current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [R] COG5595 Zn-ribbon-containing, possibly nucleic-acid-binding protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MYLIETYFRLTALENNIESQSRLLNAVIDQWRYNGQIIGREIPLYLAEEDGAQGFAMRVICPEQDSLFPQNNNAEVNRALQEAEKCGVIFDGFQLVGDDFNSDQTAENASPAWQVLYTTHLQSCSPIHSGENFAPIPLYKQLKNQPHLTQDLIKWQENWQACDQLQMNGAVLEQQSLAEISDHQSTLSKHGRYLAQEIEKETGIPTYYYLYRVGGQSLKSEKSRCCPSCGANWALKDAIFDTFHFKCDTCRLVSNLSWNFLLast
1 -112.000[R] COG5595 Zn-ribbon-containing, possibly nucleic-acid-binding protein  ali  100  1MYLIETYFRLTALENNIESQSRLLNAVIDQWRYNGQIIGREIPLYLAEEDGAQGFAMRVICPEQDSLFPQNNNAEVNRALQEAEKCGVIFDGFQLVGDDFNSDQTAENASPAWQVLYTTHLQSCSPIHSGENFAPIPLYKQLKNQPHLTQDLIKWQENWQACDQLQMNGAVLEQQSLAEISDHQSTLSKHGRYLAQEIEKETGIPTYYYLYRVGGQSLKSEKSRCCPSCGANWALKDAIFDTFHFKCDTCRLVSNLSWNFL 261
2 -9.130[S] COG3196 Uncharacterized protein conserved in bacteria  ali follow..  12  5...........................................................................................................................................................................ANHACLPTPLASTTGRGQDHEMPVEETSTPQKLPQFRYHPDPVGTGSIVADEVSCVSCEQRYTYTGPVYELNEAICPWCIADGSAASRF. 98
3 -8.830[J] KOG2768 Translation initiation factor 2, beta subunit (eIF-2beta)  ali follow..  15  158..........................................................................................................................................FRIPPPVCLRDGKKTIFSNIQDIAEKLHRSPEHLIQYLFAELGDGQKRLVIKGKFQSKQMENVLRRYILEYV--------------TCKTCKSI-LKREQSNRLFFMVCKSCGSTRSVS.... 269
4 -8.470[C] KOG3456 NADH:ubiquinone oxidoreductase, NDUFS6/13 kDa subunit  ali follow..  15  51...........................................................................................................................................................QSDYRLQRFDISKKSVNPNVAMHLIDQRPPEDCGDKRVVCDGGHPALGHPKVYI-------NLDKPGVHACGYCGNRFYNSHATKAE-HLNC.............. 140
5 -8.180[R] COG5525 Bacteriophage tail assembly protein  ali follow..  65.......YVVEAMNCLSSRSYDAVVFVAPARTGKTLGLIDGWISYNIVCDPSDML---VVQMTQDKAQEHSK--------RRLAKMFRHSPAIARRLSPHRNDNNVHDKTFRDGSFLKIGWPSINVFSSSDFKCVA------------LTDYDRFPEDVDG-DAFSLASKRTTTFMSLGMTLVESSPGREITDTRWKPSSPHEAPPTTGILSLYNRGDRRRWYWPCPHCGEYFQPSMEASEAARIQCPHCELNNRGVW... 316
6 -8.070[TZR] KOG1704 FOG: LIM domain  ali follow..  14  197.........................................................................................................................................................SWHFHHFQCAQ-----------CNDVLAD-QKYMQRANKPVCLK--------CFHSSS----------STFSCTTCRLHWHASAE------FCCCVCSLLG....... 278
7 -8.050[L] COG3677 Transposase and inactivated derivatives  ali follow..  32  2............................................................................................................................................................................................................................STHCHCPQCGHGNVVKNFVKDKQRFKCKSCQ.......... 33
8 -7.760[K] KOG1194 Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains  ali follow..  18  106.........................................................................................................................NVDNLIHVGTEYQAIQPTAEQLEKEPCRDQQI-WATEYAAMVQAMRRKEIHDDWTAEEISLFSTCFFHFGKRIHAAMPQRSLSSIYYYNTKKVQNHLERVPSGYCENCNAKSDLLILNRVMSRHECKPCIL......... 301
9 -7.720[S] KOG1008 Uncharacterized conserved protein, contains WD40 repeats  ali follow..  14  585.............MQIHDPHLRAVFSFLTMEKDNFDAVLKEEGVSLSDR-----MAFACKYLSETKL-----ADYVAQQIQAAIDGGDLN-GLLLTG------------SQDGIDILQSYMDTSFDVQTV----ALVAINYFRQELFEDKRIQYWIASYLDH-GLWEKRAELDIESIRPSSRSSRTVFLSCNFCGKSVSNALLDEP-----RPRSTTTSTNRLSSCPSCRKP-------------RCSLC........... 784
10 -7.700[J] COG2023 RNase P subunit RPR2  ali follow..  17  29...............................................................................................................................................................................LAERVARYSPDLAKRYVELALEIQKKAKVKI------------RKWKRRYCKRCHT--RLRTKRMPHVVITCLECGYIMRYP.... 107

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.