current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [U] KOG0070 GTP-binding ADP-ribosylation factor Arf1, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKALast
1 -99.200[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali  100  1MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA 181
2 -98.000[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  55  1MDGGVLSYFRGLLGSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSR. 180
3 -96.500[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  67  5LFKGFSKPFSRLFSNKEMRILMLGLDAAGKTTILYKLKLNQSVVTIPTVGFNVETVTYKNIKFNVWDVGGQDKIRPLWRHYFTGTKGLIFVVDSADSNRISEARQELHRIISDREMRDCLLLVLANKQDLPGALSPAQITDVLQLDKLKDRLWNVQPTCALTGDGLLEGLAWLSQNAKLK. 184
4 -95.900[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  45  1MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAK. 180
5 -95.700[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  56  1MGNIFSSMFDKLWSNKELRILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVIKEE. 181
6 -94.700[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  46  3...LLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREALELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSR. 179
7 -89.100[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  30  1MLALINRIFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFADMIPTVGFNMRKITRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQS 185
8 -86.900[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  32  4FDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALLSDEALATVPFLILGNKIDIPYAASEDELRYHLGLTNFTTRPLEVFMCSIVRKMGYGEGFKWLSQYIN... 193
9 -84.800[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  31  1MFHLVKGLYNNWNKKEQYSILILGLDNAGKTTFLETLKFKALEKIQPTVGQNVATIPVDSKQLKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVMDEEIEGVPILMLANKQDRQDRMEVQDIKEVFNKEHISARDSRVLPISALTGEGVKDAIEWMIVRLERN. 189
10 -53.300[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  18  39LATIWLLSIRLFRRTKSNTVLLSGLSGSGKTVLFYQLRDGSSHGAVTSMEPNEGTFKGKVKPVHLIDVPGHSRLISKLEEYLPRAAAVVFVVDALEFLPIRAASEYLYDILTNASVNKTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKLRVSRSAISTADIANDFTLGIEGEVFSFSH.. 230
11 -39.500[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  20  46TEEGVLDFSDPFSTEVKPRILLMGLRRSGKSSIQKVVSPNETLFLESTNKICREDVSNSFVNFQIWDFPGQIDFFDPYEMIFRGTGALIFVIDSQDDYMEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQRANDDKIHLSFYLTSIYDHSIFEAFSKVVQKLIPQ. 240
12 -34.500[R] COG2229 Predicted GTPase  ali follow..  17  2...............RENKIIFTGPVGVGKTTAIAAISDEALVQTNTTVAMDYGAISLEDTKVHLYGTPGQERFNFMWEILSQGSMGLVLLLDNARTNPLKDLEFFLHSF--RGLLEKAPVVVGITKMDIRSQPGIDVYHKYLAKHNLN-----VFEIDARKEDDVKQLVSAMLFSIDPG. 175
13 -32.700[R] KOG0091 GTPase Rab39, small G protein superfamily  ali follow..  23  10.................FRLILIGDSTVGKSSLLKFFTDGKFALSDPTVGFFARLIEMKDIKLQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAGGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYAR. 178
14 -31.900[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  23  13.................FKLVLVGDGGTGKTTFVKRHLTGEFEKKIATIGVEVHPTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL--VRVCENIPIVLCGNKVDVKERKVKAK-----TITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNP 174
15 -31.300[U] KOG0081 GTPase Rab27, small G protein superfamily  ali follow..  20  10.................IKFLALGDSGVGKTSVLYQYTDGKFNKFITTVGFREKRVVYQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLE---DQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKR. 184
16 -30.700[R] KOG0080 GTPase Rab18, small G protein superfamily  ali follow..  23  9.................LKILIIGESGVGKSSLLLRFTDDTFDELAATIGVDFKSVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFA----RKHSMLFIEASAKTCDGVQCAFEELVEKIIQT. 172
17 -30.600[R] KOG0394 Ras-related GTPase  ali follow..  15  9.................LKVIILGDSGVGKTSLMNQYVNKKFSNQKATIGADFLTFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNEEFLIQASPSDPENFPFVLIGNKVDVDDGNSRVVSEKKAKAWCASKGNIPYFETSAKVGTNVEEAFQCIAKDALKS. 179
18 -29.600[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  19  9.................FKLLLIGDSGVGKSCLLLRFADDSYLSYISTIGVDFKEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYAS-ENVNKLLVGNKCDLT---SQKVVSTETAKAFADELGIPFLETSAKNATNVEEAFMAMTAAIKTR. 172
19 -29.600[TU] KOG0078 GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins  ali follow..  17  10.................IKLLLIGDSGVGKSCLLLRFSEDSFTSFITTIGIDFKELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNV-EQHASENVYKILIGNKCDCE---DQRQVSFEQGQALADELGVKFLEASAKTNVNVDEAFFTLAREIKKQ. 173
20 -29.600[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  19  13.................FKIVLLGEGCVGKSSLVLRFVENKFSKHLSTIQASFQNVEDCQADLHIWDTAGQEKYHALGPIYYRGSNGVLLVFDITDRKSFEKVKNWVLEIKTCLG-NTAEILIVGNKIDLE---EERQVTRQDAEAYAESEGALYMETSAQDNVGISDAFESLTAKMIEH. 176
21 -29.600[R] KOG0079 GTP-binding protein H-ray, small G protein superfamily  ali follow..  15  11.................FKLLIIGDSGVGKSSLLLRFADNTFSNYITTIGVDFKDINGQRVKLQIWDTAGQERFRTITSTYYRGTHGVVVVYDVTNGESFGNVKRWLQEI--ENNCDSVQKVLVGNKCEEN---ERRVVLESDARNYAQSMNISFFETSAKEDKNVEPMFTCITSLVLTA. 173
22 -29.500[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  19  21.................FKLVLLGESAVGKSSLVLRFVKGQFHEFESTIGFLTQTVCLDDVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQAS-PNIVIALSGNKADLA---NKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKN. 184
23 -29.400[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  20  10.................YKLVFLGDQSVGKTSIITRFMYDKFDTTQATIGIDFLSLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRNERA-GDVIIVLVGNKTDLV---EKRQVSIEEGDSKGREYGVMFIETSAKAGFNIKPLFRKIAAALPGM. 173
24 -29.300[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  17  10.................FKIVLIGNAGVGKTCLVRRFTQGLFPGQGATIGVGFMEINGEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYAS-NKVITVLVGNKIDLA---ERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISE. 173
25 -29.100[U] KOG0086 GTPase Rab4, small G protein superfamily  ali follow..  22  9.................FKFLVIGSAGTGKSCLLHQFIENKFKDSNHTIGVEFGNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLAS-PNIVVILCGNKKDLD---PEREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNK. 172
26 -29.000[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  20  23.................FKILIIGNSSVGKTSFLFRYADDSFTAFVSTVGFKVKTIYRNDIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQI-KTYSWDNAQVLLVGNKCDME---DERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEK. 186
27 -28.700[T] KOG3886 GTP-binding protein  ali follow..  19  38..............AMKKKVLLMGKSGSGKTSMRSIIFANDTRRLGATILDRIHSLQIGNLVLNLWDCGGQDTFMENYDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSDAKIFCLVHKMDLVQEDQRDLIFKERELRRLSRPLECSCFRTSIWDETLYKAWSSIVYQLIPN. 244
28 -28.700[T] KOG4252 GTP-binding protein  ali follow..  18  10.................IKMVVVGNGAVGKSSMIQRYCKGIFTDYKKTIGFLERQIQVNDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRGSFEAVSSWREKV--VAEVGDIPTVLVQNKIDLL---DDSCIKNEEAEALAKRLRLRFYRTSVKEDLNVNEVFKYLAEKYLQK. 172
29 -28.600[U] KOG0097 GTPase Rab14, small G protein superfamily  ali follow..  19  12.................FKYIIIGDMGVGKSCLLHQFTEKKFMDCPHTIGVEFGEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTN-PNTVIILIGNKADLE---AQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQN. 175
30 -28.400[R] KOG1673 Ras GTPases  ali follow..  17  102.................LKISLLGDCQTGKTTFVVKYVGDENQSFLEMTGLNLMDVQGVTISFSIWDVGGDEKSKDHIPIACKDAVAILFMFDLTSRSTLNSVFGWYSQA--RKWNKTAIPILIGTKFDDFVRLPPNWTIVTQARAYAKVMNASLFFSSATHNINVNKIFKFILARLFNLP 270
31 -28.400[U] KOG0098 GTPase Rab2, small G protein superfamily  ali follow..  22  7.................FKYIIIGDTGVGKSCLLLQFTDKRFQPVDLTIGVEFGTIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSN-SNMVIMLIGNKSDLE---ARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYRK. 170
32 -28.300[U] KOG0087 GTPase Rab11/YPT3, small G protein superfamily  ali follow..  17  11.................FKTVLIGDSGVGKSNLLMRFTRNEFNESKSTIGVEFAVLDNKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREHAD-SNIVIMLVGNKTDLL---HLRAVSTEEAQAFAAENNLSFIETSAMDASNVEEAFQTVLTEIFRI. 174
33 -27.900[R] KOG0395 Ras-related GTPase  ali follow..  17  17..............KNSYRMVVLGASRVGKSSIVSRFLNGRFEDQTPTIE-KVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILETKEAAELPMVICGNKNDHGELCRQVPTTEAELLVS-GDENCAYFEVSAKKNTNVDEMFYVLFSMAKLP. 193
34 -26.700[R] KOG0083 GTPase Rab26/Rab37, small G protein superfamily  ali follow..  20  469.................GKVIMLGDSGVGKTSLLIRFRDGRYVPSLSTVGIDFRVVDGTRVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEI-REYAQEDVVIVLIGNKADCSG--SERQVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRG 635
35 -23.100[R] COG1084 Predicted GTPase  ali follow..  16  164..................TVVIAGFPNVGKSTLLRTLTGAEPEVA-TTKGIQIGHLERKWKRIQVIDTPGNNIELQAMVALENIADVIMFIFDASETCG-YTLESQYSLYLGIRSVFDIPVVTVFNKMDL--------AENVKYLEEYINMVEDPLKVSAFEGRGVSKIIKKLEGLYEKET 329
36 -21.700[R] KOG0393 Ras-related small GTPase, Rho type  ali follow..  17  2...............QAIKCVVVGDGAVGKTCLLLSYTTNAFPGEILTVFDTYSMVDGRPINLSLWDTAGQDDYDQFRHLSFPQTDVFLVCFALNNPASFENVRAKWYPEVSH-HCPNTPIILVGTKADLREDRDTIERLRESRLQPVSHTQ-KYLECSALTQIGLKQVFDEAIRTGLTPP 180
37 -21.400[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  12  1...MWMGVGDSSGSPKPIRIVVVGEKGSGKSSLIMAAARNTFHPNIPSLLPYTNEFFPDRIPATVIDTSSRPEDKGKVVKEVRQADAIVLTFAFDRPETLDRLSKYWLPLFRQLE-VRVPIIVAGYEVDNKEAYNHFSIEQITSALMKQYRE-TSIQWSAQRLDQAKDVLYYAQKAV.... 177
38 -21.300[R] COG3596 Predicted GTPase  ali follow..  13  36..............HYEPVIGIMGKTGAGKSSLCNALFAGEVSPVSDVAACTRDRLQIGEHFMTIVDLPGDTEYAALYREQLPRLDLILWLIKADD--RALATDEHFYRQVIGEA-YRHKMLFVISQSDKAEPTSGGNILSTEQKQNISRKI-PVCAVSVRLQWGLRVMAERMIKCLPREP 220
39 -20.600[E] COG4917 Ethanolamine utilization protein  ali follow..  20  3..................RIAFVGSVGAGKTTLFNALQGNYTLAR------KTQAVEFNDKGDI--DTPGHPRWYHALITTLQDVDMLIYVHGANDPESRLPAG--------LDIGVSKRQIAVISKTDMPDA-DVAATRKLLLETGFEEP---MFELNSHDPQSVQQLVDYLASLTKQEE 150
40 -20.200[R] KOG2486 Predicted GTPase  ali follow..  13  137..................EFALVGRSNVGKSSLLNSLVRRKRLALTSKKPGKTQCINHFRIKWYLVDLPGKQDWNKFTKDYFSTLVSVFLLVDA--SIPVKPIDLEYASWLGQ---NQVPMTLIFTKCDKRKKKKNGGKKPEANIKEFQDL--PWIMTSSVTNQGRDEILLHMAQLRNY.. 314
41 -18.900[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  20  335................ELKSILIGLPNAGKSTILNKISNAKFTTLSPTIG--TVSLGFGQDVFTVADIPGDKGMGLEFLRHIERSNGWVFVLDLSNKNPLNDLQLLIEEVGTLEKVKTKNILIVCNKVDIDAEKSESFAKYLQVEKFSKSQEWDCVPISALREKT................ 499
42 -18.800[T] KOG0099 G protein subunit Galphas, small G protein superfamily  ali follow..  30  38..............RATHRLLLLGAGESGKSTIVKQMRIDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVEDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDL................................................... 296
43 -18.700[T] KOG0085 G protein subunit Galphaq/Galphay, small G protein superfamily  ali follow..  24  37..............RRELKLLLLGTGESGKSTFIKQMRIDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLEDKILYSHLVDYFDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLN 352
44 -18.700[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  14  171...................VLICGYPNVGKSSFMNKVTRADVDVQFTTKSLFVGHTDYKYLRYQVIDTPG-EMCSITALAHLRAAVLFFLDISGSCGYTIAQQAALFHSI--KSLFMNKPLVIVCNKTDLMPMENISEEDRKLKTAMGASEEQVLLKMSTLTDEGVMSVKNAACERLLDQ. 352
45 -18.600[DT] KOG0082 G-protein alpha subunit (small G protein superfamily)  ali follow..  25  31..............ARTVKLLLLGAGESGKSTIVKQMKIDVLHSRVKTTGIIETQFSFKDLHFRMFDVGGQRSERKKWIHCFEGVTCIIFCAEDEEVNRMHESLHLFNSICNHKYFSTTSIVLFLNKKDI................................................... 273
46 -17.600[R] COG1160 Predicted GTPases  ali follow..  20  5..................VVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKHIAGYDFIVIDTGGEEKMAEQSLLAIDEADIVLFLVDA--RAGLTAADIGIANYLRQR--QNKITVVVANKTDGIDADSHCAEFYQLGLGE-------IEQIAASQGRGVTQLMEQVLAPFAEKM 168
47 -17.000[R] COG0218 Predicted GTPase  ali follow..  16  27..................EIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIKMRFVDVPGSKKEREKWEEYLTTRENLRAVVSLVDLRHDPSADDV--QMYEFLKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPSDDFILFSSVSKAGMDEAWDAILEKL.... 195
48 -16.300[P] COG0370 Fe2+ transport system protein B  ali follow..  18  2...............SQNTYCILGNPNTGKTSLFNALTSYEYVGNWSGVTVEKKVGTLRSKTGKLIDLPGIYDLNPISRD--EKFDCMLNIVDSSQIERNLNLTVQLLEY-------GAPVVMGLNMIDVAAGLNIQNLAKKLRIP--------ILPVVARSGKGTEDILSTLSEKHVAPA 165
49 -15.600[S] KOG4273 Uncharacterized conserved protein  ali follow..  20  2..............ESRPGVLVVGSSGVGKRTLLSRLLSVEFESSESSSQTEVHNTKYYTADVSVCISHICDEYSLPNLPNSHPLVALVMVFDLSELSTLVALQDWVSHT---DINSFDILLCIGNKVDREYRRRLLKASDPSRDLYSDIDDFGISETEGSSLLGSEDALEWCSEN..... 181
50 -15.600[R] COG0536 Predicted GTPase  ali follow..  23  155................ELKSMLVGFPSAGKSSLISVMSAAKFTTLQPNLGV----VNVGHETFTMADVPGGKGLGLDFLRHIERTSVLVHVVDTATMDPGRDPISDIEALEAE-DLSQRPRLVVLNKADVPEA---EELAEFLKEDIEKQFGWPVFIISAVARKGLDPLKYKLLEIVQD.. 342
51 -14.800[R] COG0486 Predicted GTPase  ali follow..  11  211LDHVRSEAKQGSILREGMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLRIDGMPLHIIDTAGLREATDE-WSEIEQADRILLMLDSTEA--DNQDLEKVRSEFLTKLPSNIPVTIVRNKADLSGENEGIVEQNGYTVITL----------SAKTQQGIALLREHLKQSMGYQT 391
52 -14.700[R] COG1163 Predicted GTPase  ali follow..  18  63..............TGVASVGFVGFPSVGKSTLLSKLTGTEFTTLVTVPGV----IRYKGAKIQMLDLPGGRGRGKQVIAVARTCNLLFIILDVNKPHHKQIIEKELEGV--GIRLNKTPPDILIKKKEKGGI................................................ 190
53 -14.500[T] KOG1487 GTP-binding protein DRG1 (ODN superfamily)  ali follow..  18  62..............TGDARIGFVGFPSVGKSTLLSNLAGVYFTTLTTVPGV----IRYKGAKIQLLDLPGGKGRGRQVIAVARTCNLILIVLDVLKPGHKKIIENELEGF--GIRLNSKPPNIGFKKKDKGGI................................................ 189
54 -14.000[R] COG1159 GTPase  ali follow..  17  11...................IAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRITEGPYQAIYVDTPGNRLMNKAASSSIGDVELVIFVVEGTRWTPDDE------MVLNKLRDGKAPVILAVNKVDN--VQEKVDLLPHLQFLASQMNFLDIVPISAETGMNVDTIAGIVRKHLPEAI 177
55 -13.800[T] KOG1486 GTP-binding protein DRG2 (ODN superfamily)  ali follow..  15  60..............YGHGRVALIGFPSVGKSTLLTMLTGTHFTTLTCIPGV----IHYNDTKIQLLDLPGGKGRGRQVIAVAKSSDLVLMVLDSKSEGHRQILTKELEAV--GLRLNKTPPQIYFKKKKTGGI................................................ 187
56 -13.600[J] KOG1191 Mitochondrial GTPase  ali follow..  13  337VESALDTANYDKLLQSGLQIAIVGRPNVGKSSLLNAWSKSERAIVTEVAGTTRDVVEVRGVPITLLDTAGIRETNDI-ETAAKVADVIIMAVSAVEGWTEEDTEVSFYDLFGGLLYLKQPMILVMNKIDCAPPGSCDQLEDQRKKEEVFHKSVFT---SAVTGQGIEELEDAILEILGLDR 537
57 -13.600[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  18  183...................VTIMGHVDHGKTTLLDKFRKTQVAAITQHIGFLVSLPSGEKITFL--DTPGHAAFSAMRARGAQVTDIVVLVVAADD------VMKQTVESIQHAKDAQVPIILAVNKCDKAEA-DPEKVKKELLAYDVVCEDYQAVPVSALTGDNLMALAEATV....... 339
58 -13.000[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  13  34.........EVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNRSCGSSMPDEFPVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAI---EIMKLKHILILQNKIDLVKERQAKEQYEQILVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIP... 244
59 -12.800[R] KOG0410 Predicted GTP binding protein  ali follow..  18  312...................VSLVGYTNAGKSTLLNQLTGANVLRLFATLDPTTRRVQMNGKEFLLTDTVGPTTLVAAFRATLEESSLLVHVVDISHPL-AEQQIEAVEKVMSELDVSSIPKLVVWNKVDRVDDPQKVKLEAEETGDTI--------CISALTGEGLDDFCNAVHEKLKDS. 475
60 -12.600[J] COG4108 Peptide chain release factor RF-3  ali follow..  17  13..............SKRRTFAIISHPDAGKTTITEKVRGSNQHAKSDSVTTSVMQFPYGDCLVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDAAK------VEDRTRKLMEVTRLRDTPIVTFMNKLDREIR-LMDEVENELKIACS................................. 169
61 -12.600[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  16  2..............KRPLIIGVGGPVGAGKTMLIERL-----TRYLSTKGYSMAAITNDDLQLLFLESGGDNLSATF---SPDLVDFSIYIIDVAQGEKIPRKGGQGMIKSD---------LFIINKVDLAPYVGANVEVMKADTLKSRGNK-DFFVTNLKTDEGLKSVADWIEKRLQLAL 203
62 -12.600[J] COG0532 Translation initiation factor 2 (IF-2; GTPase)  ali follow..  20  448...................VTIMGHVDHGKTTLLDRFRESRVTE---TQHIGAYQIKANGKKITFLDTPGHEAFTSMRARGASVTDITILVVAADD------VMPQTIEAINHSKAAGVPIIVAINKIDKPGA-NPQRVTQELTEHGVFPVAWEFVEISAKFNQNLDELLDTVL....... 605
63 -12.300[R] COG2262 GTPases  ali follow..  16  200...................VSLVGYTNAGKSTLFNRITEARVYQLFATLDPTLRRIDVDVGETVLADTVGPHDLVAAFKATLQEATLLLHVIDAADVR-VQENIEAVNTVLEEIDAHEIPTLLVMNKIDMLEDFEPR-------IDRDEENKPIRVWLSAQTGAGIPQLFQALTERLSGE. 364
64 -11.700[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  14  47....................IVAHVDH-GKSTLADRLGQKQMLDKLQTVKAQTAALRHRGYLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAANQ------VQAQTIANFWLAFEKNIQIIPVINKIDLPGADIKSVETQLKNLFEFNPEE--CLHISAKSGLNVDKVLEAIIDRV.... 211
65 -11.700[J] COG5256 Translation elongation factor EF-1alpha (GTPase)  ali follow..  16  1.......MKIMASQKPHLNLITIGHVDHGKSTLVGRLRFKEERERGVTIDLAHRKFETDKYYFTLIDAPGHRDFVKNMITGTSQADAAILVISAREGEGVMEQTREHAFLARTLGVPQ--MVVAINKMDATSPPYSEKRYNEVKLRSIGFKDISFVPISGYKGDNVSPNMPW......... 206
66 -11.500[J] KOG0052 Translation elongation factor EF-1 alpha/Tu  ali follow..  17  4.............EKVHINIVVIGHVDSGKSTTTGHLKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEP--TNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLE............. 203
67 -11.300[J] KOG0460 Mitochondrial translation elongation factor Tu  ali follow..  20  50.............KKPHVNIGTIGHVDHGKTTLTAAIKAPEEKARGITISSAHVEYETANRHYAHVDCPGHADYIKNMITGAATMDGAIIVVSATDGQ-MPQTREHLLLA---RQVGVKQIVVYINKVDMVEELVEMEMRELLSEYGFDGDNTPIVSGSALCA.................. 218
68 -11.100[M] COG0481 Membrane GTPase LepA  ali follow..  15  9....................IIAHIDH-GKSTLSDRLRERGITIKAQSVTLNYKAKDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQ------VEAQTLANCYTAIEMNLEVVPILNKIDLPAADPERVAEEIEDIVGIDAME--AVRCSAKTGVGIEDVLEEIVHKI.... 180
69 -11.100[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  16  1...........MKNQSEINIGLVGHVDHGKTTLTKTHSEETKRGISIRLGYRCGTETELLRKVSFVDAPGHETLMATMLSGAALMDGAILVIAANEPCPQPQTKEHLMAL---DVIGVKDVIVVQNKIDIVSKERALESYREIKVKGTCAEDAPIIPVSAQQGANIDILIETIEERIK... 198
70 -11.000[J] KOG0458 Elongation factor 1 alpha  ali follow..  19  164.............ALPHLSFVVLGHVDAGKSTLMGRLQTNEERERGVTVSICTSHFSTHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTESGFDLDGQTKEHMLLASSLGIHNLIIAMNKMDNVD---KSKLLPYLVDIGFFEDNINWVPISGFSGEGVYK............. 361
71 -10.700[J] COG3276 Selenocysteine-specific translation elongation factor  ali follow..  19  3...................IVTSGHVDHGKTALLKALTGTSTAHLPETIDLGYAYLPLENKVLGFIDVPGHEKFLSNMLAGLGGVHYAMLIV-AADEGVAVQTKEHLAIL---RQLQFHEIIVVITKADRTNSAQIESLIQTIKQDYSFLRNANYFVTSAETGQGISELRHYLANLAELAD 166
72 -10.700[J] KOG0468 U5 snRNP-specific protein  ali follow..  16  133..................NVALVGHLHHGKTTFVDCLQERGCSIKATPVTLVLQDVKQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDA-----AEGVMLNTERLLKHAVQERQAITVCINKIDRLILLPPQDAYFKLK..................................... 281
73 -10.400[J] KOG0459 Polypeptide release factor 3  ali follow..  16  98.............KKRHLNVVFIGHVDAGKSTIGGQITNEEERLKGKTVEVGRAHFETESTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKETGYERGGQTREHVQLAKTLGVSKLIVVVNKMDDPTVNWSKERYDEIASGYNTKKDVVFLPISGLMGKNMDQ............. 298
74 -10.300[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  16  10....................IIAHVDH-GKTTLVDKLESERVMDSNDTILAKNTAIKWNGYNINIVDTPGHADFGGEVERVMSMVDSVLLVVDAQD------PMPQTRFVTQKAFKAGLRPIVVVNKIDRPGARPDWVIDQIFDLFDNLGATDEQLDFPIVYASAL............... 168
75 -10.100[H] COG1763 Molybdopterin-guanine dinucleotide biosynthesis protein  ali follow..  22  4...................FGITGWKNSGKTTLTEKL-----VAELVRRGWKVSTVKHAHHDFDI-DKPGADSFR------HRQAGATEVAIVSGNRWALLRGEDEPPLESILSRLAPCDIVLVEG....................................................... 101

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 0 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.