDKGGRVVLFERNHSKKGCEYKFFTEFQSHEPEFDYLKSLEIEEKINKIRWCKRTNRAHFLLSTNDKTIKLWKLYEKNLKVVAENNLSDSFHSPMQGPLTTPSQLRLPRLNHHDMIIAAYPRRVYANAHAYHINSISVNSDAETYISADDLRINLWNLSISDHSFNIVDIKPENMEELTEVITSAEFHPINCNHLMYSSSKGNIKLLDLRQSALCDNPCKLFEDQEDQDSKSFFSEIISSISDVKFSQNGRYILSRDYLTLKIWDVNMEKAPVKTIPLHDVLRSKLCDLYENDCIFDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLPGDRGQIVLQADKAAFRARKSAANNVPKLNAVKNNDWRSQPQAAMGSASVGLDPDNLDYNKKILHASWHPFEDSVAIAATNNLFVFSKL 463
2 -87.200[T] KOG1354 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  54  1MAGAGGGN-QWCFSQVKGAVD--DDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPE---GYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGK-------------------RKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQD. 444
3 -60.400[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  12  440YDIANNKDALRKTWNPKFTL-----RSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKKSTSLDVEPIYT-------FRAHKGPVLCVVMSSNGE--QCYSGGTDGLIQGWNTTNPNIDPYDSYDPSVLRGP--------------------------------LLGHTDAVWGLAYSAAHQRLLSCSDGTLRLWNTTEVAPALSVFN----DIKELGIPASVDLVSS-DPSHMVASFSKGYTSIFNMETQQRILTLE---------SNVDTTANSSCQINRVISHPTLSISITAEDRHIKFYDNNT-GKLIHSMVAHLE---------------AVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQ-----------------------------------------------EFTAHRKKFEESIHDVAFHPSKCYIASAGADAAKVF... 779
4 -55.400[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  18  2.........KIKLIDVRSFKVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCEKGTQSRTVN------------------SKKYGVDLIHFTHANNTAIHSSTKVDDTIRYLSLHDNKYL-------------------------------------------RYFPGHTKKVISLCISPVEDTFLSGSDKTLRLWDLRSPNCQGLM----------HLSGRPIAAYDP-EGLIFAAGVNSESIKLYDLRSF-----------DKGPFVTFKLNQEKECDWTGLKFSRDGKTILISNGSVIRLVDAFH-GTPLQTFTGYPNNKGI------------PIEASFSPDSQFIFSGSTDGRVHIWNADTGNKVSVLNG--------------------------------------------------DHPGPVQCVQFNPKYMMLASACTNAFWLPT.. 312
5 -54.900[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  15  322VLVVAFSSGAFYLYELPDVNMIHSLSISDYPISAALFNCTGDWVALASREGQLLVWEWQSEQY------------------IMKQQGHSSEMTCIAYSSDGQ--FIATGGEDSKVKLWNTQSSFCFVTFSEHTSGVTGIQFSRNKKFLVSSSLDGTVRAFDVNRYRNFRTFTSPNPAQFSCVAVDYSGELVVAGDVFDIFLWSVKTGKLL--------EIISGHEGPVVSIAFSPVTSSTLVSGSWDKTVKIWNCLESN----------------SEHETIDAVSDVTNVTFSPSGEEIAVATSGNITIFDIKS-AGQVTTIEGRNDLSTDIITARKNAQANYFSTIEYSADGECILAAGKSANICIYHVREAILLKKFEITQNHSLDGLNDFISRKHLSEFGNMALVEEREELEGGRVGVQRGDMSSRRFQQEVRVFSVKFSPTGQAFAAAGTEGLCIYA.. 752
6 -54.700[T] KOG4378 Nuclear protein COP1  ali follow..  13  12LLAASGGD-TVKLFDVSADSGDSYTPSPGCAVNSVKWNHTNLVVASTGEDKKISLWRKNGQS-----------LGTVPVTGKDGGDSAEECLSAISFSKKGS-RYICSGGTGQIVKIWDLQRKLCIKK-------------------------------------------LKGHTSTITGVMYNCKDEHLASVSGGDLIVHNLASGARATELKD-PNGQVVQFVHVLRLLDYSRSSRHLLVTAGDDGTVHLWDTTGRSP---------------KMSWLKQHSAPTAGVCFSPSNEKIIASMDKKLYTYDSG--SRRSSSCIAYEA---------------PFSSLAFGDNGYILVAGTSNGRVVFYDIRGKPQPVT------------------------------------------------VLHAFSNSEDVTSLSWQTSKPVIVNEKNYT....... 337
7 -54.600[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  4IINQRVEQGESSMGGAKPALLHR--TGHVARINDVILLSKDEGVWTASDDRSVRLYLKRDND----------------QFWPSIHHFMPVAPTSLYYSEETY--KLLVGLINGNVYEFSVADD---------------------------------------FNSMTESRKWTCHAGPISGLGFALSSELIFSCSRDKSIVWHCSENSN----------KMGSYLLENSCTAMVI-DLPFVFVGDHGGHVTVLRIVDNQ--------------PNLVSKLSAHTNAITSLTWDGNKKVLYSGSDHLIIMWDIGGGRGEAYELNGHNG---------------KVTTLCAAPAAKRLFSADEHGKLMCWDMNCKRVETPERTCGSAVCGSCCDNWTTYPPMGYETKIRINDCNARMKDNPQNFNLTPLAIPHEIHTGITAMHLQETLGLLVTSGQNRIMIWD.. 403
8 -54.300[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  11  35.FEVPREYNATKLERVFAKPFLASLDGHRDGVNCLAKHPEKATVLSGACDGEVRIWNLTQRNCIRTIQ------------------AHEGFVRGICTRFCGT--SFFTVGDDKTVKQWKMDGPDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSM-TWGFDSISSVKFNPIETFLLGSSDRNIVLYDMRQATPLKKV---------ILDMRTNTICWNPMEAFIFTAANEDYNLYTFDMRALD---------------TPVMVHMDHVSAVLDVDYSPTGKEFVSASDKSIRIFPVDKSRSREVYHTKRMQ---------------HVICVKWTSDSKYIMCGSDEMNIRLWKANASEKLGVLTSREKAAKDYNQKLKEKFQ---YPHIKRIARHRHLPKSIYSQIQEQRIMKEARRRKEVNRIKHSKPGSVPLVSEKKKHVVAV.. 443
9 -54.000[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  12  1MAQPYLPAE--KFLSRKQETILLDE-DEPAVVSSVRISPKKPYHVATTSSVRLTLYDTVVCEPLNLFS------------------RFKKGVCSIDFRHDGR--LLAIGGDEGKVRIFDVEKTTG--------------------------------------SSKVALRVMQASQSTVKSVHFSPRGDTVFSMADGKIKQYRVADTAYGVN--AVPIIEIQAHEDAIRCGAVSSINDHIVLTGGYDHKVRLWDIRSKEKSLEL-----------------DCEHPVESVLFLPGEQLIATAAGPIVKIWDTTT-GRQLTALQAHYK---------------TVTSLRLATNSTCLLSAGIDRRVNAFRTTNYSLIN----------------------------------------------------SWSMPSPVLDIDVSRDDQTMAIGMGNLLALYRRA 316
10 -53.800[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  14  296AVKDWSKRLHLGPRASLPSVCMYTFHHTNNNMNCAEFSPDSTMIACGFQESYIRLWSIKADKKSLPKSTSVE-----DSDGSVRLLSHSGPVYGTTFSPDNK--YLLSCSEDASARLWSVDTKTALVA-------------------------------------------YKGHTGPVWDVAFGPFGHYFATASDQTAQLWSCDHIYPL--------RVFAGHLSDVDCVTFHP-NSAYVLTGSSDKTCRLWDVHRGHS----------------VRVFNGHTQPVTAVAIAPDGHTMASADEGLIHLWDIGT-GRRIKTMRGHRG---------------NIYSLSFSRESTVLVSGGSDCTVRAWDVFKTNYNNPVSSSLTGSVVTPFSAKTSTFN-----------------EVNWSTSPDQMVALYTKQTPIFNVSFTRRNLCLAISVS......... 643
11 -53.100[R] KOG0286 G-protein beta subunit  ali follow..  12  28.VTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIP------------------LRSSWVMTCAYAPSGN--FVACGGLDNMCSIYNLKSRE---------------------------------------GNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQK--------TVFVGHTGDCMSLAVSP-DFNLFISGACDASAKLWDVREGTC----------------RQTFTGHESDINAICFFPNGEAICTGSDASCRLFDLRA-DQELICFSHESI-------------ICGITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVG---------------------------------------------------ILSGHDNRVSCLGVTADGMAVATGSWDSLKIWN.. 340
12 -53.100[R] KOG1334 WD40 repeat protein  ali follow..  12  274.........................GSHAGSVSTIHFNQRGTRLASSGDDLRVIVWDWVRQKPVLNF-----------------ESGHDINVIQAKFFPNCGDSTLAMCGHDGQVRVAELINASYCENT----------------------------------------KRVAKHRGPAHELALEPDSPFLTSGEDAVVFTIDLRQDRPA---SKVVVTRENDKKVGLYTISMNPANIYQFAVGGHDQFVRIYDQRRIDKKENNGVL---KKFTPHHLVYCDFPTNITCVVYSHDGTELLASNDEDIYLFNSSLSDQYVKRYKGHRNNDT-------------KCVNFYGPRSEFVVSGSDCGHVFFWEKSSSQIIQFMEG--------------------------------------------------DRGDIVNCLEPHPYLPVLATSGLDQVRIWT.. 590
13 -52.800[R] KOG0645 WD40 repeat protein  ali follow..  13  1.........................SGHTGRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNLVHVIDG-----------------FHTRSIRRVAWRPIER-PVLAVASFDSVVSINEKIDDD------------------------------------------ECTAALEGHENEVKCIAWSCNGNYLATCSDKSVWIWEATEDDE------DCLAVLQEHTQDVKVVTWHP-TEDLLVSGSYDNSICFWRDDGD--------------DWALTCQLQGHTNTVWALAFSPNGNTLASADDGNVFLWIKISSNEDVATIDSTNILRPALQEEWKHIHKGAVYTISWMNDAT-LCSAGGDGKIVVYQREKHDEALWHVAYEQ--------------------------------------------DHAHGVYEINSLEYLRDDRLLSGGDDGECRVWS.. 320
14 -52.700[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  10  5.........................QFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVK----------------AHELKEHNGHITGIDWAPKSD--RIVTCGADRNAYVWSQKDGVWKPT-----------------------------------------LVILRINRAATFVKWSPLENKFAVGSARLISVCYFEAENDWWVSK----HIKKPIRSTVLSLDWHP-NNVLLAAGSCDFKCRVFSAYIKEVDEKKASTKMPFGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSDSTVSVADA-SKSVQVSTLKTEFL---------------PLLSVSFVSENSVVAAGH-DCCPMLFIYDDRGCLTFVSKLDIPKQSIQRNMSAMERFRNMDKRATTEDRNTALETL--------------HQNSITQVSIKQDCRKFCTTGIDGMTIWD.. 356
15 -52.400[S] KOG1407 WD40 repeat protein  ali follow..  10  2......EETTIPFKSLHSREY----QGHKKKVHSVAWNSNGTKLASGSVDQTARIWNIEPHGHSKA--------------KDLELKGHTDSVDQLCWDPKHS-DLVATASGDKSVRLWDARSGKCTQQV--------------------------------------------ELSGENINITYKPDGTHVAVGNDDELTILDVRKFKPL---------HRRKFNYEVNEIAWNM-PGDFFFLTTGLGTVEVLSYPSLK----------------PLDTLTAHTAGCYCIAIDPKGRYFAVGSDSLVSLWDIS-DMLCLRTFTKLEW---------------PVRTISFNYSGEYIASASEDLFIDIANVQTGRTVH----------------------------------------------------QIPCRAAMNSVEWNPKYNLLAYAGDDKFRIFG.. 311
16 -52.100[S] KOG0293 WD40 repeat-containing protein  ali follow..  15  248.DLSLYSDHQCGKHQIPSQTAQI--ESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGHISLKH---------------TLVGHHKPVIAILWSPDDR--QVLTCGAEEVIRRWDVDSGDCVHM-------------------------------------------YEKGGISPISCGWYPDGQGIIAGMDRSICMWDLDGREKE--------CWKGQRTQKVSDIAMTD-DGKWLVSVCKDSVISLFDREATV------------------ERLIEEEDMITSFSLSNDNKYILVNLNQEIRLWNIEGDPKIVSRYKGH------------KRSRFIIRSCFGGYKQAFIASGSEDSQVYIWHRSTGKLIVE---------------------------------------------------LPGHAGAVNCVSWSPTNLMLASASDDGIRIWG.. 560
17 -52.100[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  13  7.........................QGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYM------------------GHTGAVWCVDADWDTK--HVLTGSADNSCRLWDCETGKQLALL--------------------------------------------KTNSAVRTCGFDFGGNIIMFSTDKQVSFFDLRDPSQI--DNNEPYMKIPCNDSKITSAVWGP-LGECIIAGHESGELNQYSAKSGEV----------------LVNVKEHSRQINDIQLSRDMTMFVTASDNTAKLFDSTT-LEHQKTFRTER----------------PVNSAALSPNYDHVVLGGGQEAMDVTTTSTRI-------------------------------------GKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGVRIHY.. 313
18 -52.000[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  14  32ALLESGVRRTSNLQAPIMQL-----EGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDCEN-----------------VMAMSGHSGAVMEAHFTPDGS--HIFTCSTDKTLAFWDIATGQRQRR-------------------------------------------FKGHGNFVNSVQGSRRGQQLLCSDDRTIKIWDARKKHAAHTL---------ESPFQVTAVCFGD-TGEQVISGGIDNEVKIWDIRKQAV----------------LHHLRGHSDTITGMSLSPEGDFILTNADNTLRVWDVRPYAPGERCVKVFQG--------HQHNFEKNLLRCAWSPGSDKITSGSADRHVYIWDVNTRRILYKLP---------------------------------------------------GHNGSVNAVDFSPKEPLILSGSSDKLYLGE.. 344
19 -51.600[S] KOG4328 WD40 protein  ali follow..  14  187.SIPVKPEKIEFDLDLLTLEPQNVARVVPGRIFVVQFLPNVKMVAAGDKLGNVGFWNLDCGNE-------------EDNDGIYLFTPHSAPVSSIVFQQNSL-SRVISSSYDGLIRLMDVEKSVFDL--------------------------------------------VYSTDEAIFSLSQRPNDEQSLYFGYGVFNVWDLRAGKSV--------FHWELHERRINSIDFNPQNPHVMATSSTDGTACLWDLRSMG------------AKKPKTLSTVNHSRAVHSAYFSPSGLSLATTSDNYIGVLSGANFENTCMIYH------------NNTSRWISKFKAVWGWDDSYIYVGNLSKKIDVINPKLKRTVMELHNP-------------------------------------------------LQRAIPCRIHCHPNVGTLAGSTAGGVYVWT.. 514
20 -51.500[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  10  12.........................AQRSERVKSVDLHPTEPWILASLYSGTLCIWNYQTQVMAKSFE------------------VTELPVRSAKFVARKQ--WVVAGADDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWACTQIFEGHSHYVMQVTFNPKDTNTFASADRTIKIWNLGSPDPN--------FTLDAHQKGVNCVDYFTGGDKYLITGSDDHTAKVWDYQTKSC----------------VQTLEGHTHNVSAVCFHPELPIIITSEDGTVRIWHATT-YRLENTLNYGLE---------------RVWAIGYIKSSRRVVIGYDEGTIMVKLGREIPVASMDNTGKIIWAKHNEIQTANIKSIGADYEVTDGERLPLSVKELG-----------TCDLYPQSLKHNPNGRFVVVCGDGEYIIYTAL 382
21 -51.300[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  12  33TEDEAEQEQNDTMNNMVMDMSVQGFFEHKDSVFSVSINPVHNLCASGGGDDLGYIWDITTGEQICQLT------------------GHKDSIVAIDWSFDGT--YIATGGMDSQVRLWKSSTGFEFIT-------------------------------------------AFETVDEIVWLSWHPKGLFLAAGCDGSIWMWSLPSGKVV--------QVMYGHTAPVNAGKFIPPGGKRLATVDDSGTLIVWNPATGAP-----ECRMSSDDHRFDPGNEETAAGWTSFDCNAEGNVLFLGGSGKVKVVNINS-SHILASLEAQTE---------------SVEAIALCTALPICACASVDGTVALYDSASLKFRKSLPHEQAVIDCKFLPNTPYLLTACADCVIRK-----------DVRSGQLLGEYTGHQEPILCMAITPDGKRVVTGSDDTLLVFD.. 396
22 -50.900[U] KOG1332 Vesicle coat complex COPII, subunit SEC13  ali follow..  11  3..................SVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQI-----------------IADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHE-----------------------------------------HAGHDSSVNSVCWAPHGLILACGSDGAISLLTYTGEGQ------EVKKINNAHTIGCNAVSWAPAYIKRFASGGCDNLIKLWKEEEDG-------------QWKEEQKLEAHSDWVRDVAWAPSTSTIASCSDGRVFIWTCDDASSSPKLLHKFND---------------VVWHVSWSITANILAVSGGDNKVTLWKESVDGQ-------------------------------------------------VCISDVNKGQGSVSSVTEGQQNEQ............... 322
23 -50.900[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  11  1............MTTVTPSAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTN-------------------SLKGEFLHGGAVLDCCFHDDFS---GFSVGADYKVRRIVFNVGKEDILGTHDK------------------------------AVRCVEYFDFSILFFYTLCLFCDVTGQVITGSDKTVKCWDPRGASG------PERTQVGTYLQPERVYSMSL-VGHRLVVATAGRHVNIYDLRNM--------------SQPEQRRESSLKYQTRCVRCYPNGTGYALSSEGRVAMEFFDLSEAAQAK-----AFKCHRKSEAGRDIVYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRLYQYS---------------------------------------------------KYPTSISALSFSRDGQLLAVASSYTIFVRS.. 336
24 -50.700[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  10  1MSSCVNTSQTGPKKKISFIIRDEHEYSNRSAVSALQYDAQNGRLFTGGSDTIIRTWSVPHHKDAFSARGGVRSPGKNSPVQYQGSLQHTDWVNDMILCGHGK--ILISASNDTTVKVWNIERDNKIDCIRTHKDYVSCLAYAPIVEKAVSASFDHNIFVYDINANFKTVNNLIGCKDSIYSLATTPNLSLVLGAGEKCIRLFDPRTNEKI--------MKLRGHTDNVRALVVND-DGTRALSAGSDATIRLWDIGQQRC----------------IATCIAHEEGVWTLQVDSSFTTVYSAGDKMVVKTPLY-DFTKSQLLFKEEA---------------PVKKLLLSEKDNSLWVGTWKSDIKRWSIRPSAQLSIGGDEDGPSTSNANHSVSASSSPPVTFKY--------IRVKDQKGQQSTPELVIPGAPAIKKHAMLSDKRHVLTRDSDGVALYD.. 419
25 -50.400[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  10  163LLVTSGKDTMVKWWDLDTQHCFKTMVGHRTEVWGLVLLSEEKRLITGASDSELRVWDIAYLQEIEDSSPGIQDTLEAEDGAFETDREGRDRVVNLAVDKTGR--ILACHGTDSVLELFCILSKKEIQKKMDKKMKKARKKAKLHSSKGEEEDPEVNVEMSLQDEIQRVTNIIGGHRSDVRTLSFSSDNIAVLSAAADSIKIWNRSTLQCIRTMSGNLLETIDAHDGALWSMSLSP-DQRGFVTGGADKSVKFWDFELVKDENSTQKRL-----SVKQTRTLQLDEDVLCVSYSPNQKLLAVSLDCTVKIFYVDT-LKFFLSLYGHKL---------------PVICMDISHDGALIATGSADRNVKIWGLDFGDHKSLFAHDDSVMYLQFVPKSHLFFTAGKDHKIKQW----------DADKFEHIQTLEGHHQEIWCLAVSPSGDYVVSSSHDKLRLWE.. 703
26 -50.400[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali follow..  13  156.SKPMEIDGDVEIPPNKATVL----RGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGG----HDVPSNKDVTSLDWNSDGT--LLAMGSYDGFARIWTE-NGNLASTLGQHKGPIFALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQF-PFHSAPALDVDWQNNMTFASCSTDMCIHVCRLGCDHPV--------KTFQGHTNEVNAIKWDP-SGMLLASCSDDMTLKIWSMKQDA----------------CVHDLQAHSKEIYTIKWSPTGPLASASFDSTVRLWDVEQ-GVCTHTLMKHQE---------------PVYSVAFSPDGKYLASGSFDKYVHIWNTQSGSLVH----------------------------------------------------SYQGTGGIFEVCWNARGDKVGASASDGVCVLD.. 521
27 -50.200[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  13  412RVKLNIDAEYLIPKLPSPRDLQPFPRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGR-------------------CIRTIETDEVVRCVAWCPNPKLSIIAVATGNRLLLVN--PKVGDKVLVKKTDDLLAEAPSQDVIESERIKTAVQWSNAEADEQEKGVRVVI-THFKPIRQVTWHGRGDYLATVMPEGALIHQLSKRRSQ--------IPFSKSKGLIQFVLFHPVKPCFFV--ATQHNIRIYDLVKQEL----------------VKKLLTNSKWISGMSIHPKGDNLLVSTDKKMLWFDLDLSTKPYQTMRLHRN---------------AVRSVAFHLRYPLFASGSDDQAVIVSHGMVYNDLLQNPLIVPL--------------------------------------KKLQTHEKRDEFGVLDVNWHPVQPWVFSTGADSIRLYT.. 784
28 -50.200[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  10  119GLASGSGDQTMRIWDIELELPLHTCKSHKSWVLCIAWSPDATKIASACKNGEICIWNAKTGEQIGK-----------------TLKRHKQWITSLAWQPMHTCRLLASCGKDGNIFIWDTVQGTVVRC-------------------------------------------LSGHTASVTCLRWGGEGLIYSGSQDRTVKMWRADDGVMC--------RNMTGHAHWINTLALNTDGGERLVSGSDDFTLFMWNPKETK---------------QSINRMTGHMQLVNQVVFSPDTRYIASASDKSVKLWCGRT-GKYLASLRGHVG---------------PVYQVAWSADSRLLVSGSADSTLKVFELKTKSLYY---------------------------------------------------DLPGHGDEVFTVDWSPEGTKVVSGGKDKLKLWRQ. 473
29 -50.100[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  39...LYTNGNSVIIRNIENPAIADVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKEHLLK----------------NEFQPIAGPIKDISWSPDNQRIVAVGEGRERFGHVFMSETGTSVGEISGQSKSINSADFRPARPFRIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYSPDGKFFASAGDGKVFLYDGTSSELVGEF------GSPAHKGGVYALAWKP-DSTQLLTCSGDKTCRLWTVESRELVSEVITYLNVADPSKPLRVVKGHNKPITVLGLSDDRSTIYTGSDGVVTNWNSGSGNSYTDYVVKLNCQPRGLAILRNENIIYEASSIAVNADTSDVAVGGDDQKLHIYTLKGGVPKVELDHLGAVTDVSYSPDLKYLVACDAHRKVVLYSVEEYKPAHNKEWG--------FHSARVNTVAWSPNSLLVASGSLDTIIIWS.. 561
30 -49.900[S] KOG0295 WD40 repeat-containing protein  ali follow..  37.LSENDIKPLGGILEKKWTTVLRLQRKVNDLESKLQESQREINHGAPTRDKRQAADWIPRPPETQKLT------------------GHRLPITRVIFHPLWT--IMASCSEDATIKVWDYETGQLERTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLWDFGQTYDCLKSLKGHEHTVSSVTFLPTGDFVLSASDHTIKQWDISTGYCV--------YTFRGHNDWVRMIRISN-DGTLFASASLDQTVTVWSFATKSA----------------KLVLRDHEHAVECVEWAPDTAYFSGSRDRSIKAWNINT-GDVLFTLLAHEN----------------VRGLAFHPKGKYLISVADDKTLRVWELSAQRCMK---------------------------------------------------AIEAHEHFVSTVAFHQTSPFVITGSVDMCKVWE.. 402
31 -49.900[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  13  456MQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVS-------------QLDCLNRDNYIRSCKLLPDGC--TLIVGGEASTLSIWDLAAPT-----------------------------------------PRIKAELTSSAPACYALAISPDSKVCFSCCDGNIAVWDLHNQTLV--------RQFQGHTDGASCIDISN-DGTKLWTGGLDNTVRSWDLREGRQLQQH-----------------DFTSQIFSLGYCPTGEWLAVGESSNVEVLHVNKPDK--YQLHLHESC---------------VLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQS----------------------------------------------------KESSSVLSCDISVDDKYIVTGSGDKATVYE.. 767
32 -49.700[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  51ANLETLKDKKLKTQLASREKLYGKSAKAAAKIEKWLLPAEAGYLETEGLEKTWRVKQTD-----------ANEVDILSSRNQYDIVLPDFGPYKLDFTASGR--HMLAGGRKGHLALLDMMNMSLIKEI--------------------------------------------QVRETVRDVAFLHNDQFFAAAQKKYAYIYGRDGTE----------LHCLKERGPVARLRFLK-NHFLLASVNMSGQLHYQDVTHGGM----------------VASIRTGKGRTDVMEVNPYNSVVGLGHGGTVTMWKPTS-QAPLVQMQCHPG---------------PVSSVAFHPNGHLMATSGKERKIKIWDLRKFEEVQT--HSFHAKTLSFSQKGLLAAGTGSFVQILGDSSG-----GSSHNYTRYMNHSMVKGYQIEKVMFRPYEDVIGIGHSMGSSIL... 407
33 -49.600[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  12  5TAPKKNSEKKARVFDLSNAPRTEEPTHVPQSVSVSSKSESGVSSSAVSDDEDDFMPDLPPGFQ--------------------MQQSEAGPSSSRAEGPEDS--DDSDFDETEAISIIKLIPAACEAKISHGTQAISALRVEPPGVRFASGGLDYYVKLFDFQKMDMSKELLPAESHVINSLAFSPNGETLVVASEAIIRLLDRAGKQWSETVRGDQLNITKGHTATVNCVEFNPLNKNEFISCSDDGSLRLWNLDDHKV---ITKCINKHRKVIKTKGANGKRVSPQVCTFSPDGKWIAAGDDGSVQAWKYGSQNVNYLVRKAHNG---------------SITSIAFSPDSKRLLSRGFDDTLKMWSLDNPKEPLLVKTGLENAFKSTDCGFSPRAEVVFTGTSSPNKDTPGTLQFFDPMTFDLVYKIDYPGISCHRIQWHPRLNQIIAGLSDGIHVYYD. 447
34 -49.400[I] KOG0301 Phospholipase A2-activating protein (contains WD40 repeats)  ali follow..  12  1MADDGLGDVPMETESMPQYTISHVIEAHKSDTKALAVTQGGC-LISGGRDETVKFWAKKGKQYTKTHAF---------------EQPKGITVNSIAYAELADGWRLFVGRRDGTIAVFGPSQAEPYAI-------------------------------------------FNEHKQNVCCLHINEKATHMLSGSDSNVIIWPITELNSS----SFTTIVCPGHTLSVWALASFPDLPNTYLSASADKTIRMWFGDT------------------TLSVFKGHTDVVRALVVLSSSHFLSAGNDGHIIHWDVAS-ASILRKFATQA----------------HEFIYSMTLSDSHILTTGEDGTLEFWAIDGGKDGNLAIVSEAVIQL--------------------------------------------PTTNTWDAKVLLNSDIAVAGSDGRIYIMTT. 321
35 -49.200[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  11  164.LVVGYIEGQLNLYNIMRGAPKKTWKSHNSHITALLQVPDSRVVVALSRDQTMSIHETETQETLRVLPLYIEGGAIGHNGNLFTVRIASSNLDHLAYDVVSN--RFLAISAEQNLIILDFENLKIARQIVGFHDEIYSCCLLGKDESHMAVASNTSEIRLYNTKTLDCQLIRGHTESVLSVVSPTWDTSLLASCSDNSIIFWRLVTSPENDSCSTLVVAAATGHANTVTALAISNTGRAFLASVSTDCTIKLWGLGVSTKIDAEKDFVEQLPKLTCSSTMVAHGKDVNCVDISESDALIATGGDKLVKLWQVDTHKGIAGTLSGHRR---------------GVGDVKFAKNSHKLASCSGDMTIKIWNISEKSLQTISGHSCAVFRVIFARNDSQLISADSAGIIKIWTIK----------TADCECSIDAHTDKIWSLSKNHNESEFVTAGTDGIVVWKDV 637
36 -49.100[YU] KOG2445 Nuclear pore complex component (sc Seh1)  ali follow..  12  6.........................SGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWR--------------AHDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRR------------------------------------------------------------------------------------NKLCTLNDSKGSLYSVKFAPAHGLKLACLGNDGILRLYDALEPSDLRSWTL---TSEMKVLSIPPANHLQSDFCLSWCPSRFKLAVSALEQAIIYQRGKDGKVAAKLPGHKS---------------LIRSISWAPSYQLIATGCKDGRIRIFKITEKLSPLASEESLTNSNMFDNS-----ADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGVRLWKA. 333
37 -48.900[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  14  4.........................CGHTSPVDSVAFNSEEVLVLAGASSGVIKLWDLEESKMVRAFT------------------GHRSNCSAVEFHPFGE--FLASGSSDTNLRVWDTRKKGCIQT-------------------------------------------YKGHTRGISTIEFSPDGRWVVSGGDNVVKVWDLTAGKLL--------HEFKCHEGPIRSLDFHP-LEFLLATGSADRTVKFWDLETFEL----------------IGTTRPEATGVRAIAFHPDGQTLFCGLDDGLKVYSWE-PVICRDGVDMGW----------------STLGDFCINEGKFIGCSYYRNSVGIWVSDISELEPYGAVSEDKNECMVKR------------------SVLNDQSERMGSGPRGSVSPDYETREIKNIYVDSTGGNLNVAQNPGLKATL.. 319
38 -48.900[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  245CAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGEITSLLLDTRRKLPLIRSKKVVLCVTFSENGDTITGGAHEGGISPLCMLRDGT--LVSGGGKDRKLISWSGNYQKLRKTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTL--SGDFTPITQGHTDELWGLAIHASKPQFLTCGDKHATLWDAVGHRPV---------WDKIIEDPAQSSGFHP-SGSVVAVGTLTGRWFVFDTETKDL----------------VTVHTDGNEQLSVMRYSPDGNFLAIGSDNCIYIYGVSDNGRKYTRVGKCSGHSS------------FITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCNAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDIMQWRVI 717
39 -48.800[R] KOG2096 WD40 repeat protein  ali follow..  53HPAPKKNHPKSQASDKNQNKRHHP-KGHGDAVTGLCFSSDGKSLATACADGVIRVFKLDDASSKSFNRWEFTLQAHFHDLTVFINLPAGGHPTAVAFADDASKQKDQQGKLPLPSIKWDHHHIHEKRSVLTISGATATYGTADGSVVIASCSEGTDIVLWHGKTGRNLGHV-DTNQLKNHMAAVSPNGRFLAAAATADVKVWEIVYQKDGSVKEVSRVMQLKGHKSAVTWLCFSP-NSEQIITASKDGSIRVWNINVRYHLDEDPKTL--KVFPIPLCDSGGNPLHYDRLSLCPEGKILAASHGSTLQWLCAETGNVLDTAEKAHEG---------------DITCISWAPKAMVLGTSGDDKKVKLWEAPKSQ......................................................................................... 452
40 -48.800[R] KOG0289 mRNA splicing factor  ali follow..  11  110HDAACRVIARLTKEVTAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRVGLHSASIPGILALDLCPS-DTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVV-RAHESAVTGLSLHATGDYLLSSSDQYWAFSDIQTGRVLTKVTD------ETSGCSLTCAQFHP-DGLIFGTGTMDSQIKIWDLKERT----------------NVANFPGHSGPITSIAFSENGYYLATAADSSVKLWDLRKLKNFKTLQLDNNF---------------EVKSLIFDQSGTYLALGGTD--VQIYICKQWTEILHFT---------------------------------------------------EHSGLTTGVAFGHHAKFIASTGMDRLKFYS.. 503
41 -48.600[T] KOG0279 G protein beta subunit-like protein  ali follow..  14  2...............AEGLVLKGTMCAHTDMVTAIATPVDNDVIVTSSRDKSIILWKLTKEDK-------------SYGVAQRRMTGHSHFVQDVVLSSDGQ--FALSGSWDGELRLWDLATGESTRR-------------------------------------------FVGHTKDVLSVAFSTDNRQIVSASDRTIKLWNTLGECK------YTISEADGHKEWVSCVRFSPNTLPTIVSASWDKTVKVWNLQNCKL----------------RNTLAGHSGYLNTVAVSPDGSLCASGGDGVILLWDLAE-GKKLYSLEAGS----------------IIHSLCFSPNRYWLCAAT-ENSIRIWDLESKSVVEDLKVDLKAE--------------------------------AEKTDGSTGIGNKTKVIYCTSLNWSADGNTLFSGYTDGIRVWG.. 322
42 -48.500[BK] KOG1063 RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily  ali follow..  192ALALGGLDNKIKLYSGERTTSVCELKGHTDWIRSLDFSLPLHMLVSSSQDKVIRIWKLVLVGDVGSWRREITLASYIEGPVFVSGIGHEDWVYSVEWQPPVQPLSILSASMDKTMMIWRPEKKTCVGELSHCALGFYGGHWSPNSLSILAHGYGGAFHLWRNVSSSQMQKVPSGHFAAVTDVTWARTGEYLLSVSDQTTRVFSAWKNDEGNEAHELARPQVHGHDINCVAMVQGK-GNHRFVSGAEEKVVRVFEAPLSQSASMAEIWLWEVGTWKAVGRLQSHSLTVTHLEFSYDDTLLLSVSDRHFSVFSIQRTDKLMAKVEAHKRI---------------IWACSWNPFGHQFATSSRDKTVKIWSVENDARIKQILVLPPFGSSVTAVA-AVGMESGLIELSNVKIIETEEGTTATAALALRLEPFMCHVSAVNRLAWRPTEKWLTSCGDDNVRVFN.. 837
43 -48.400[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  3MDIGKALSDVGGLRDITSRANNSLPTPDSSPAAPSKKHKLYDFLESRGKIETPRKRIVFEKELLIRQLGGSRSHPFSTKTSRHVGMMLNQLPFCLGFANNES--LLAVCTETGALELFDSRFYDRQNEENQPSARRIHG--------------------------------WLAHNNAIFSVNFSKDDSLLATSSDQTSKVFDLSTQQCITRL--GRRGVDGYHSHSVKQVNFCNDSPYNLVSCSRDGSIIFWDMRTHGITIDGEHFQKPVLRIRKAHENSGRDCSITSATWLPQSTISSCSANSALKLWDLRTVH------TVRPLPAATTPELTTSKRDFGVTNVCTSPDGERIYAASRDSIIYEYSSRHLNSGFCKTYKDPRLRISSFYVKLACSPDGATLACGGGVQDKTSGVDTTRNCSSSAMLTGGHTKDVTAVDWSSEGQLASISDDGSVRVWN.. 464
44 -48.400[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  11  6LDPSNLVKNREILYRLMISQLMYD--GLEKFAMELSMLVKADQCAPSERLLHVMIAGMQTLKTNSDDVLPGIDLEFEPEASALAPTSHKQACRAGAFSCDGS--LVATGSVDASIKILDVERMLAKSAPEDIEPGRE-------------------------QQGHPVIRTLYDHTDEVSYLEFHPKEHILASASDGTVKLFDIAKPSV------KKAHKVFTDCEPVLCLSFHP-TGDYVAIGTEHNVLRVYDVATTQC--------------VSAIPSQQHKAGVTCVKYSPTGKLYATGSDGDIKIWDGIS-GRCINTIAEAHGGA-------------AICSLEFTRNGKYLLSSGMDSLVYLWELCTSRPIQTYTGAGTTGKQEHQTEAVFNHTEDYVLFPDEATTSLCSWNSRNGCR--LTLNSLGHNGPVRYITHSPNGPAFLTCSDDFARFWY.. 418
45 -48.100[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  77VFAVSTSDGKINILSRNGKVENMVD-AHNGAALCARWNSDGTGLLSSGEDGFVKMWSRSGMSVLAQFATAVYCVAWDSTSSNVKWKAHDGIILCCDWNPTSD--LIVTGGEDLKFKVWDGFGQILFN--------------------------------------------SSVHDYPITSISWNTDGTLFAVGSHNILRLCDKS---------GWSHSLEKMNAGSVMALSWSP-DGTQLAVGTAAGLVFHAHIIDKRLTYEEFEIVQTQKSSKNWNTPTMIEYNERTVNIIVQCEKIFLSDGMTITIFTYEGRKLINLNPPG-------------VMALLDERKIDLANDTLVVRDRADNKVLHFFDPTTGKAQG----DGNLKHEHDIVELTVNQCGPLNDRNVAFRDQIGAVHIAMVKTFGVSQRMVKIGSLVEQLVFNDVTNMLCGISEGKIAVWP.. 531
46 -48.100[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  12  2..............SAVCGGAARMLRTPGRHGYAAEFSPLPGRLACATAQGTLLILDPDEAGLR-----------------LFRSFDWNDGLFDVTWSENNE-HVLITCSGDGSLQLWDTAKAA------------------------------------------GPLQVYKEHAQEVYSVDWSQTRGVVSGSWDQTVKLWDPTVGKSL--------CTFRGHESIIYSTIWSPHIPGCFASASGDQTLRIWDVKAAG----------------VRIVIPAHQAEILSCDWCKYNELVTGAVDCSLRGWDLRNVRQPVFELLGHTY---------------AIRRVKFSPHASVLASCSYDFTVRFWNFSKPD--------------------------------------------------SLLETVEHHTEFTCGLDFSLQSPQVADCSWDEIKIYD.. 315
47 -48.000[Z] KOG0313 Microtubule binding protein YTM1 (contains WD40 repeats)  ali follow..  13  76...SSEEVVEIEYVEKCTAPQPEQCMFHDDWISSIKGAEEW--ILTGSYDKTSRIWSLEGKS-------------------IMTIVGHTDVVKDVAWVKKDSSCLLLSASMDQTILLWEWNVER---------------------------------------NKVKALHCCRGHAGSVDSIAVDGSGTKFCSGSDKMLKIWSTVPTDEEDEMEESTNRTLSGHMEAVSSVLWSDAE--EICSASWDHTIRVWDVGSGS-----------------LKSTLTGNKVFNCISYSPLCKRLASGSDRHIRLWDPRTKDGSLLSLTSHTG----------------VTSVKWSPTHQQLISGSLDNIVKLWDTRSCKAPLY--------------------------------------------------DLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYR.. 413
48 -47.800[S] KOG0282 mRNA splicing factor  ali follow..  13  261VGVNLRSTMPPEKCYLPKKQIHV--SGHTKGVSAVRLFPLGHLLLSCSMDCKIKLWEVYGERRC-----------------LRTFIGHSKAVRDICFNTAGT--QFLSAAYDRYLKLWDTETGQCISRFT--------------------------------------------NRKVPYCVKFNPDEDFVAGMSDKKIVQWDIRSGEIV--------QEYDRHLGAVNTIVFVD-ENRRFVSTSDDKSLRVWEWDIPVDFK---------------YIAEPSMHSMPAVTLSPNGKWLACQSDNQILIFGAQNRFR-----------LNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFK---------------------------------------------------AHDKVCIGAVWHPETSKVITCGWDGIKLWD.. 579
49 -47.600[A] KOG0285 Pleiotropic regulator 1  ali follow..  10  91ELRKSATEKALVVGPTLPPRDL-NNTGNPGKSTAILPAPGSFLSTAALMERMPSRWPRPE---------------HAPWKNYRVLQGHLGWVRSVAFDPSNE--WFCTGSADRTIKIWDVATGVLKLTLTGHIGQVRGLAVSNRHTYMFSAGDDKQVKCWDLEQNKVIRSY-HGHLHGVYCLALHPTLDVVLTGGDSVCRVWDIRTKMQI---------FVLPHDSDVFSVLARP-TDPQVITGSHDSTIKFWDLRYGK----------------SMATITNHKKTVRAMALHPKENDFVSASADNIKKFSLPKGEFCHNMLSLQRDI---------------INAVAVNEDGV-MVTGGDKGGLWFWDWKSGHNFQR-------------------------------------------AETIVQPGSLESEAGIYAACYDQTGSRLVTCEGDKIKMWK.. 454
50 -47.400[A] KOG0299 U3 snoRNP-associated protein (contains WD40 repeats)  ali follow..  10  124...........KINPDVKIETAQLRGRHMRPLVGVVAYENF--VYSADKSGLIQKWEALQEKDTENRENDDHEIG-KFSRSRRGENDHVKEITCLAISNDGR--WIVTGGLDHRIVIRDSVTLEPQHC-------------------------------------------WKHHRDAVMGLAMRRGTNEMFSCSDRSIKVWSLDQMSYI--------ETLFGHQDVIFGVDALA-RERCVSVGGRDRTSRLWKIVEES-------QLVFRSGGTSMKATAGYMEGSVDCVAMIDEDHFVTGSNGVIALWSVQR-KKPLFTYPLAHGLDPILAPGRHSAETSPITSLAAIPYSNLFASGSWDGNIRLWKIAEGLRSF---------------------------------------------EPLTIATPLSVYGCINSLSLSLQGKVFAACGRETVGRWK.. 494
51 -47.300[R] KOG1188 WD40 repeat protein  ali follow..  15  31...............................TSKTVQAGKENLVAVLCSNGSIRIYDKERLNVLREFS------------------GYPGLLNGVRFANSCD--SVYSACTDGTVKCWDARVAR----------------------------------------EKPVQLFKGYPSNIFISFDINCNDHIICAGDDALLVFWDARMNSQNLSTTKDSLAYSETHSDDVTQVRFHPSNPNMVVSGSSDGLVNVFDINIDN-------------EEDALVTTCNSISSVSCIGWSGKGYIYCMTHDEGFYWWDLNHLDTDEPVTRLNIQDVREVVNMKEDALDY-LIGGLYHEDTLHVIGGTNKGRIHLMNCSMSGLTHVTSLQG------------------------------------------------GHAATVRSFCWNVQDDSLLTGGEDALLLWK.. 349
52 -47.100[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  10  2..................................SFFNRSNTTSALGTSTAMANEKDLAN--------------------DIVINSPAEDSISDIAFSPQQD-FMFSASSWDGKVRIWDVQNGV------------------------------------------PQGRAQHESSSPVLCTRWSNDGTKVASGGDNALKLYDIASG---------QTQQIGMHSAPIKVLRFVPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPERANPTTIFKATTSPLKWQTRCVACYNEADGYAIGSEGRCSIRYIDDGMQKKSGFS-RQTNPNRAPGSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQRHRLKGYP---------------------------------------------------TLQASIPVCSFNRNGSVFAYALSYD....... 333
53 -47.000[R] KOG2394 WD40 protein DMR-N9  ali follow..  149LVFNVSDAIFICDLNSQEKDPVKSIHFSNSNPMCHAFAKDGHDLLIGLNSGDVYTVSLRQQLQDVS-KKLVGALHYNKD----SVNNRQDRCTSISWVPGGDG-AFVVAHADGNLYNKDGATESTFPAIRDPTQFSVDKAKYSKSNPVAR---------------------WHICQGSINSIAFSNDGAHLATVGDGYLRIFDFLTQK--------LVCGGKSYYGALLCCSWSM-DGKYILTGGEDDLVQVWSMEDRKV----------------VAWGEGHNSWVSGVAFDSNWRFGSVGQDTQLLLWDLEM-DEIVVPLRRAPGGSPTYSTGSSAHWDNVLSGLMFTQES--VVTACREGHIKIWTRPSESETQT------------------------------------------------NSSEANPTTALLSTSFTKDNKASLSSKIISSTFKQ.. 556
54 -46.900[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  8ILATGGYDHTIKVWQAHGNCIKTMRFVETSQVNALDRTPDKTRLAACG-YQCIRLYDLESNCTAP----------------VINFDGVQKNVTRLGFQEDGN--WMFTAGEDHHVRIWDMIAAPPHCSRIFDCEAPVNAACLHPNQVEIAMGSQNGSVFLWDVKSERHERIVPEVDASIQDVAISPDGRYLAAANKGNCYIWSLTSQDQKMSTLRPN-RKIPAHSRYILRCKFSP-DSRLLLTTSGDGTVCIWKTDDFS----------------KWRELCIENYWVWDAAFSADSKWLFTASDGIARLWKLQT-KSSIRDYTGHTK---------------AITALSFKDEIPVKSTNISDVQSSAKPPTQRD---------------------------------------------------------NPPGTNNLAFFETVGRVAMNPYMGNTTELN.. 362
55 -46.700[R] KOG2919 Guanine nucleotide-binding protein  ali follow..  11  106YFQGALVELGRRCWT--------SSTEAQHYTKGCYWSPDGTCLLVPVHLDGMHVIEMPSDLYSADT---VQPARSLTKLQSEVHVPEGGTVYDCVWYPHMNTCLWLATRQHEPIHMWDAFDGSLRCSYSGYDA--------------------------------------VDEVMAAISLAFSHDGEQIYAGYKRCIKIFDTSRPGRF--------CDDYPVKFAISCIAQTTAHPHTLTCGNWHGYIQHFDLRCSH-------------KQGPLFTLGGHKGGITQLRYGEFGNFSGARKCDKILQWDMRNYKQPLVELQRHVDTNQRI-------------QFDLASDSNWLASGDTRGFVNVWDLKKYGDPSVLP---------------------------------------------------LHSDCCNGVALNPAMPILATSSGQFHF..... 439
56 -46.400[R] KOG1273 WD40 repeat protein  ali follow..  12  2.........NAPIIDPLQGDFPEEEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDFETRGIAKE----------------IRDNDCSAAITSVSWSKYGH--RLLVSAADKSLTLWDVSTGEKIARTILQQLSSAPMIVDFDIDCTTLLPVSVPEMPDVLAPPQRSKCPESNPPFSPAAACFNKCGDLVYIGNKGEILIVDYKSVRVLALVS-------ASGAAPVKNIVFSR-NGQYLLTNSHDRTIRIYENLLPAKNKMKTV---GSKCLTLFREFQDSVTKWKAPCFSGDGEWVVGGSEHKIYIWD--RAGHLVKILEGPKE---------------ALIDLAWHPVHPIIVSVSLAGLVYIWAKDYTENWSAFAPDFKEENEEYVEREDEFDLIPETEKVKVL----------DVNEDEEVDIDTVEKDAFSDSDMSVEELRYLPAEPIP....... 424
57 -46.300[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  13  1..........MSATELPTKEAHI--KGHEGAVLAARFNGDGNYALTCGKDRTIRLWNPHRGILIKTYK------------------SHGREVRDVHVTSDNA--KFCSCGGDRQVYYWDVSTGRVIRK-------------------------------------------FRGHDGEVNAVKFNDSSSVVVSAGDRSLRVWDCRSHSVE--------PVQIIDTFLDTVMSVVL-TKTEIIGGSVDGTVRTFDMRIGRE------------------MSDNLGQPVNCISISNDGNCVLAGCDSTLRLLDRTT-GELLQVYKGHISKS--------------KTDCCLTNSDAHVIGGSEDGLVFFWDLVDAKVLS----------------------------------------------------KFRAHDLVNSIDVDFYLRKFFVAGDKRLPPEG.. 299
58 -46.300[R] KOG4227 WD40 repeat protein  ali follow..  18  26.DPLLTQDFQRRRLRGCRNLYKKDLLGHFGCVNAIEFSNNGQWLVSGGDDRRVLLWHMEQAIHSRVKPIQL-------------KGEHHSNIFCLAFNSGNT--KVFSGGNDEQVILHDVESSETLDVF--------------------------------------------AHEDAVYGLSVSPVNDNIFSSDDGRVLIWDIRESPHG------EPFCLANYPSAFHSVMFNPVEPRLLATANSKEGVGLWDIRKPQ-------------SSLLRYGGNLSLQSAMSVRFNSNGTQLLARRRLPPVLYDIHSRLPVFQF------------DNQGYFNSCTMKSCCFAGDRQYILSGSDDFNLYMWRIPADPEAGGI----------------------------------------GRVVNGAFMVLKGHRSIVNQVRFNPHTYMICSSGVEKIKIWS.. 361
59 -46.000[Y] KOG4714 Nucleoporin  ali follow..  10  12............................SEKVSQVRWLPEEERFVTGSWDNFVRLWRLQSNQYVTATDSEVD-----QIPRCMDKVRMEDDVTAMEFVDKD---TLAVSCADGHLSVFNVHRAVEEDQMQR-------------------------------TSRSGRLHCFQRSQEPAPCTDLSVYGTDIATAGDGCVSIVSVENVRQV-------KRQIEADSMALFSICYI--SQQELVTANRMGVIRMLDARVATEA--------QPKTTFMVASQDDKSNFVSSLAKHPMQQHILLSEEGSITVWDMRNLSYPASYLSAHKS---------------PINEIGFHQDPSKLFTAAEGGEVWMWSENKVLGCDYNKDGHSPWLSG----------------------------DRVRSLVDVEGVLSNVRKSIN--SFDVHGSRLVCGGDTEVYLVDNI 357
60 -45.900[R] KOG1539 WD repeat protein  ali follow..  10  246LLASGGSFGVISIWNLNKRLQSVIRDAHDSSIISLNFLANEPVLMSASADNSLKMWIFDTNDGDPRLLRFRS--------------GHSAPPLCIRFYSNGR--HILSAGQDRAFRLFSVIQEQQSRELSQRHISRRAKKLRLKEEELKLKPVVSFDCAEIRTPIKGVFVSRNHLLLAILACAISACGNFAVVGAGGWIERFNLQSGISRGSYFDMSEKRRYAHDGEVIGVACDS-TNTLMISAGYHGDLKVWDFKKRELKSQ------------------DVGCSLVKIVYHRVNGLLATVDDFVIRLYDVVT-LKMVREFRGHTD---------------RITDLCFSEDGKWVISSSMDGSLRIWDVILAK----------------------------------------------------QIDGVHVDVPITALSLSPNMDVLATAHSDQVYLWVN. 649
61 -45.600[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  11  4.................NQQPPSNLQTYGVPIYAVDWILEEAVRSKITKDQDDDDDDGSSSSSYIVLSGGGGEGRSLSEQPIGRRVIGTDLPYRMAIHPRQGGLICALPNSENIIEDDNEEESEKVVKELKDVGQQLSLSFNQDGTVLATGAEDGTLRVFEWPSMKTLLN-ESKTHASVKSLTFSESGKFLVSLGAPLCRVWDVNASAAIASLS-------KEKDEMFASCRFSVDNSGVAANTQRGGSIITWDTTSWR---------------RRSSKLIKRNNSISAFNVSADGKLLAVGTEGDVLIIDSTKMQTNQIVKKAHLGL---------------VTALTFSPDSRCLVSVSFDSRARLTVIKQKGEKRR--------------------------------------------------VYLWVAALLFVLVYVVLYYLMVAMGIIH....... 383
62 -45.300[R] KOG0322 G-protein beta subunit-like protein GNB1L, contains WD repeats  ali follow..  15..........................PDMGAVNSLCFQESDR-LLAGTIKGSVFLWDLQTNRSALHFE------------------VGSDPITSLHHTPDR----LVTQEKGGTITMFSIGGSSYVKERSIPGNH------------------------------------LGFCRSALHTNTSKTNEQLLFYPEESSIGVLHVTDAAAPTQILVPDDPQLPKLGSVTCFKPFECASQLFLLAGYESGHFLTWDISSSVIL-----------------DVMELAQDATSVDYDPVTNRGIVGGTDKLISFSYQRSSMQMQLGSELCIKNP------------GVNGVRIRPDQKVFASAGWDGRIRIFSWKSLRPLAVLTQHK--------------------------------------------------NGGVMDLAFSSQAPIMAAAGMDGISLWD.. 320
63 -45.200[R] KOG0646 WD40 repeat protein  ali follow..  11  5VIASSSIDEGIGSWDLKTGTEQLQFKPCASPAHGLTAVGESSQLSARNTSGSIFYWSWTKP-------------------QAEVKSYPVEPIKALAANNEGT--YLVGGGISGDIYLWEVATGKLLKK-------------------------------------------WHGHYRSVTCLVFSGDDSLLVSGSDGSIRVWSLIRLFDDFQRQQGNEHNFNEHTMSVTDIVIDYGGCNVIISSSEDRTCKVWSLSRGKLLKN------------------IFPSVINALALDPGGCVFYAGADSKIYIGAINAGTQVLGSVSEKGK---------------AITCLAYCADGNLLISGSEDGVVCVWDPKSLRHVRTLIHAKGSRKGPVNNIQIVRKTIVANSNKTQVS------------KSRGALIPPPLEKYERPVEDTMDGIVTVDPPPFS....... 367
64 -44.800[S] KOG0283 WD40 repeat-containing protein  ali follow..  11  325SVRLSKRRGAALLKNIKGHSMSLRVADKDVSDGSTDSPKKGKDHKHGKANEWVKVRPTGKSYKELSALHMCQ-----------EIQAHEGAVWTIKFSQDAH--YLASGGADRVIHVWEVQECELMSMNEGSLTPIHPSLCDSSGNEITVVEKKKKGKGSSGRRHNHIPDYVKGHLDAILDLSWSKSQLLLSSSMDKTVRLWDIETKTCL---------KLFAHNDYVTCIQFSPVDENYFLSGSLDAKIRIWSIQDRH-----------------VVEWSDLHEMVTAACYTPDGQGALIGSKGICRAYDTEDCKLSQTN-------QIDVQSNKKSQAKRKITSFQFSPVNPEVLVTSADSRIRILDGSEVIHKFK---------------------------------------------------GFRNTCSQLSASYSQDGKYIICASEDSVYLWK.. 710
65 -44.600[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  12  105YAVPADSTPDVPVDCILTKFIRTAMNKVKCPVYSVCWSPEGKRLITGCQTGEFTLWNGTAFNFETILQ------------------AHDSAIRALKWASNEQ--WLLSADQGGYVKYWQPNMNNAHMFSAHKDEAIRGLAFAPTDVKFATASDDGTARVWDFARYTEERVL-RGHGAEVRCIDWHPTKGLIATGSRDTVKIWDPKSGSCL--------ATLQEHKSSVMAVEFNK-NGNWLLTGGRDHLVKMYDIRMMK----------------EMRTYRAHKKEVISLAWHPIHEGLFVSGDGSIVYWMVDGEKEIGLLEHAHDQ---------------AIWSMKWHPLGHILATGSNDNNTKFWARNRPGDTVED------------------------------------------IFGLSNTNMIGHLDKEREPRMAPPKPSIETQETYR....... 462
66 -44.400[R] KOG2055 WD40 repeat protein  ali follow..  196.LLAPGTINIKRLKDA------NFQAPSHSGIRCMSIHPYFPLLLTCGFDRTLRIYQLDGKVNP-----------------VTSLHLRSSALQTALFHPDGK--RVIAAGRRKYMYIWDLESAQVQKVQENFQPSMERFHVDPTGKYIALEGRSGHINLLHALTGQFATSF--KIEGVLSDVLFTSDGSEMLVLSGAEVWHFNVEQRSVVRRWQV-------QDGVSTTHFCLDP-SNKYLAIGSKSGIVNIYDLQTSN----------ADAAPKPVTTLDNITFSINSMSFSQDSQVLAIASKDTLRLVHVPS-FSVFRNWPT------------SATPLGRVTCLAFGKGGE-LCVGNEAGRVGLWKLAHYDLKFVPD-----------------------------------------------------KIINWEIRLGKFGYVLLGIQIDVVIL.... 556
67 -44.300[R] KOG4497 Uncharacterized conserved protein WDR8, contains WD repeats  ali follow..  24...ASCVQYRLVVRDVNTLQI-LQLYTCLDQIQHIEWSADSLFILCAMKRGLVQVWSLEQPEWHCKID------------------EGSAGLVASCWSPDGR-HILNTTEFHLRITVWSLCTKSVS-YIKYPKACLQGITFTRDGRYMALAERRDCKDYVSICSDWQLLRHFDTDTQDLTGIEWAPNGCVLAVWDTCEYKILLYSLDGRLLSTY-----SAYEWSLGIKSVAWSP-SSQFLAVGSYDGKVRILNHVTWKMITEIASVPVSLQTLKPVTDRANPKMGIGMLAFSPDSYFLATRNDNAVWVWDIQKLR--LFAVLEQLS---------------PVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQV---------------------------------------------------PGEGDFAVLSLCWHLSGDSMALLSKDHCLCF... 442
68 -44.200[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  11  97PHQNPKPVKPRRYIPQNERVLDAPGLRDDFSLNLLDWGSANVLAIAL--GDTVYLWDASSGSTS----------------ELVTIDEDKGPVTSINWTQDGL--DLAVGLDNSEVQLWDCVSNRQVRTLRGG-HESRVGSLAWDNHILTTGGMDGKIVNNDVRIRSSIVETYLGHTEEVCGLKWSESGNKQASGGDNVVHIWDRSLASSK--QTRQWLHRFEEHTAAVRALAWCPFQASLLATGVGDGKIKFWNTHTGACLNS------------------ETGSQVCSLLWSQSERELLSSTQNQLTLWKYPS-MSKMAELNGHTS---------------RVLFMAQSPNGCTVASAAGDENLRLWNVFGEPPKTTK----------------------------------------------------KAASKKYPELFSHVNSL............... 443
69 -43.900[R] KOG0288 WD40 repeat protein TipD  ali follow..  14  203.IVRRNEDGTDHFVETIPSTCANRIHAHEGGCGSIVFEYNSGTLFTGGQDRAVKMWDTNSGTLIKSLY------------------GSLGNILDMAVTHDNK--SVIAATSSNNLFVWDVSSGRVRHT-------------------------------------------LTGHTDKVCAVDVSKFSSRHVVSADRTIKLWDLHKGYCTNTV---------LFTSNCNAICLSI-DGLTVFSGHMDGNLRLWDIQTGKL----------------LSEVAGHSSAVTSVSLSRNGNRILTSGDNVHNVFDTRT-LEICGTLRASGNRLAS-----------NWSRSCISPDDDYVAAGSADGSVHVWSLSKGN---------------------------------------------------IVSILKEQTSPILCCSWSGIGKPLASADKNGVCTWT.. 515
70 -43.700[E] KOG0280 Uncharacterized conserved protein  ali follow..  4.................TGIIPKSTDYTDWPADVCKYSQVFEDVLVV---GTYMLDESTKLRH---------------------KLVLYDTKEDVLSPHDAS--VLAVAHSTGHVSFYRHQFRAELMFLRGIK--------------------------------------VADSSVLMLSLDFSDSGKELAVSSNGSVLIIDIDSGVIK--------NKWKEHDYEAWTCHYSRQDNNLLYSGGDDAALVCYDQRIPN-------------SCIWRDIQVHHSGVVSILSRAPFGPYIATGEGDFMHTLDTRNIGKPLFSANLGGG----------------VWRLEHMETTEKVLGILMHRGAQVLRISNDF----------------------------------------------SSIDASKRIFKEHESMCYGGDWRHTDGLLATCSDKRVCLWEDI 310
71 -43.300[S] KOG0270 WD40 repeat-containing protein  ali follow..  11  113HEGEKGEDPYISLPN---------QEDSQEEKQELQVYPSDNLVLAARTEDYLDIYVYDDGAGFHSSDIPVEEGDEADPDVARGLVRDPDYKVGSNSEEAAN--YAAIGTFDPQIEIWNLD--------------CVDKAFPDMILGEPLDNSMVSLKSKKKKKKSKTGHITTHHTDAVLSMAHNKYFRSVLASTDHTVKLWDLNSGNAARSL------ASIHSNKNVSSSEWHMLNGSILLTGGYDSRVALTDVRISD------------ESQMSKYWSAMAGEEIETVTFASENIILCGTDSGNVYSFDIRNNEKPVWTLKAHDA---------------GISTLCSNKPGMMSTGAMGEKTVKLWKFPLDD-------------------------------------------ATNTKGPSMVLSRDFDVGNVLTSSFAPDIETMVIGGVNKLKLWD.. 505
72 -43.000[KL] KOG4283 Transcription-coupled repair protein CSA, contains WD40 domain  ali follow..  12  16.NSFANRFKSRRILSLQLSNRKDFVSPHRGSVNSLQVDLEGRYLLSGAADGSAAVFDVQRATDYEASGLIAKHKC-IFTVDKQHENGHKYAISSAIWYPI-DTGLFITGSFDHYLKVWDTNTAQAVVDFK-----------------------------------------MPGKVYRTAMSSMAMSHTLIAAGTDVQVRLCDIASGAFS--------HTLSGHRDGVMSVEWSTSSEWVLYTGGCDGAIRFWDIRRAGC-------------------FRVLDQSQTQLGFRPPILKRTAVGSKVCS........................................................................................................................................................... 254
73 -42.700[S] KOG2110 Uncharacterized conserved protein, contains WD40 repeats  ali follow..  3...............................FFVRKYRGKAALLSIGTFDG-YKIYNCDPFGKC------------------FHKIQGATSIVEMLFSTSLVALVEKDDGNNRKLKLINTKKSTTICELT--------------------------------------------FPTPLLAVKLNRKRLLAVLEE--QIYVYDISNMLLLHTIEENCYLAYPDSRDHEPRTEGES-SSPNVSNSAVSGQVILWDVINCK----------------QITKIEAHKDSLACLAFNSDGTMLATASDNGIRVFAIPSGQR--------------LYQFRRGSLPAQIYSIAFHPDSSLLTVTSSTQTVHIFRLKEVYSNLERQGLLPSSPPPKESLLRRSSRSLIGTVGGYLPQSVSGMLDPER---DFAYAHIPGDKVTSIAAFGPDNTIVNVATYDGLYSFR.. 351
74 -42.700[R] KOG2444 WD40 repeat protein  ali follow..  2........................LVEFDNPPLCMKSNKDGSRLVVGFVDGSIRFYDTQQH---------------EEEFQEIWKFQTKSSIRGVDLDEHKK--RVYAVTKNRSLCVFDIDTGKRVRCILKCHRSVPTAICTLPPTALKSQQLATADESGEVASENANIRKWQEQDEDINDLKVDVKSNLLATSSDGTLGAYDLRKAK--------LKMRSELMHSELYSVC---GTNRSVYVGGEDGYVEVFNLNE---------------GNLLERVESGFEMGVNGIVELRSGLLGLTSGSNRMRLLNVQ-PSKRLGYAGYHGDE---------KSDDDGIDAITISTDKSTVTMISMSCTIKKWDMGPIIDEIPILRAQDAKSKKMRKTEGFFDGLVGPKNDSDSDDD-------DEPKSKKRRNDEDSDEEIDEEEQEEDDEEEEEDSD......... 383
75 -42.600[B] KOG0264 Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1  ali follow..  12  45.................................TVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARGFGSVTGKIECEIKINHEGEVNRARYMPQNPH-IIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLR---------------------------------LRGHQKEGYGLSWNSSGHLLSASDDHTVCLWDINAGPKEGKIVDAK-AIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNT-------------TSKPSHLVDAHTAEVNCLSFNPYSEFILATADKTVALWDLRNLKLKLHTFESHKD---------------EIFQVHWSPNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLF-------------------------------------IHGGHTAKISDFSWNPNEPVICSVSEDNMQIWQ.. 402

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhao Y, Hong DH, Pawlyk B, Yue G, Adamian M, Grynberg M, Godzik A., Li T. The retinitis pigmentosa GTPase regulator (RPGR)- interacting protein: subserving RPGR function and participating in disk morphogenesis. Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3965-70. Epub 2003 Mar 21.