current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [S] COG5458 Uncharacterized conserved protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MALNLLKLCVGCDSVEDLEEWIEFRLDERRRAGEPAEHWHTTRMVPTRGAEITDGGSLYWVIKGNVQCRQLITEIRPFTDDEGIGRCHLMLDPHVVRTDWQPRRAFQGWRYLKPSDAPPDLGKGKAGMVEMPPKLRRELADLGLLLast
1 -99.200[S] COG5458 Uncharacterized conserved protein  ali  100  1MALNLLKLCVGCDSVEDLEEWIEFRLDERRRAGEPAEHWHTTRMVPTRGAEITDGGSLYWVIKGNVQCRQLITEIRPFTDDEGIGRCHLMLDPHVVRTDWQPRRAFQGWRYLKPSDAPPDLGKGKAGMVEMPPKLRRELADLGLL 145
2 -5.740[KE] COG3060 Transcriptional regulator of met regulon  ali follow..  24  28.......................................................................................SIPLKVLKILTDERTRRQVNNLRHATNSELPDDADLRKERSDEIPEAAKEIMRELGI. 98
3 -5.210[S] COG4318 Uncharacterized protein conserved in bacteria  ali follow..  14  31.DLRPTQLTVGMIEVQAKKTHLAAMAPADQQA-----------MQAHPIPAVLGPGGQLYITDHHHLGRAAL--------DAGVITGYFMVEADLSQHSLDD------WKAMDQNL-PLDEHGVRHYYASIPKHLEK........ 145
4 -5.090[J] KOG3181 40S ribosomal protein S3  ali follow..  48IIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVR-------HVLLRQGVLGI. 184
5 -4.980[S] COG4859 Uncharacterized protein conserved in bacteria  ali follow..  35...ESVKLIFAFDTDNPDAPRAERLWVTVEGIEADGAFSGRLDNYPQYIRDLSLGERIVFEARHIINTEHDPRETPISRYARRCFVTRRVIDEGKAVGYLYREAP-SGWRLMAGDESDDYMNTAGT................... 161
6 -4.970[M] COG3056 Uncharacterized lipoprotein  ali follow..  14  4......................................LHALPTSPRRW-QCYDGGNFY-RVSESPNMFKKILFP-EVSPTITLPQQDPSLMGVTVSINGADQRTDQALAKVTRDNQIVTLTASRDLRFLLQEVLEKQMTARGY. 127
7 -4.880[C] KOG3382 NADH:ubiquinone oxidoreductase, B17.2 subunit  ali follow..  11  1..............MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVG-GNKYYEDNKQFFGRHRWVVYTTEMNGKNTFW----VDGSMVPPE------WHRWLHSMTDDPPTT......................... 100
8 -4.870[J] COG0594 RNase P protein component  ali follow..  4..............................................KTKHHLRDRKVFAALLRSKRRFFSTFLMAYFMPNRVRTWRAAVSISKTKYKLAVERNL--AIMREQFCNLNAVDVGFLELTFKEKQTIFLNLCQKLQEL 112
9 -4.820[R] COG5119 Uncharacterized protein, contains ParB-like nuclease domain  ali follow..  13  1MSLQSNSVKPTEIPLSEIRRPLAPVLDPQKIDAMVATMKGIPTASKTCSLEQAEGQTLYYAFGGRLQAYDRR--------ARETQNAAFPVRCRVLPATPRQIRMYLG..................................... 121
10 -4.810[O] COG5160 Protease, Ulp1 family  ali follow..  12  405....ISERSKIDSSLPRVHGFNTFFYTSLQRRGYAG----VRRWAKKARVNIAD--DVHWCM-AVINKSKKRFEYWDSLAGSPGKVFDLLR--DYYIAETKGAVDVSDWENFMDDNSPRQRNGHDCGQNDMPIKMAASIIDAQI. 567

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 3 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.