current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst MFLFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALLSDEALATVPFLILGNKIDIPYAASEDELRYHLGLTNFTTGKGKVTLGDSGVRPLEVFMCSIVRKMGYGEGFKWLSQYINLast
1 -95.900[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali  100  1MFLFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALLSDEALATVPFLILGNKIDIPYAASEDELRYHLGLTNFTTGKGKVTLGDSGVRPLEVFMCSIVRKMGYGEGFKWLSQYIN 193
2 -87.600[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  35  1..MGNIFSSMFDKLWGSNKELRILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKD------------RSWSIVASSAIKGEGITEGLDWLIDVIK 179
3 -87.600[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  33  1...MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRD------------RVWQIQSCSALTGEGVQDGMNWVCKNVN 178
4 -86.900[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  32  1...MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQ------------RHWYIQSTCATSGEGLYEGLDWLSNNIA 178
5 -86.800[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  32  4..SLFKGFSKPFSRLFSNKEMRILMLGLDAAGKTTILYKLKLNQSVVTIPTVGFNVETVTYKNIKFNVWDVGGQDKIRPLWRHYFTGTKGLIFVVDSADSNRISEARQELHRIISDREMRDCLLLVLANKQDLPGALSPAQITDVLQLDKLKD------------RLWNVQPTCALTGDGLLEGLAWLSQNAK 182
6 -86.600[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  32  1MGLLTILKKMK----QKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREALELDSIRS------------HHWCIQGCSAVTGENLLPGIDWLLDDIS 177
7 -86.400[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  34  1..MDGGVLSYFRGL-LGSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVHHALGLENLKN------------RTFQIFKTSATKGEGLDQAMDWLSNTLQ 178
8 -82.400[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  29  2LALINRILEWFKSI-FWKEEMELTLVGLQFSGKTTFVNVIASGQAEDMIPTVGFNMRKITRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDETGLIERMNLSSIQD------------REICCYSISCKEKDNIDITLQWLIQHSK 182
9 -78.900[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  26  1...MFHLVKGLYNNWNKKEQYSILILGLDNAGKTTFLETLKKKALEKIQPTVGQNVATIPVDSKQLKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVMDEEIEGVPILMLANKQDRQDRMEVQDIKEVFNKI----------AEHISARDSRVLPISALTGEGVKDAIEWMIVRLE 187
10 -50.800[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  17  36VLLLATIWLLSIRLFRRTKSNTVLLSGLSGSGKTVLFYQLRDGSHQGAVTSMEPNEGTFVLKVKPVHLIDVPGHSRLISKLEEYLPRAAAVVFVVDALEFLPIRAASEYLYDILTNASVNKTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKLRVSRSAISTADINKVTVAEASGLTG-ETDQVQEFIREHVK 259
11 -38.100[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  14  60.................EVKPRILLMGLRRSGKSSIQKVVSPNETLFLESTNKICREDVSNSFVNFQIWDFPGQIDFFDPYEMIFRGTGALIFVIDSQDDYMEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQRANDD-----LADAGLEKIHLSFYLTSIYDHSIFEAFSKVVQKL. 237
12 -32.500[R] COG2229 Predicted GTPase  ali follow..  19  2..................RENKIIFTGPVGVGKTTAIAAISDEALVQTNTTVAMDYGAISLDDTKVHLYGTPGQERFNFMWEILSQGSMGLVLLLDNARTNPLKDLEFFLHSF--RGLLEKAPVVVGITKMDIRSQPGIDVYHKYLAKHNLN---------------VPVFEIDARKEDDVKQLVSAMLFSID 173
13 -30.800[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  17  13....................FKLVLVGDGGTGKTTFVKRHLTGEFEKYIATIGVEVHYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL--VRVCENIPIVLCGNKVDVKERKVKAK-----------------TITFHRKKNLQYYDISAKSNYNFEKPFLWLARKL. 170
14 -29.800[R] KOG0091 GTPase Rab39, small G protein superfamily  ali follow..  18  10....................FRLILIGDSTVGKSSLLKFFTDGKFALSDPTVGFFARLIEMKDIKLQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAGGHREVTTEEA------------QKFAKQHGLHFVETSARSGANVEEAFRMVTQEV. 175
15 -29.300[R] KOG0080 GTPase Rab18, small G protein superfamily  ali follow..  19  9....................LKILIIGESGVGKSSLLLRFTDDTFDELAATIGVDFKSVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKF----------------ARKHSMLFIEASAKTCDGVQCAFEELVEKI. 169
16 -29.100[U] KOG0081 GTPase Rab27, small G protein superfamily  ali follow..  16  10....................IKFLALGDSGVGKTSVLYQYTDGKFNKFITTVGFREKRVVYQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSD---------------LEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLI. 181
17 -28.500[R] KOG0394 Ras-related GTPase  ali follow..  17  9....................LKVIILGDSGVGKTSLMNQYVNKKFSQYKATIGFLTKEVQFEDFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNEEFLIQASPSDPENFPFVLIGNKVDVDDG------------NSRVVSEKKAKAWCASKGNIPYFETSAKVGTNVEEAFQCIAKDA. 176
18 -28.200[T] KOG3886 GTP-binding protein  ali follow..  13  38.................AMKKKVLLMGKSGSGKTSMRSIIFANDTRRLGATILDRIHSLQIGNLVLNLWDCGGQDTFMENYDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSDAKIFCLVHKMDLVQEDQRDLIFKER----------EEDLRRLSRPLECSCFRTSIWDETLYKAWSSIVYQL. 241
19 -27.800[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  19  21....................FKLVLLGESAVGKSSLVLRFVKGQFHFQESTIGFLTQTVCLDDVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQAS-PNIVIALSGNKAD---------------LANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL. 181
20 -27.800[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  19  13....................FKIVLLGEGCVGKSSLVLRFVENKFSKHLSTIQFQNKTVNVEDADLHIWDTAGQEKYHALGPIYYRGSNGVLLVFDITDRKSFEKVKNWVLEIKTCLG-NTAEILIVGNKID---------------LEEERQVTRQDAEAYAESEGALYMETSAQDNVGISDAFESLTAKM. 173
21 -27.800[R] KOG1673 Ras GTPases  ali follow..  14  102....................LKISLLGDCQTGKTTFVVKYVGDENQSFLEMTGLNLMDVQGVTISFSIWDVGGDEKSKDHIPIACKDAVAILFMFDLTSRSTLNSVFGWYSQA--RKWNKTAIPILIGTKFDDFVRLPPNL----------QWTIVTQARAYAKVMNASLFFSSATHNINVNKIFKFILARL. 266
22 -27.700[R] KOG0079 GTP-binding protein H-ray, small G protein superfamily  ali follow..  19  11....................FKLLIIGDSGVGKSSLLLRFADNTFSNYITTIGFKIRTMDINGVKLQIWDTAGQERFRTITSTYYRGTHGVVVVYDVTNGESFGNVKRWLQEI--ENNCDSVQKVLVGNKCE---------------ENERRVVLESDARNYAQSMNISFFETSAKEDKNVEPMFTCITSLV. 170
23 -27.600[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  22  9....................FKLLLIGDSGVGKSCLLLRFADDSYLSYISTIGVDFKEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEI-DRYASENVNKLLVGNKCD---------------LTSQKVVSTETAKAFADELGIPFLETSAKNATNVEEAFMAMTAAIK 170
24 -27.600[TU] KOG0078 GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins  ali follow..  20  10....................IKLLLIGDSGVGKSCLLLRFSEDSFTSFITTIGIDFKELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNV-EQHASENVYKILIGNKCD---------------CEDQRQVSFEQGQALADELGVKFLEASAKTNVNVDEAFFTLAREIK 171
25 -27.600[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  16  10....................YKLVFLGDQSVGKTSIITRFMYDKFDTYQATIGFLSKTMYLEDVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEV-RNERAGDVIIVLVGNKTD---------------LVEKRQVSIEEGDSKGREYGVMFIETSAKAGFNIKPLFRKIAAAL. 170
26 -27.500[R] KOG0395 Ras-related GTPase  ali follow..  18  17.................KNSYRMVVLGASRVGKSSIVSRFLNGRFEQYTPTIEFHRKVYNIRGYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILETKEAAELPMVICGNKNDHGELCRQVPTTEAELLVS-------------GDENCAYFEVSAKKNTNVDEMFYVLFSMAK 191
27 -27.400[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  19  10....................FKIVLIGNAGVGKTCLVRRFTQGLFPGQGATIGFMIKTVEINGVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREI-EQYASNKVITVLVGNKID---------------LAERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRL. 170
28 -27.300[T] KOG4252 GTP-binding protein  ali follow..  16  10....................IKMVVVGNGAVGKSSMIQRYCKGIFTDYKKTIGFLERQIQVNDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRGSFEAVSSWREKV--VAEVGDIPTVLVQNKID---------------LLDDSCIKNEEAEALAKRLRLRFYRTSVKEDLNVNEVFKYLAEKY. 169
29 -27.200[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  19  23....................FKILIIGNSSVGKTSFLFRYADDSFTAFVSTVGFKVKTIYRNDIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQI-KTYSWDNAQVLLVGNKCD---------------MEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVI. 183
30 -27.100[U] KOG0086 GTPase Rab4, small G protein superfamily  ali follow..  19  9....................FKFLVIGSAGTGKSCLLHQFIENKFKDSNHTIGFGSRVVNVGGVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLAS-PNIVVILCGNKKD---------------LDPEREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTI. 169
31 -26.800[U] KOG0097 GTPase Rab14, small G protein superfamily  ali follow..  16  12....................FKYIIIGDMGVGKSCLLHQFTEKKFMDCPHTIGFGTRIIEVSGIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTN-PNTVIILIGNKAD---------------LEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKI. 172
32 -26.700[U] KOG0087 GTPase Rab11/YPT3, small G protein superfamily  ali follow..  18  11....................FKTVLIGDSGVGKSNLLMRFTRNEFNESKSTIGFATRNIVLDNIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREHAD-SNIVIMLVGNKTD---------------LLHLRAVSTEEAQAFAAENNLSFIETSAMDASNVEEAFQTVLTEI. 171
33 -26.400[U] KOG0098 GTPase Rab2, small G protein superfamily  ali follow..  19  7....................FKYIIIGDTGVGKSCLLLQFTDKRFQVHDLTIGFGARMVTIDGIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSN-SNMVIMLIGNKSD---------------LEARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEI. 167
34 -25.300[R] KOG0083 GTPase Rab26/Rab37, small G protein superfamily  ali follow..  19  469....................GKVIMLGDSGVGKTSLLIRFRDGRYSYFLSTVGFRNKVVVVDGVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEI-REYAQEDVVIVLIGNKADCSGSERQVKREDGERLGR--------------EHNVPFMETSAKTGLNVELSFTAVARQLK 632
35 -23.800[R] KOG0393 Ras-related small GTPase, Rho type  ali follow..  16  2..................QAIKCVVVGDGAVGKTCLLLSYTTNAFGEYILTVFDTYSMVDGRPINLSLWDTAGQDDYDQFRHLSFPQTDVFLVCFALNNPASFENVRAKWYPEVSH-HCPNTPIILVGTKADLREDRDTIERLRESRLQPVSHTQGYVMAKEIKAVKY--LECSALTQIGLKQVFD....... 170
36 -23.000[R] COG3596 Predicted GTPase  ali follow..  17  36.................HYEPVIGIMGKTGAGKSSLCNALFAGEVSPVSDVAACTRDRLQIGEHFMTIVDLPGDTEYAALYREQLPRLDLILWLIKADD--RALATDEHFYRQVIGEA-YRHKMLFVISQSDKAEPTSGGNILSTEQKQNISRKICLLHELFQPVHP--VCAVSVRLQWGLRVMAERMIKCLP 217
37 -22.800[R] COG1084 Predicted GTPase  ali follow..  15  160.................LDAFTVVIAGFPNVGKSTLLRTLTGAEPEVADTTKGIQIGHLERKWKRIQVIDTPGNNIELQAMVALENIADVIMFIFDASETCG-YTLESQYSLYLGIRSVFDIPVVTVFNKMDLAENVKYLEEYINM----------------------DPLKVSAFEGRGVSKIIKKLEGLYE 326
38 -22.200[R] KOG2486 Predicted GTPase  ali follow..  18  137.....................EFALVGRSNVGKSSLLNSLVRRKRLALTSKKPGKTQCINHFRIKWYLVDLPGPHELKQDWNKFTSTLVSVFLLVDA--SIPVKPIDLEYASWLGQ---NQVPMTLIFTKCDKRKKKKNGGKKPEANIKEFQDLIQGFFETTP-----PWIMTSSVTNQGRDEILLHMAQLRN 313
39 -21.300[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  14  12.................PKPIRIVVVGEKGSGKSSLIMAAARNTFHPNIPSLLPYTNEFFPDRIPATVIDTSSRPEDKGKVVKEVRQADAIVLTFAFDRPETLDRLSKYWLPLFRQLE-VRVPIIVAGYEVDNKEAYNHFSIEQIT-----------SALMKQYREVETSIQWSAQRLDQAKDVLYYAQKAV. 177
40 -20.000[E] COG4917 Ethanolamine utilization protein  ali follow..  20  3.....................RIAFVGSVGAGKTTLFNALQGNYTLAR--------KTQAVEFNDKGDIDTPGHPRWYHALITTLQDVDMLIYVHGANDPESRLPAG--------LDIGVSKRQIAVISKTDMPDA-DVAATRKLLLETGFEE---------------PMFELNSHDPQSVQQLVDYLASLTK 147
41 -19.700[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  171......................VLICGYPNVGKSSFMNKVTRADVDVQPTTKSLFVGHTDYKYLRYQVIDTPG-EMCSITALAHLRAAVLFFLDISGSCGYTIAQQAALFHSI--KSLFMNKPLVIVCNKTDL---MPMENISEEDRKLIEEMKSEAMKTAMGASEEQVLLKMSTLTDEGVMSVKNAACERL. 349
42 -19.700[DT] KOG0082 G-protein alpha subunit (small G protein superfamily)  ali follow..  18  31.................ARTVKLLLLGAGESGKSTIVKQMKQDVLHSRVKTTGIIETQFSFKDLHFRMFDVGGQRSERKKWIHCFEGVTCIIFCAEDEEVNRMHESLHLFNSICNHKYFSTTSIVLFLNKKDIQEKVTKVHLSICFDAGNYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKFVFDAVTDII. 343
43 -19.600[T] KOG0099 G protein subunit Galphas, small G protein superfamily  ali follow..  23  38.................RATHRLLLLGAGESGKSTIVKQMRQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVEDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDL............................................................ 296
44 -18.800[T] KOG0085 G protein subunit Galphaq/Galphay, small G protein superfamily  ali follow..  25  37.................RRELKLLLLGTGESGKSTFIKQMRQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDL............................................................ 278
45 -18.000[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  20  337.................KSIADLGLIGLPNAGKSTILNKISNAKFTTLSPTIG--TVSLGFGQDVFTVADIPGDKGMGLEFLRHIERSNGWVFVLDLSNKNPLNDLQLLIEEVGTLEKVKTKNILIVCNKVDIDAEKSESFAKY------------LQVEKFSKSQEWDCVPISALREKT............. 499
46 -17.800[R] COG1160 Predicted GTPases  ali follow..  19  5.....................VVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKHIAGYDFIVIDTGGEEKMAEQSLLAIDEADIVLFLVDA--RAGLTAADIGIANYLRQR--QNKITVVVANKTDGIDADSHCAEFYQLGLGE-------------------IEQIAASQGRGVTQLMEQVLAPFA 165
47 -17.000[R] COG0218 Predicted GTPase  ali follow..  16  27.....................EIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIKMRFVDVPGSKKEREKWGCMIENLRAVVSLVDL--RHDPSADDVQMYEFLKY---YEIPVIIVATKAD------------KIPRGKWNKHESAIKKKLNFDPSDDFILFSSVSKAGMDEAWDAILEKL. 195
48 -16.300[P] COG0370 Fe2+ transport system protein B  ali follow..  18  2..................SQNTYCILGNPNTGKTSLFNALTGYEYVGNWSGVTVEKKVGTLRSKTGKLIDLPGIYDLETVVTRFLEKFDCMLNIVDSSQIERNLNLTVQLLEY-------GAPVVMGLNMIDVAAGLNIQNLAKKLRIP--------------------ILPVVARSGKGTEDILSTLSEKHV 162
49 -15.900[S] KOG4273 Uncharacterized conserved protein  ali follow..  11  2.................ESRPGVLVVGSSGVGKRTLLSRLLSVEFESSESSSQTEVHNTKYYTADVSVCISHICDEYSLPNLPNSHPLVALVMVFDLSELSTLVALQDWVSHT---DINSFDILLCIGNKVDRVPHHLAHD-----YRRRLLKASDPSRDLYSDIDDFGISETEGSSLLGSEDALEWCSEN.. 181
50 -15.400[R] COG1163 Predicted GTPase  ali follow..  18  63.................TGVASVGFVGFPSVGKSTLLSKLTGTESEAAETTLVTVPGVIRYKGAKIQMLDLPGGRGRGKQVIAVARTCNLLFIILDVNKPHHKQIIEKELEGV--GIRLNKTPPDILIKKKEKGGI......................................................... 190
51 -15.200[T] KOG1487 GTP-binding protein DRG1 (ODN superfamily)  ali follow..  20  62.................TGDARIGFVGFPSVGKSTLLSNLAGVYSEVAATTLTTVPGVIRYKGAKIQLLDLPGGKGRGRQVIAVARTCNLILIVLDVLKPGHKKIIENELEGF--GIRLNSKPPNIGFKKKDKGGI......................................................... 189
52 -15.100[R] COG0536 Predicted GTPase  ali follow..  18  155...................ELKSMLVGFPSAGKSSLISVMSAAKPKIGDTTLQPNLGVVNVGHETFTMADVPGGKGLGLDFLRHIERTSVLVHVVDTATMDPGRDPISDIEALEAE-DLSQRPRLVVLNKADVPEAEELAEFLKE---------------DIEKQFGWPVFIISAVARKGLDPLKYKLLEIVQ 341
53 -14.500[R] COG0486 Predicted GTPase  ali follow..  15  225.................REGMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLRIDGMPLHIIDTAGLREATDE-WSEIEQADRILLMLDSTEA--DNQDLEKVRSEFLTKLPSNIPVTIVRNKADLSGENEGIVEQNGYTVITL----------------------SAKTQQGIALLREHLKQSMG 388
54 -14.400[T] KOG1486 GTP-binding protein DRG2 (ODN superfamily)  ali follow..  20  60.................YGHGRVALIGFPSVGKSTLLTMLTGTHSEAASTTLTCIPGVIHYNDTKIQLLDLPGGKGRGRQVIAVAKSSDLVLMVLDSKSEGHRQILTKELEAV--GLRLNKTPPQIYFKKKKTGGI......................................................... 187
55 -13.600[J] COG4108 Peptide chain release factor RF-3  ali follow..  17  13.................SKRRTFAIISHPDAGKTTITEKVRGSNQHAKSDSVTTSVMQFPYGDCLVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDAAK------VEDRTRKLMEVTRLRDTPIVTFMNKLDREIR-LMDEVENELKIACS.......................................... 169
56 -13.500[J] KOG1191 Mitochondrial GTPase  ali follow..  15  351.................QSGLQIAIVGRPNVGKSSLLNAWSKSERAIVTEVAGTTRDVVEVRGVPITLLDTAGIRETNDI-ETAAKVADVIIMAVSAVEGWTEEDTEVSFYDLFGGLLYLKQPMILVMNKIDCAPPGSCDQLEDQR---------------KKEEVFHKSVFTSAVTGQGIEELEDAILEILG 534
57 -13.400[R] COG1159 GTPase  ali follow..  16  7..................YCGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRITEGPYQAIYVDTPGNRLMNKAASSSIGDVELVIFVVEGTRWTPDDE------MVLNKLRDGKAPVILAVNKVDN--VQEKVDLLPHLQFLASQMNFL------------DIVPISAETGMNVDTIAGIVRKHL. 173
58 -13.300[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  19  183......................VTIMGHVDHGKTTLLDKFRKTQVAAVETTQHIGAFLVSLPS-KITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADD------VMKQTVESIQHAKDAQVPIILAVNKCDKAEA-DPEKVKKELLAYDVVCED---------GGDVQAVPVSALTGDNLMALAEATV.... 339
59 -13.200[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  18  39.................QATINIGTIGHVAHGKSTVVKAISGVHTVRFFPTDIPGTKGNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAI---EIMKLKHILILQNKIDLVKERQAKEQYEQI----------LAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIP 244
60 -13.000[R] KOG0410 Predicted GTP binding protein  ali follow..  17  312......................VSLVGYTNAGKSTLLNQLTGANVLRLFATLDPTTRRVQMNGKEFLLTDTVG-AAFRATLEE-IAESSLLVHVVDISHPL-AEQQIEAVEKVMSELDVSSIPKLVVWNKVDRVDDPQKVKLEAEETGDTI--------------------CISALTGEGLDDFCNAVHEKLK 473
61 -12.400[R] COG2262 GTPases  ali follow..  18  199.....................TVSLVGYTNAGKSTLFNRITEARVYQLFATLDPTLRRIDVDVGETVLADTVG-AAFKATLQE-TRQATLLLHVIDAADVR-VQENIEAVNTVLEEIDAHEIPTLLVMNKIDMLEDFEPRIDRDEENKPI-------------------RVWLSAQTGAGIPQLFQALTERLS 362
62 -12.300[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  13  2.................KRPLIIGVGGPVGAGKTMLIERLLNTSVLPADRIAGVET-CDKHPDLQLLFLESGGDNLSATF---SPDLVDFSIYIIDVAQGEKIPRKGGQGMIKSD---------LFIINKVDLAPYVGANVEVMKADTLKSRGNK-------------DFFVTNLKTDEGLKSVADWIEKRLQ 200
63 -12.300[J] COG0532 Translation initiation factor 2 (IF-2; GTPase)  ali follow..  20  448......................VTIMGHVDHGKTTLLDRFRESRVTEGEATQHIGAYQIKANGKKITFLDTPGHEAFTSMRARGASVTDITILVVAADD------VMPQTIEAINHSKAAGVPIIVAINKIDKPGA-NPQRVTQELTEHGVFPVA--------PENGSEFVEISAKFNQNLDELLDTVL.... 605
64 -12.200[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  18  40.................DKIRNFGIVAHVDHGKSTLADRLGQKQMLDKLQTVKAQTAALRHRGYLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAANQ------VQAQTIANFWLAFEKNIQIIPVINKIDLPGADIKSVETQLKNL............................................. 181
65 -12.100[J] COG5256 Translation elongation factor EF-1alpha (GTPase)  ali follow..  15  1..........MKIMASQKPHLNLITIGHVDHGKSTLVGRLRFKEERERGVTIDLAHRKFETDKYYFTLIDAPGHRDFVKNMITGTSQADAAILVISAREGEGVMEQTREHAFLARTLGVPQ--MVVAINKMDATSPPYSEKRYNEV------KADAEKLLRSIGFKDISFVPISGYKGDNVSPNMPW...... 206
66 -11.800[J] KOG0468 U5 snRNP-specific protein  ali follow..  16  129.................PLIRNVALVGHLHHGKTTFVDCLQERGCSIKATPVTLVLQDVKQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDA-----AEGVMLNTERLLKHAVQERQAITVCINKIDRLILLPPQDAYFKLK.............................................. 281
67 -11.700[M] COG0481 Membrane GTPase LepA  ali follow..  13  2.................KNIRNFSIIAHIDHGKSTLSDRLRERGITIKAQSVTLNYKAKDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQ------VEAQTLANCYTAIEMNLEVVPILNKIDLPAADPERVAEEIEDIVGIDAME--------------AVRCSAKTGVGIEDVLEEIVHKI. 180
68 -11.300[J] KOG0052 Translation elongation factor EF-1 alpha/Tu  ali follow..  14  1.............MGKEKVHINIVVIGHVDSGKSTTTGHLKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEI----TNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLE.......... 203
69 -11.300[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  20  1...............MIENLRNIAIIAHVDHGKTTLVDKLESERVMDSNDTILAKNTAIKWNGYNINIVDTPGHADFGGEVERVMSMVDSVLLVVDAQD------PMPQTRFVTQKAFKAGLRPIVVVNKIDRPGARPDWVIDQIFDLFDNLGAT...................................... 154
70 -11.200[J] KOG0460 Mitochondrial translation elongation factor Tu  ali follow..  16  51.................KPHVNIGTIGHVDHGKTTLTAAIKAPEEKARGITISSAHVEYETANRHYAHVDCPGHADYIKNMITGAATMDGAIIVVSATDGQ-MPQTREHLLLA---RQVGVKQIVVYINKVDMVEPDMIELVEMEMR.............................................. 195
71 -11.200[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  17  25.................KSLLRFLTCGSVDDGKSTLIGRLGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCELAILLIDARKGV-LDQTRRHISTLLGIKH-----LVVAINKMDLVD--------SEETFTRIREDYLTFAGQLPGNLDIRFVPLSALEGDNVSESMPW...... 222
72 -11.100[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  17  4.................QSEINIGLVGHVDHGKTTLTKALSGVWTDTHSEEICERCGTETELLRKVSFVDAPGHETLMATMLSGAALMDGAILVIAANEPCPQPQTKEHLMAL---DVIGVKDVIVVQNKIDIVSKERALESYREI----------KEFVKGTCAEDAPIIPVSAQQGANIDILIETIEERIK 198
73 -10.800[J] KOG0459 Polypeptide release factor 3  ali follow..  14  99.................KRHLNVVFIGHVDAGKSTIGGQITNEEERLKGKTVEVGRAHFETESTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKETGYERGGQTREHVQLAKTLGVSKLIVVVNKMDDPTVNWSKERYDEIKMVPFLKASG------NTKKDVVFLPISGLMGKNMDQ.......... 298
74 -10.800[J] KOG0469 Elongation factor 2  ali follow..  13  1..MVNFTVDEIRALMDRKRNIRMSVIAHVDHGKSTLTDSLRFTDTRKDEQERCITIKSTAINGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDC-----VSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLLGAEELFQTFQ.............................................. 191
75 -10.500[J] COG0480 Translation elongation factors (GTPases)  ali follow..  16  8.................EKVRNIGIAAHIDAGKTTTTERIEGTAVTDWMDTITAAAISTSWKDYQINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVG------VQPQSETVWRQADRYKVPRIAFINKMDRTGARVHEQMRDRLRANAI.......................................... 160

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 2 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Berman HM, Burley SK, Chiu W, Sali A, Adzhubei A, Bourne PE, Bryant SH,Dunbrack RL Jr, Fidelis K, Frank J, Godzik A, Henrick K, Joachimiak A, HeymannB, Jones D, Markley JL, Moult J, Montelione GT, Orengo C, Rossmann MG, Rost B,Saibil H, Schwede T, Standley DM, Westbrook JD. Outcome of a workshop on archiving structural models of biological macromolecules. Structure. 2006 Aug;14(8):1211-7.