current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [A] KOG0265 U5 snRNP-specific protein-like factor and related proteins, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .
# Score Template Links and tools%idFirst MGTKRPNNSVILAQEAKRSKNDLMAYTNRDKALLESGVRRTSNLQAPIMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKKHAAHTLESPFQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDTITGMSLSPEGDFILTNAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWSPGSDKITSGSADRHVYIWDVNTRRILYKLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGEIDELast
1 -98.400[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali  100  1MGTKRPNNSVILAQEAKRSKNDLMAYTNRDKALLESGVRRTSNLQAPIMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKKHAAHTLESPFQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDTITGMSLSPEGDFILTNAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWSPGSDKITSGSADRHVYIWDVNTRRILYKLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGEIDE 347
2 -78.700[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  16  421............LGPGELAGLTVANEADSLTYDIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNLRGPLLGHTDAVWGLAYSAAHQRL-LSCSADGTLRLWNTTEVAPALSVELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLENSSCQINRVISHPTLSISITAHEDRHIKFYDNN----TGKLIHSMVAHLEA----VTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHEESIHDVAFHPSKCYIASAGADALAKVF.... 779
3 -75.500[R] KOG0286 G-protein beta subunit  ali follow..  18  3.....EMEQLRQEAEQLKKQIADARKACADVTLAELVSG-GRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTT-NKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREVSRELSAHTGYLSCCRFLDDNN--IVTSSGDTTCALWDIETGQQKTVFVGHGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLR----ADQELICFSHE--SIICGITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN... 340
4 -75.300[S] KOG0282 mRNA splicing factor  ali follow..  20  235.....GEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCKQIHVWSGHTKGVSAVRLFPLGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNR-KVPYCVKFNPDEDKLFVAGMSDKKIVQWDIRSGEIVQEYDRHGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNK-KKIFKGH--MVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPETSKVITCGWDGLIKLWD... 579
5 -72.400[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  21  92....RPVTRCSASIPGHGEPVISAQFSPDGRGLASGSGDQTMRIWLPLHTCKSHKSWVLCIAWSPDATKIASACKNGEICIWNAKTGEQIGKTLKRHKQWITSLAWQPTCRLLASCGKDGNIFIWDTVQGTVVRCLSGHTASVTCLRWGGEGL--IYSGSQDRTVKMWRADDGVMCRNMTGHAHINTLALNTDGERLVSGSDDFTLFMWNPETKQSINRMTGHMQLVNQVVFSPDTRYIASASFDKSVKLWCGR----TGKYLASLRGHVGP----VYQVAWSADSRLLVSGSADSTLKVFELKTKSLYYDLPGHGDEVFTVDWSPEGTKVVSGGKDKVLKLWR... 472
6 -71.300[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali follow..  20  169.......PNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNEGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTE--NGNLASTLGQHKGPIFALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMT--FASCSTDMCIHVCRLGCDHPVKTFQGHNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPMLASASFDSTVRLWDVE----QGVCTHTLMKHQEP----VYSVAFSPDGKYLASGSFDKYVHIWNTQSGSLVHSYQGT-GGIFEVCWNARGDKVGASASDGSVCVLDL.. 522
7 -71.200[S] KOG0295 WD40 repeat-containing protein  ali follow..  20  50...EKKWTTVLRLQRKVNDLESKLQESQREINHGAPTRDKRQAADPETQKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYETG-QLERTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLWDFQTYDCLKSLKGHEHTVSSVTFLPTGD-FVLSASRDHTIKQWDISTGYCVYTFRGHNDVRMIRISNDGTLFASASLDQTVTVWSFATKSAKLVLRDHEHAVECVEWAPDTAYLFSGSRDRSIKAWNIN----TGDVLFTLLAH----ENWVRGLAFHPKGKYLISVADDKTLRVWELSAQRCMKAIEAHEHFVSTVAFHQTSPFVITGSVDMSCKVWECR. 404
8 -70.800[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  16  50......MDMSVQGFFEHKDSVFSVSINPVHNLCASGGGDDLGYIWEQICQLTGHKDSIVAIDWSFDGTYIATGGMDSQVRLWKSSTG-FEFITAFETVDEIVWLSWHPKGLFLAAGCNDGSIWMWSLPSGKVVQVMYGHTAPVNAGKFIPPGVKRLATVDDSGTLIVWNPATGAPECRMETAAGWTSFDCNAEGNVLFLGGSSGKVKVVNINSSHILASLEAQTESVEAIALCTALPICACASVDGTVALYDSASLKFRKSL---------PHEQAVIDCKFLPNTPYLLTACADCVIRKWDVRSGQLLGEYTGHQEPILCMAITPDGKRVVTGSDDTELLVFDCEH 399
9 -70.600[R] KOG0288 WD40 repeat protein TipD  ali follow..  22  176.....ANDLYEEMLAKLKANGLETLARQQVDGIVRRNEDGTDHFVTCANRIHAHEGGCGSIVFEYNSGTLFTGGQDRAVKMWDTNSG-TLIKSLYGSLGNILDMAVTHDNKSVIAATSSNNLFVWDVSSGRVRHTLTGHTDKVCAVDVSKFSSRHVVSAAYDRTIKLWDLHKGYCTNTVLFTSNCNAICLSIDGLTVFSGHMDGNLRLWDIQTGKLLSEVAGHSSAVTSVSLSRNGNRILTSGRDNVHNVFDTR----TLEICGTLRASGNRLASNWSRSCISPDDDYVAAGSADGSVHVWSLSKGNIVSILKEQTSPILCCSWSGIGKPLASADKNGYVCTWT... 515
10 -70.600[S] KOG0293 WD40 repeat-containing protein  ali follow..  24  230..............NSLHIQRDSCVFHNTLDSDLSLYSDHQCGKHQTAQILESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGSLKHTLVGHHKPVIAILWSPDDRQVLTCGAEEVIRRWDVDSGDCVHMYEKGGISPISCGWYPDGQGI-IAGMTDRSICMWDLDGREKECWKGQRTKVSDIAMTDDGKWLVSVCKDSVISLFDREATV--ERLIEEEDMITSFSLSNDNKYILVNLLNQEIRLWNIEG---DPKIVSRYKGHKRS-RFIIRSCFGGYKQAFIASGSEDSQVYIWHRSTGKLIVELPGHAGAVNCVSWSPTNLMLASASDDGTIRIWGLDR 563
11 -69.700[A] KOG0285 Pleiotropic regulator 1  ali follow..  19  106.....TLPPRDLNNTGNPGKSTAILPAPGSFLSTAALMERMPSRWKNYRVLQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATG-VLKLTLTGHIGQVRGLAVSNRHTYMFSAGDDKQVKCWDLEQNKVIRSYHGHLHGVYCLALHPTLD-VVLTGGRDSVCRVWDIRTKMQIFVLPHDSDVFSVLARPTDPQVITGSHDSTIKFWDLRYGKSMATITNHKKTVRAMALHPKENDFVSASADNIKKFSL----PKGEFCHNMLSLQ----RDIINAVAVNEDG-VMVTGGDKGGLWFWDWKSGHNFQRAETSEAGIYAACYDQTGSRLVTCEGDKTIKMWKEDE 457
12 -69.500[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  15  1MSATELPTKEAHILKGHEGAVLAARFNGDGNYALTCGKDRTIRLWNPIKTYKSHGREVRDVHVTSDNAKFCSCGGDRQVYYWDVSTG-RVIRKFRGHDGEVNAVKFNDSSSVVVSAGFDRSLRVWDCRSHSVEPVQIIDTFLDTVMSVVLTKTEII-GGSVDGTVRTFDMRIGREMSDNLGQ-PVNCISISNDGNCVLAGCLDSTLRLLDRTTGELLQVYKGHISKKTDCCLTNSDAHVIGGSEDGLVFFWDLV----DAKVLSKFRAH-----DLVNSIDVDFYLRKFFVAGDKRELPPEGRLYVDFFGRWYNSLEKMKKQQILTSIDFVIYVSNSPFFFYYRL.. 343
13 -69.400[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  19  313......PSVCMYTFHHTNNNMNCAEFSPDSTMIACGFQESYIRLWSISVRLLSHSGPVYGTTFSPDNKYLLSCSEDASARLWSVDTK-TALVAYKGHTGPVWDVAFGPFGHYFATASHDQTAQLWSCDHIYPLRVFAGHLSDVDCVTFHPNSA-YVLTGSSDKTCRLWDVHRGHSVRVFNGHQPVTAVAIAPDGHTMASADSEGLIHLWDIGTGRRIKTMRGHRGNIYSLSFSRESTVLVSGGSDCTVRAWDVF----KTNYNNPVSSSLTG----SVVTPFSAKTSTFNE--------VNWSTSPDQMVALYTKQTPIFNVSFTRRNLCLAISVS........... 643
14 -69.200[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  22  4................................................ILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNG-ERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALL-KTNSAVRTCGFDFGGNIIMFSTDKQCFVSFFDLRDPSQIDN-CNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEH----------KTFRTERPVNSAALSPNYDHVVLGGGQEAARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDP 316
15 -69.000[S] KOG1407 WD40 repeat protein  ali follow..  19  3......................................ETTIPFKSHSREYQGHKKKVHSVAWNSNGTKLASGSVDQTARIWNIEPHGAKDLELKGHTDSVDQLCWDPKHSLVATASGDKSVRLWDARSGKCTQQV-ELSGENINITYKPDGTHV-AVGNRDDELTILDVRKFKPLHRRKFNYEVNEIAWNMPGDFFFLTTGLGTVEVLSYPSLKPLDTLTAHTAGCYCIAIDPKGRYFAVGSADSLVSLWDIS----DMLCLRTFTKL----EWPVRTISFNYSGEYIASASEDLFIDIANVQTGRTVHQIPCRAA-MNSVEWNPKYNLLAYAGDDKNPKYNTDE. 304
16 -68.400[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  23  7......................................DSVVRSFKVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCEKG-TQSRTVNSKKYGVDLIHFTHANNTASSTKVDDTIRYLSLHDNKYLRYFPGHTKKVISLCISPVEDTFL-SGSLDKTLRLWDLRSPNCQGLMHLSG-RPIAAYDPEGLIFAAGVNSESIKLYDLRSFDTFKLNQEKECDWTGLKFSRDGKTILISTNGSVIRLVDAF----HGTPLQTFTGYPNN-KGIPIEASFSPDSQFIFSGSTDGRVHIWNADTGNKVSVLNGHPGPVQCVQFNPKYMMLASACTNMAFWLPTSEE 315
17 -67.400[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  15  133.....NPFVLRRRFLGGFDDVTWLDWSSDSRLLAIGCRDSSTKIVAITYNLSGHTDAIVACFFEANSLHLNTISRNGQLCLWECSLAPSDLPRKEQRDVQLTAANYNTRTKVLVVAFSSGAFYLYELPDVNMIHSLSISDYPISAALFNCTGDWVALASREIGQLLVWEWQSEQYIMKQQGHSEMTCIAYSSDGQFIATGGEDSKVKLWNTQSSFCFVTFSEHTSGVTGIQFSRNKKFLVSSSLDGTVRAFDVNRY-------RNFRTFTSPNPAQFSCVAVDYSGELVVAGGQDFDIFLWSVKTGKLLEIISGHEGPVVSIAFSPTSSTLVSGSWDKTVKIWNCLE 554
18 -67.000[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  18  3.....LRLEIKRKLAQRSERVKSVDLHPTEPWILASLYSGTLCIWNMAKSFEVTELPVRSAKFVARKQWVVAGADDMYIRVYNYNTM-DKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGACTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKVNCVDYFTGGDKLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHAT----TYRLENTLNYGLER----VWAIGYIKSSRRVVIGYDEGTIMVKL-GREIPVASMDNTGKIIWAKHNEIQTANIKSIGADYEVTDGERL. 342
19 -66.900[R] KOG0645 WD40 repeat protein  ali follow..  18  1...................................................SGHTGRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNLVHVIDGFHTRSIRRVAWRPIERVLAVASFDSVVSINEKDDWECTAALEGHENEVKCIAWSCNGNYL-ATCSRDKSVWIWEATEDDEFDCLEHTQDVKVVTWHPTEDLLVSGSYDNSICFWDGDDWALTCQLQGHTNTVWALAFSPNGNTLASADNDGNVFLWIKISQEEWKQQTSLPHIHKGA----VYTISWMNDAT-LCSAGGDGKIVVYQREKHDYEQDHAHGVYEINSLEYLRDDR-LLSGGDDGECRVWSFK. 322
20 -66.400[R] KOG0289 mRNA splicing factor  ali follow..  18  121TKEVTAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELSHVGLHSASIPGILALDLCPDTNKILTGGADKNVVVFDKSSE-QILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGD-YLLSSSDDQYWAFSDIQTGRVLTKVTSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKL-------KNFKTLQLDNNFEVKSLIFDQSGTYLALGGTD--VQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL.. 504
21 -66.000[T] KOG0279 G protein beta subunit-like protein  ali follow..  21  1........................................MAEGLVLKGTMCAHTDMVTAIATPVDNDVIVTSSRDKSIILWKLTKEGVAQRRMTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQI-VSASRDRTIKLWNTLGECKYTI-GHKEWVSCVRFSPNTLTIVSASWDKTVKVWNLQNCKLRNTLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLA----EGKKLYSLEAG-----SIIHSLCFSPNRYWLCAAT-ENSIRIWDLESKSVVEDLKTKVIYCTSLNWSADGNTLFSGYTDGVIRVWGIGR 325
22 -65.900[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  16  62....QTLSDKDKTNSDDVLPGIDLEFEPEASALAPEPHSYE------TAYVTSHKQACRAGAFSCDGSLVATGSVDASIKILDVERGHPVIRTLYDHTDEVSYLEFHPKEHILASASRDGTVKLFDIAKPSKAHKVFTDCEPVLCLSFHPTGD-YVAIGTEHNVLRVYDVATTQCFVSAQHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRCINTIAEAHGAICSLEFTRNGKYLLSSGMDSLVYLWELC----TSRPIQTYTGATGKQEHQTEAVFNHTEDYVLFPDEATTSLCSWNSRNGCRLLNSLGHNGPVRYITHSPNGPAFLTCSDDFRARFWYRRA 421
23 -65.600[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  18  76...KKPAQLCKELLIRQLGGSRSHPFSTKTSRHVGGRLNLETYYSRPSECLMMLNQLPFCLGFANNESLLAVCTETGALELFDSRFSARRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQTSKVFDLSTQQCITRLGYHSHSVKQVNFCNDSPYNLVSCSRDGSIIFWDMRTHGITIDGERDCSITSATWLPQSTSISSCSANSALKLWDLRTVHTVRPLSKRDFGVTNVCTSPDGERIYAASRDSIIYEYSSRHLNSG--FCKTYKDPRLRISSFYVKLACSPDGATLACGGKTSGVVVFDTTRNSSAMLTGGHTKDVTAVDWSSEGQ-LASISDDGSVRVWNSSL 467
24 -65.500[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  19  347MSLQDEIQRVTNIKTSAKIKSFDLIHSPHGELAVFLLQNNLVELYSLRITIGGHRSDVRTLSFSSDNIAVLSAAAD-SIKIWNRSTLQCIRTM---TCEYALCSFFVPGDRQVVIGTKTGKLQLYDLASGNLLETIDAHDGALWSMSLSPDQRGFV-TGGADKSVKFWDFELVKDERTLQLDEDVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLKFFLSLYGHKLPVICMDISHDGALIATGSADRNVKIWGLD----FGDCHKSLFAHDDS----VMYLQFVPKSHLFFTAGKDHKIKQWDADKFEHIQTLEGHHQEIWCLAVSPSGDYVVSSSHDKSLRLWERTR 706
25 -65.400[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  14  15...KISFIIRDEHEYSNRSAVSALQYDAQNGRLFTGGSDTIIRTWSVQGSLEQHTDWVNDMILCGHGKILISASNDTTVKVWNIERDNKFIDCIRTHKDYVSCLAYAPIVEKAVSASFDHNIFVYDINANKTVNNLIGCKDSIYSLATTPNLS-LVLGAGTEKCIRLFDPRTNEKIMKLRGHDNVRALVVNDDGTRALSAGSDATIRLWDIGQQRCIATCIAHEEGVWTLQVDSSFTTVYSAGKDKMVVKTPLY----DFTKSQLLFKEEAP----VKKLLLSEKDNSLWVGTWKSDIKRWSIRPSAQLSIGGDEDGAIKKHAMLSDKRHVLTRDSDGNVALYDVLA 422
26 -65.200[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  17  10....ENKNIYATLPRTQRGQPIVLGADPKGKNFLYTNGNSVIENPAIADVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKEHLLKEFQPIAGPIKDISWSPDNQRIVAVGEGRFGHVFMSETGTSVGEISGQSKSINSADFRPARPFRIVTGSEDNTIAVFEGPPFKFKMTKQDHSRVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEFPAHKGGVYALAWKPDSTQLLTCSGDKTCRLWTVESRELVSEFVM-------GTTVDDQQVSCLWQGDNLITVSLSGVITYLNVADSKPLRVVKGHNKPITVLGLSDDRSTIYTGSHDGVVTNWNSGS 356
27 -64.900[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  13  52...RVFAKPFLASLDGHRDGVNCLAKHPEKATVLSGACDGEVRIWNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETFLLGSCASDRNIVLYDMRQATPLKKVILDMRTNTICWNPMEAFFTAANEDYNLYTFDMRADTPVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKS-------RSREVYHTKRMQHVICVKWTSDSKYIMCGSDEMNIRLWKANASEKLGVLTSREKAAKDFQHYPHIKRIARHR-HLPKSIYSQIQ 405
28 -64.300[R] KOG2096 WD40 repeat protein  ali follow..  15  27.....FRKRTSEVQSMAKAEPQDPIRNPKSNHPAPKKNHPKSQASDKLNTLKGHGDAVTGLCFSSDGKSLATACADGVIRVFKLDDKFRFLRINLPAGGHPTAVAFADDASSIVVGKLPLPSIKWDHHHIHEKRSVLTISGATATYGTADGSV-VIASCSEGTDIVLWHGKTGRNLGHVDTNLKNHMAAVSPNGRFLAAAAFTADVKVWEIVYQKRVMQLKGHKSAVTWLCFSPNSEQIITASKDGSIRVWNINVRYHLDEDPKTLKCDSGGNPLHYDRLSLCPEGKILAASH-GSTLQWLCAETGNVLDTAKAHEGDITCISWAPKAMVLGTSGDDKKVKLWEAPK 450
29 -64.300[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  15  430.....PTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPARQINTLNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLATPRIKAELTSSAPACYALAISPDSK-VCFSCCSDGNIAVWDLHNQTLVRQFQGHDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQH-DFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPD-----KYQLHLH----ESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASI-FQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEV.. 768
30 -64.100[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  15  13....SRKQETILLDEDEPAVVSSVRISPKKPYHVATTSSVRLTLYEPLNLFSRFKKGVCSIDFRHDGRLLAIGGDEGKVRIFDVEKSKVALRVMQASQSTVKSVHFSPRGDTVFSMADDGKIKQYRVADAVPIIEIQAHEDAIRCGAVSSINDHIVLTGGYDHKVRLWDIRSKEKSLELDCEHPVESVLFLPGEQLIATAA-GPIVKIWDTTTGRQLTALQAHYKTVTSLRLATNSTCLLSAGIDRRVNAFRTTNYSL----------NSWSMPSPVLDIDVSRDDQTMAIGMGNLLALYRRAEIKKEATASAAIEDKRSLIRTSAPPVKLVEKDRDMQKVDVVAKN 360
31 -64.100[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  18  385....REVPAYSRYLRERFLRCLDLYLCPRAKRVKLNIDAEYLIPKLPSMVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCI--RTIETDEVVRCVAWCPNPKLSIIAVATGNSNAEADEQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGRSALIHQLSKRRSQIPFSKSKGIQFVLFHPVKPCFFVAT-QHNIRIYDLVKQELVKKLLTNSKWISGMSIHPKGDNLLVSTYDKKMLWFDLD---LSTKPYQTMRLH----RNAVRSVAFHLRYPLFASGSDDQAVIVSHGMVYNPLKKLQTHEFGVLDVNWHPVQPWVFSTGADSTIRLYT... 784
32 -64.000[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  16  264.....ETAKLVRKKRIASSNLDHLAYDVVSNRFLAISAEQNLIILDF-QIVGFHDEIYSCCLLGKDESHMAVASNTSEIRLYNTKTL-DCQLIRGHTESVLSVVSPTWDTSLLASCSKDNSIIFWRLSTLVPVAAATGHANTVTALAISNTGRAFLASVSTDCTIKLWGLGVSTKLKEVKHGKDVNCVDISESDALIATGGMDKLVKLWQVDTHKIAGTLSGHRRGVGDVKFAKNSHKLASCSGDMTIKIWNIS----EKSCLQTISGHSCA----VFRVIFARNDSQLISADSAGIIKIWTIKTADCECSIDAHTDKIWSLSKNHNESEFVTAGTDGRIVVWKDVT 638
33 -63.600[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  14  22...QAHTGNCIKTMRVETSQVNALDRTPDKTRLAACGYQCESNCTAPVINFDGVQKNVTRLGFQEDGNWMFTAGEDHHVRIWDMIAAPPHCSRIFDCEAPVNAACLHPNQVEIAMGSQNGSVFLWDVKSERHERIVPEVDASIQDVAISPDGRYL-AAANNKGNCYIWSLTSQDQKMSTAHSRYILRCKFSPDSRLLLTTSGDGTVCIWKTDDFSKWRELCIENYWVWDAAFSADSKWLFTASSDGIARLWKLQ----TKSSIRDYTGH----TKAITALSFKDEIPVKSTNISDVQSSAKPPTQ------RDNPPGTNNLAFFETVGRVAMNPYMGNTTTELN... 362
34 -63.400[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  18  75...........QMQQSEAGPSSSRAEGPEDSDDSDFDETEAISIIKLEAKISHGTQAISALRVEPPGVRFASGGLDYYVKLFDFQKMDMSMRLLPAESHVINSLAFSPNGETLVVASGEAIIRLLDRAGKQWLNITKGHTATVNCVEFNPLNKNEFISCSDDGSLRLWNLDDHKVITKCGKRVSPQVCTFSPDGKWIAAGCDDGSVQAWKYGSQYVYLVRKAHNGSITSIAFSPDSKRLLSRGFDDTLKMWSLDNPKEPLLVKTGL-----ENAFKSTDCGFSPRAEVVFTGDTPGTLQFFDPMTFDLVYKIDYPGISCHRIQWHPRLNQIIAGLSDGTIHVYYDQT 449
35 -63.300[BK] KOG1063 RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily  ali follow..  14  288.GTFTYQISVESVLIGHEDWVYSVEWQPPVISILSASMDKTMMIWRPVGELSHCALGFYGGHWSPNSLSILAHGYGGAFHLWRNVSSSQMQKVPSGHFAAVTDVTWARTGEYLLSVSQDQTTRVFSAWKNDARPQVHGHDINCVAMVQGKGNHRF-VSGAEEKVVRVFEAPLSFLKTLNHGGEGLDTFETVPEAAPAELKEPPIEDQLAFHTLWPESHKLYGHGNELFSLCSDHKGNLVASSCKAQSASMAEIWLWVGTWKAVGRLQSHSLT----VTHLEFSYDDTLLLSVSRDRHFSVFSIQRTKLMAKVEAHKRIIWACSWNPFGHQFATSSRDKTVKIWSVEN 727
36 -63.200[R] KOG1334 WD40 repeat protein  ali follow..  19  229...........SALPRSRWQVLTALRQRQLGSSARFVYEACGARTRLQYLLGSHAGSVSTIHFNQRGTRLASSGDDLRVIVWDWVRQKPVLNFESGHDINVIQAKFFPNDSTLAMCGHDGQVRVAELINAENTKRVAKHRGPAHELALEPDSPYKFLTSGEDAVVFTIDLRQDRPASKVDKKVGLYTISMNPANYQFAVGGHDQFVRIYDQRRIDKKENYCDFPTNITCVVYSHDGTELLASYNDEDIYLFNSSL-SDGAQYVKRYKGHRNN-DTIKCVNFYGPRSEFVVSGSDCGHVFFWEKSSSQIIQFMEGRGDIVNCLEPHPYLPVLATSGLDQHVRIWTPT. 592
37 -63.000[R] KOG4227 WD40 repeat protein  ali follow..  18  2........KRRAGLGGSMRSVVGFLSQRGLHGDPLLTQDFQRRRLRGKKDLLGHFGCVNAIEFSNNGQWLVSGGDDRRVLLWHMEQAVKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETLDVF-AHEDAVYGLSVSPVNDNIFASSSDDGRVLIWDIRESPHGEPFNYPSAFHSVMFNPEPRLLATANSKEGVGLWDIRKPQLRYGGNLSLQSAMSVRFNSNGTQLLALRRRLPPVLYDIHSRLPVFQFDNQGYFNSCT----MKSCCFAGDRDYILSGSDDFNLYMWRIPANGAFMVLKGHRSIVNQVRFNPHTYMICSSGVEKIIKIWSPYK 364
38 -62.300[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  13  23...TWTLIQICMQESDVELETKVKKYLRGEGANLETLKDKKLKTQKLYGKSAKAAAKIEKWLLPAEAGYLETEGLEKTWRVKQTDLSSRNQYDIVLPDFGPYKLDFTASGRHMLAGGRKGHLALLDMMNMSLIKEI-QVRETVRDVAFLHNDQ-FFAAAQKKYAYIYG--RDGTELHCLKERGPVARLRFLKNHFLLASVNMSGQLHYQDVTHGGMVASIRTGKGRTDVMEVNPYNSVVGLGHSGGTVTMWKPT----SQAPLVQMQCHPGP----VSSVAFHPNGHLMATSGKERKIKIWDLRKFEEVQTSMVKGYQIEKVMFRPYEDVIGIGHSMGWSSILIPGS 411
39 -62.200[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  22  2........................................SAVCGGAARMLRTPGRHGYAAEFSPLPGRLACATAQGTLLILDPDEAGLRLFRSFDWNDGLFDVTWSENNEVLITCSGDGSLQLWDTAKAGPLQVYKEHAQEVYSVDWSQTRGELVVSGSWDQTVKLWDPTVGKSLCTFRGHESIYSTIWSPIPGCFASASGDQTLRIWDVKAAGVRIVIPAHQAEILSCDWCKNENLLVTGAVDCSLRGWDLRN---VRQPVFELLGHTYA----IRRVKFSPHASVLASCSYDFTVRFWNFSKPSLLETVEHHTEFTCGLDFSLQSPQVADCSWDETIKIYDPAC 318
40 -62.100[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  19  2............SLCGHTSPVDSVAFNSEEVLVLAGASSGVIKLWKMVRAFTGHRSNCSAVEFHPFGEFLASGSSDTNLRVWDTRKK-GCIQTYKGHTRGISTIEFSPDGRWVVSGGLDNVVKVWDLTAGKLLHEFKCHEGPIRSLDFHPLEF-LLATGSADRTVKFWDLETFELIGTTRPETGVRAIAFHPDGQTLFCGLDDG-LKVYSWEPVICRDGVDMGWSTL-GDFCINEGKFIGCSYYRNSVGIWVSD----ISELEPYGAVSEDKNECMVKRFSVLNDQSERMGSGPRGSV------------SPDYETREIKNIYVDSTGGNLNVAQNPGSLKATLPLE 322
41 -62.100[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  11  19.....AKPALLHRITGHVARINDVILLSKDEGVWTASDDRSVRLYLKPSIHHFMPVAPTSLYYSEETYKLLVGLINGNVYEFSVADDMTESRKWTCHAGPISGLGFALSSELIFSCSRDKSIVWHCSENSN---KMGSYLLENSCTAMVIDLPFV-FVGDHGGHVTVLRIVDNQVSKLSAHTNAITSLTWDGNKKVLYSGSSDHLIIMWDIGGGREAYELNGHNGKVTTLCAAPAAKRLFSADEHGKLMCWDMN----CKRVETPEWKTSDRTCGSAVCGSCCDNWTTYPPMGYETKIRICNNFNLTPLAIPHEIHTGITAMHLQETLGLLVTSGQNRVIMIWDVRS 406
42 -61.300[R] KOG2055 WD40 repeat protein  ali follow..  16  167...NALSEKSVIPKSLKSLFKSSVSYINQSSKLLAPGTINIKRLKD-ANFQAPSHSGIRCMSIHPYFPLLLTCGFDRTLRIYQLDGKNPLVTSLHLRSSALQTALFHPDGKRVIAAGRRKYMYIWDLESAQVQKVQENFQPSMERFHVDPTGK-YIALEGRSGHINLLHALTGQFATSFKIEGVLSDVLFTSDGSEMLVLSYGAEVWHFNVEQRSVVRRWQVQDGSTTHFCLDPSNKYLAIGSKSGIVNIYDLQTSDAAPKPVTTLDNITFS----INSMSFSQDSQVLAIASKKDTLRLVHVPSFSVFRNWPTPLGRVTCLAFGKGGE-LCVGNEAGRVGLWKLAH 517
43 -61.200[T] KOG4378 Nuclear protein COP1  ali follow..  15  1....................MMSNLVEPSWRLLAASG-GDTVKLFDVLSYTPSPGCAVNSVKWNHTNLVVASTGEDKKISLWRKNGQSTGKDGGDSAEECLSAISFSKKGSRICSGGTGQIVKIWDLQRKLCIKKLKGHTSTITGVMYNCKDEHL-ASVSVGGDLIVHNLASGARATELKDPNGLRLLDYSRSSRHLVTAGDDGTVHLWDTTGRSPKMSLKQHSAPTAGVCFSPSNEIIASVGMDKKLYTYDSGSRRSSSCI---------AYEAPFSSLAFGDNGYILVAGTSNGRVVFYDIRGKPTVLHAFSNSEDVTSLSWQTSKPVIVNEKNYTSEMALLGST 346
44 -61.200[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  12  1..........MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFEAENSKHIKKPIRSTVLSLDWHPNNV-LLAAGSCDFKCRVFSAYIKEEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVSTLKTEFLPLLSVSFVSENSVVAAGH-DCCPMLFIYDDRGCLTFV--------SKLDIPKQSIQRNMSAMERFRNMDK-----RATTEDRNTALETLHQNSITQVSIKQDCRKFCTTGIDGAMTIWDFKT 359
45 -61.100[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  15  1......................MSFFNRSNTTSALGTSTAMANEKDLIVINSPAEDSISDIAFSPQQDFMFSASSDGKVRIWDVQNGVPQGRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQ-TQQIGMHSAPIKVLRFVPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPERVYSMDNKQSLLVVATAERHIAIINLANPTTIFKATTSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDGMQKKSG-RAPGSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQRHRLKGYPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNR 342
46 -60.500[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  21  201.PDSLRIARLWLADYSLPRAKDRLVRAREALEVPSAARAGRMVELAPLCSQVGDTRPVSSAAFSEDSSLLLTSSWSGLCKLWSVPDC-ELKQTLRGHASYVGGVALRPGVKAMASGGHDGAVKLWGFNNEESIADITGHPHRVSKVAFHPSGRFL-ATACYDSSWRLWDLEQKTEVLHQEGHAKVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGRCIMFLEGHLGAVFGVDFSPNGFHIATGSQDNTCKIWDLR----RRQPVYTIPAH----TNLISDVKYQQEGSFLVTCSYDSTTKIWSNKTWQPLKTLQGHDNKVISVDIAPNSQYIATTSFDRTFKLWSPDS 553
47 -60.300[S] KOG0283 WD40 repeat-containing protein  ali follow..  19  341...KGVAHSMSLRVADKDVSDGSTDSPKKGKDHKHGKANEWVKVRPMCQEIQAHEGAVWTIKFSQDAHYLASGGADRVIHVWEVQEC-ELMSMNEGSLTPIHPSLCDSSGNEITVVEKKKKGKGSSGRSDKPVCSLKGHLDAILDLSWSKSQL--LLSSSMDKTVRLWDIETKTCLKLFAHNDYVTCIQFSPDENYFLSGSLDAKIRIWSIQDRH-VVEWSDLHEMVTAACYTPDGQGALIGSHKGICRAYDTEDCKLSQTNQIDVQSNKSQAKRKITSFQFSPVNPEVLVTSADSRIRILDGSEVIHKFKGFRNTCSQLSASYSQDGKYIICASEDSQVYLWKNDF 713
48 -60.200[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  14  261.....QKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGEITSLLLDTDYSRTRKAKVVLCVTFSENGDTIT-GDSSGNILVWGKGTNRISYAVQGAHEGGISPLCMLRDGTLVSGGGKDRKLISWSGNYQKLRPITQGHTDELWGLAIHASKP-QFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQPSHIYGGHSSHVTNVDFLCEDSHLISGGKDTSIMQWRV.. 716
49 -59.900[S] KOG0281 Beta-TrCP (transducin repeats containing)/Slimb proteins  ali follow..  20  148...SESRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCLQRIQCRSENSKGVCLQYDDEKIISGLRDNSIKIWDKTSL-ECLKVLTGHTGSVLCLQY--DERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGL---MVTCSKDRSIAVWDMASATDITLRGHRAAVNVVDF--DDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQY--RDRLVVSGSSDNTIRLWDIE----CGACLRVLEGH----EELVRCIRF--DNKRIVSGAYDGKIKVWDLQSTLCLRTLVEHSGRVFRLQF--DEFQIISSSHDDTILIWDFLN 487
50 -59.800[S] KOG4328 WD40 protein  ali follow..  13  160.....SSRVSKVSVKKEEPEDDSFSDYVNKEFSIPVKPEKIEFDLDLLNVARVVPGRIFVVQFLPNVKMVAAGDKLGNVGFWNLDCGNDGIYLFTPHSAPVSSIVFQQNSSRVISSSYDGLIRLMDVEKSV-FDLVYSTDEAIFSLSQRPNDEQSLYFGQDYGVFNVWDLRAGKSVFHWEHERRINSIDFNPQNPHMATSSTDGTACLWDLRSKPKTLSTVNHSRAVHSAYFSPSGLSLATTSLDNYIGVLSGA----NFENTCMIYHNNTSRWISKFKAVWGWDDSYIYVGNLSKKIDVINPKLKRTVMELHNPRAIPCRIHCHPNVGTLAGSTAGGQVYVWTTK. 516
51 -59.500[R] KOG2394 WD40 protein DMR-N9  ali follow..  13  121....SSRISGSFAASNSNTSMTNTNFDGKGTYLVFNVSDANSQEKDPVKSIHFSNSNPMCHAFAKDGHDLLIGLNSGDVYTVSLRQQLQDVSSVNNRQDRCTSISWVPSTFPAIRDPTQFSVDKAKYSKSNPVARWHICQGSINSIAFSNDGAHL-ATVGRDGYLRIFDFLTQKLVCGGKSYGALLCCSWSMDGKYILTGGEDDLVQVWSMEDRKVVAWGEGHNSWVSGVAFDSNWSRFGSVGQDTQLLLWDLE----MDEIVVPLRRAPGGHTEPLSGLMFTQES--VVTACREGHIKIWTRPSEQTNSSEANPTTALLSTSFTKDNKASLSSKIISGSTFKQ... 556
52 -59.400[R] KOG0646 WD40 repeat protein  ali follow..  16  21.....KTGTEQLQFKPCASPAHGLTAVGESSQLSARNTSGSIFYWSQAEVKSYPVEPIKALAANNEGTYLVGGGISGDIYLWEVATG-KLLKKWHGHYRSVTCLVFSGDDSLLVSGSQDGSIRVWSLIRTLYEHNFNEHTMSVTDIVIDYGGCNVIISSSEDRTCKVWSLSRGKLLKNIIFPSVINALALDPGGCVFYAGARDSKIYIGAINATQVLGSVSEKGKAITCLAYCADGNLLISGSEDGVVCVWDPK----SLRHVRTLIHAKGSRKGPVNNI---QIVRKTIVANSNKTQVSWKSRGALIPPPLEKYER---PVEDTMDGIVTVDPPPFSDVPVYS... 373
53 -59.300[A] KOG0299 U3 snoRNP-associated protein (contains WD40 repeats)  ali follow..  15  74LAREYLDEVKNELVEDGGFDAKEVDRELLASRLKEDVLEKKGQMYLDYQLRGRHMRPLVGVVAYENF--VYSADKSGLIQKWEALQESRSRRGENDHVKEITCLAISNDGRWIVTGGLDHRIVIRDSVTLEPQHCWKHHRDAVMGLAMRRGTNEM-FSCSADRSIKVWSLDQMSYIETLFGHDVIFGVDALARERCVSVGGRDRTSRLWKIVEESQLKATAGYMEGSVDCVAMIDEDHFVTGSDNGVIALWSVQRSAETSPDPVTIPPQPR----WITSLAAIPYSNLFASGSWDGNIRLWKIAEGLRSFEPLSVYGCINSLSLSLQGKVFAACGRETRVGRWKTLR 497
54 -58.900[U] KOG1332 Vesicle coat complex COPII, subunit SEC13  ali follow..  20  7................................................TVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGILIADLRGHEGPVWQVAWAHPGNILASCSYDRKVIIWREENGEKSHEHAGHDSSVNSVCWAPHDYLILACGSSDGAISLLTYTGEGQWEVKKHTIGCNAVSWAPAVKRFASGGCDNLIKLWKEEEDGEEQKLEAHSDWVRDVAWAPSTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKF----NDVVWHVSWSITANILAVSGGDNKVTLWKESVDVCISDVNKGQGSVSSVTEGQQNEQ................. 322
55 -58.700[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  10  87INILSRNGKVENMVDAHNGAALCARWNSDGTGLLSSGEDGFVKMWSRRSVLAQFATAVYCVAWDSTSSNVLYCNADHCYIKSLKMQ--VAPIKWKAHDGIILCCDWNPTSDLIVTGGEDLKFKVWD-GFGQILFNSSVHDYPITSISWNTDGTLFAV--GSHNILRLCDKSGWSHSLEKMNAGSVMALSWSPDGTQLAVGTAAGLVFHAHIIDKRLTNTPTMIEYNERTVNIIVQCEKIFLVSDGMTITIFTYEGRKLINLNPPGQVMALLD----ERKIDLANDTLVVRDRADNKVLHFFDPTTGKAQGDGNKHEHDIVELTVNQCGRNVAFRDQIGAVHIAMVKT 493
56 -58.300[R] KOG1539 WD repeat protein  ali follow..  14  176.....NTKKMLYQFKGWGSSVTSCVSSPALDVVAIGCADGKIHVHNIVTFEHASRGAVTALSFSTDGRLLASGGSFGVISIWNLNKKRLQSVIRDAHDSSIISLNFLANEPVLMSASADNSLKMWIFDTNRLLRFRSGHSAPPLCIRFYSNGRHIL-SAGQDRAFRLFSVIQEQQSRELSQRLAILACAISACGNFAVVGTAGGWIERFNLQSGISRGSYYAHDGEVIGVACDSTNTLMISAGYHGDLKVWDFKKRELKSQW---------DVGCSLVKIVYHRVNGLLATVADDFVIRLYDVVTLKMVREFRGHTDRITDLCFSEDGKWVISSSMDGSLRIWDVIL 609
57 -58.100[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  16  72......NQNRTRILAFRNKPKSLLSTNHSDSPHQNPKPVKPRRYIPQNAPGLRDDFSLNLLDWGSANVLAIAL--GDTVYLWDASSGSSELVTIDEDKGPVTSINWTQDGLDLAVGLDNSEVQLWDCVSNRQVRTLRGGHE-SRVGSLAWDNH-ILTTGGMDGKIVNNDVRIRSSIVETGHTEEVCGLKWSESGNKQASGGNDNVVHIWDRSLASWLHRFEEHTAAVRALAWCPFQASLLATGGDGKIKFWNTH----TGACLNSVETGSQ-----VCSLLWSQSERELLSGFTQNQLTLWKYPSMSKMAELNGHTSRVLFMAQSPNGCTVASAAGDENLRLWNVFG 419
58 -57.400[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  18  3........................................TVTPSAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNS--LKGEFLHGGAVLDCCFHDDFSGFSVGA-DYKVRRIVFNVGK-EDILGTHDKAVRCVEYFDFSIGQVITGSWDKTVKCWDPRGASGPERTTYLQPERVYSMSLVGHRLVVATAGRHVNIYDLRNMSEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEAAQAKKYAFKCHRRDIVYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRLYQYSKYPTSISALSFSRDGQLLAVASSYTAIFVRSVNE 339
59 -57.300[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  19  121.....LTKFIRTAMNKVKCPVYSVCWSPEGKRLITGCQTGEFTLWNGETILQAHDSAIRALKWASNEQWLLSADQGGYVKYWQPNMN-NAHMFSAHKDEAIRGLAFAPTDVKFATASDDGTARVWDFARYTEERVLRGHGAEVRCIDWHPTKGLIATGSRDQQPVKIWDPKSGSCLATLQEHSSVMAVEFNKNGNWLLTGGRDHLVKMYDIRMMKEMRTYRAHKKEVISLAWHPIHELFVSGGGDGSIVYWMVDG---EKEIGLLEHAH----DQAIWSMKWHPLGHILATGSNDNNTKFWARNFGLSNTNMIGHLDKEREPRMAPPKPSIETQETYRPDTFIPGMG 471
60 -57.100[I] KOG0301 Phospholipase A2-activating protein (contains WD40 repeats)  ali follow..  15  1...............................MADDGLGDVPMETETISHVIEAHKSDTKALAVTQGGC-LISGGRDETVKFWAKKGKQKTHAFEQPKGITVNSIAYAEDGWRLFVGRRDGTIAVFGPSQAEPYAIFNEHKQNVCCLHINEKATHM-LSGSWDSNVIIWPITELNTIVCPGHTLSVWALASFPDLNTYLSASADKTIRMWF--GDTTLSVFKGHTDVVRALVVLSSSH-FLSAGNDGHIIHWDVA----SASILRKFATQAHE-----FIYSMTLSDSHILTTGEDGTLEFWAIDGGKSEAVIQLPTTNTWDAKVLLNSD-IAVAGSDGRIYIMTTDK 323
61 -56.800[R] KOG1273 WD40 repeat protein  ali follow..  22  16...............................................VIEEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDFETR-GIAKEIRDNSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTIPLSSAPMIVDFDIDCTTLL-PVSVPEMPDVLAPPQRSKCPESNPPFSPAAACFNKCGDLVYIGNSKGEILIVDYKSVRVLALVSSGAAPVKNIVFSRNGQYLLTNSHDRTIRIYENLLPAKGSKCLTLFREFQDSTKMHWKAPCFSGDGEWVVGGSGEHKIYIWD-RAGHLVKILEGPKEALIDLAWHPVHPIIVSVSLAGLVYIWAKD. 347
62 -56.500[YU] KOG2445 Nuclear pore complex component (sc Seh1)  ali follow..  16  3................................................PFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTELSDSWRAHDSSIVAIDWASPGRIIASASYDKTVKLWEEDPDQKLCTLNDSKGSLYSVKFAPAHLLKLACLGNDGILRLYDALEPSDLRSWNHLQSDFCLSWCPSRFEKLAVSALEQAIIYKDGKLHVAAKLPGHKSLIRSISWAPSYQLIATGCKDGRIRIFKITEKLSPLAS--------EESLTNSNMFDNSADVDMDAQGRSDSNTELQSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKAT. 334
63 -56.000[R] KOG1310 WD40 repeat protein  ali follow..  17  1..........MDNLSFHDGNIFNLLHTRSQDPSHEVDQRMQFHSSSQEQELEGHQGCVNALAWNSNGSLLISGSDDLRINIWNYSSRKLLHSIDTGHTANIFCTKFVPEDELVVSGAGDAEVRLFNTSRLSPSALYQCHTRRVKKLAVEPGNPNVVWSASEDGTLRQHDFRESTSCPPAKQTLSLKSCDISARPHLLLVGGSDAFARLYDRRMLPPLSERGRTNLHLTHVTFSPNGEEVLLSYSGEHVYLMNVNNGTGAIDMKRRYVGHCNVGTDIKQASFLGQRGEYIASGSDDGRWFIWEKQTGRLMKVLVGDESVLNCIQCHPFDSVVATSGIDNTIKIWSPTA 691
64 -55.600[R] KOG0322 G-protein beta subunit-like protein GNB1L, contains WD repeats  ali follow..  14  7.............................................DPVFSLRSPDGAVNSLCFQESDR-LLAGTIKGSVFLWDLQTN-RSALHFEVGSDPITSLHHTPDR--LVTQEKGGTITMFSIGGSSYVKELGFCRSALHTNTSKTNEQ-LLFYPCEESSIGVLHVTDAAAPTQILVPDDCFKPFECASQLFLLAGYESGHFLTWDISSSVIL-DVMELAQDATSVDYDPVTNRGIVGGPTDKLISFSYQRSSMQMQLGSELCIKNPG----VNGVRIRPDQKVFASAGWDGRIRIFSWKSLRPLAVLTQHNGGVMDLAFSSQAPIMAAAGMDGQISLWDLYN 323
65 -55.200[Z] KOG0313 Microtubule binding protein YTM1 (contains WD40 repeats)  ali follow..  21  87...EKCTAPQPEQCMFHDDWISSIKGAEEW--ILTGSYDKTSRIWKSIMTIVGHTDVVKDVAWVKKDSLLLSASMDQTILLWEWNVERKALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEESTNRPRKKQKTEQL-----------------GLTRTPIVTLSGHEAVSSVLWSDAEE-ICSASWDHTIRVWDVGSGSLKSTL-TGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRT-KDGSLVSLSLTSHT----GWVTSVKWSPTHQQLISGSLDNIVKLWDTRSCKALYDLAAHEDKVLSVDWTDTGL-LLSGGADNKLYSYRYSP 416
66 -54.800[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  12  3.....SNQQPPSNLQTYGVPIYAVDWILEEAVRSKITKDQDDDDDDPIGRRVIGTDLPYRMAIHPRQGGLICAL-PNSCRLFDWENESEKVVKELKDVGQQLSLSFNQDGTVLATGAEDGTLRVFEWPSMKTLLNESKTHASVKSLTFSESGKFLVSLG--APLCRVWDVNASAAIASLSKEKDFASCRFSVDNSVAANTQRGGSIITWDTTSWRRRSSLIKRNNSISAFNVSADGKLLAVGTLEGDVLIIDSTK-------MQTNQIVKKAHLGLVTALTFSPDSRCLVSVSFDSRARLTVIKQKGEKRRYLWVAALLFVLVYVVLYYLMVAMGIIH......... 383
67 -54.800[S] KOG0294 WD40 repeat-containing protein  ali follow..  11  31...DSVKFELKQTFADSSYARSITSLAVQWPWVASGGTDGRIFVYKQSQIILSHAGRVNTLKFTPDLSLLLSGSDDGHMIATRVGSWTKEYDWQKAHAGAVTHVSCHPSSKLALSLGGDQVLNTWNLVNGCVAHKTNTLDFQTGCLSWSKQGDHFTLSG--PLVLEIWGIENAHVMRRIEMPSKPICITWL-DGNECLTGLDNGNIAWISLKDEDPPTFILAHEVRVKAIAYL--NEFLATVSIAGQIKVWKIDMETRKLEEIA-----RSFMDCRPTDLGLLDLRQFGNVRPVEQRTKVEEKPKAKV-SAKPAAPRGFVTIEYEQDKKLDAEKKKEKKKNKKDEE. 379
68 -54.300[R] KOG2321 WD40 repeat protein  ali follow..  12  2.........SLKVQNPNNVRVYTVSGEGVTQRLPNWISKRKLKKDYELLQDFEYPEASNRIKCTRDGKYAMATGYKPHIKVFDFAEM-SLKFERHTDAENVQFEILSDDWTKSVHLQTDRTVDFHSQGGIHYSTRIPKY---GRDLKYHYPNCDLYLAAA-GDEVYRLNLEQGRFLNPLKPTGGVNVIDINPMHQLLAFGTDAGSVEFWDPRDRSRVGILEDNSRSVTALKYRNDGLNVAIGLSDGATLLYDLRSSSP-------YMSKDQGYSMPIKSLHWMDDGTARVLSADSKIIKIWEKDTGKPFSSI-EPTVELNDVCPIEGTGLILTANEGSPMHAFYIPS 355
69 -53.900[R] KOG2919 Guanine nucleotide-binding protein  ali follow..  15  75VVDIEDTLELTSNGNEAKPEDQELAIAPVLQYFQGALVELGRRCWT---SSTEAQHYTKGCYWSPDGTCLLVPVHLDGMHVIEMPSDKLQSEVHVPEGGTVYDCVWYPHMNLWLATRQHEPIHMWDAFDGSLRCSYSGYDMAAISLAFSHDGEQIYA--GYKRCIKIFDTSRGRFCDDYPVKFAISCIAQTTAHPTLTCGNWHGYIQHFDLRCSHPLFTLGGHKGGITQLRYGEFGNLFSGARKCDKILQWDMR---NYKQPLVELQRHVDTNQR--IQFDLASDSNWLASGDTRGFVNVWDLKKYGDPSVLPLHSDCCNGVALNPAMPILATSSGENAVVMWWCGQ 485
70 -53.600[T] KOG1354 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  18  1................................MAGAGGGNDIQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIYLKSLEIEEKINKIRWLPQKNQFLLSTNDKTIKLWKVEASPRRIFANAHTYHINSISINSDYETYLSA--DDLRINLWHLEITDRSFNIELTEVITAAEFHPNSNTFVYSSSKGTIRLCDMRASALCDRFSEIISSISDVKFSHSGRYMMTRD-YLSVKIWDLN---MENRPVETYQVHENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASFNKKILHTAWHPKENIIAVATTNN-LYIFQDK. 445
71 -53.100[R] KOG2444 WD40 repeat protein  ali follow..  12  4...............EFDNPPLCMKSNKDGSRLVVGFVDGSIRFYDQEIWKFQTKSSIRGVDLDEHKKRVYAVTKNRSLCVFDIDTGKRVRCILKCHRSVPTAICTLPKSQQLATADESGEVKTWNLDPNANIRKWQEQDEDINDLKVDVKSNLLATSS--DGTLGAYDLRKAKLKMRSELMHS-ELYSVCGTNRSVYVGGEDGYVEVFNLNENLLERVESGFEMGVNGIVELRSGLLGLTSQGSNRMRLLNVQP----SKRLGYAGYHGDSDDDGIDAITISTDKSTVTMISMSCTIKKWDMGPIIDEIPI-LRAQDAKSKKMRKTEGFFDGLVGPKNDSDSDDDD 349
72 -52.400[R] KOG4497 Uncharacterized conserved protein WDR8, contains WD repeats  ali follow..  12  31LVVRDVNTLQILQLYTCLDQIQHIEWSADSLFILCAMYKRSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEHLRITVWSLCTKS--VSYIKYPKACLQGITFTRDGRYMALAERRDCVSIFVCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAVWDTCEYKILLYSLDGRSTYSAYEWSLGIKSVAWSPSSQFLAVGSYDGKVRILNHVTWKMITEFANPKMGIGMLAFSPDSYFLATRNDNNAVWVWDIQKLRLFAVLE---------QLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGEGDFAVLSLCWHLSGDSMALLSKDHFCLCFLETE 446
73 -52.000[T] COG5170 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  14  1...............................MDDIEDSLDQWKFAQCFGDKITEADIISAVEFDHTGDYLATGDKGGRVVLFERNHSKKGYLKSLEIEEKINKIRWCKRTNHFLLSTNDKTIKLWKLYEKNLKVVANAHAYHINSISVNSDAETYISA--DDLRINLWNLSISDHSFNIELTEVITSAEFHPNCNHLMYSSSKGNIKLLDLRQSALKSFFSEIISSISDVKFSQNGRYILSRD-YLTLKIWDVNMEKAPVKTIPLHDVYENDCIFDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLPGDRGQDYNKKILHASWHPFEDSVAIAATNN-LFVFS... 461
74 -51.400[BL] KOG1009 Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats)  ali follow..  16  4........ITCEIAWHNKEPVYSLDFQHGTARLASAGVDTNVRIWEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWKVNDNKTVVKTLRGHLEDVYDICWATDGNLMASASVDNTAIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYV-ATLSCDRVLRVYSIQKKRVAFNVSKMLSFRRLSFTPDGSLLLTPAGCVESGENVMNTKRPIAHLPCPGKATLAVRCCPVYFELRPVVET-------------------------------GVELMSLPYRLVFAVASEDSVLLYDTQQSFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCSFVTFEK 377
75 -51.200[KL] KOG4283 Transcription-coupled repair protein CSA, contains WD40 domain  ali follow..  17  10...............................................................TGRIRSNSFANRFKSRRILSLQLS-NRKDFVSPHRGSVNSLQVDLEGRYLLSGAADGSAAVFDVQRATDKQHENGHKYAISSAIWYPIDTGLFITGSFDHYLKVWDTNTAQAVVDFKMPGKVYRTSMAMSHTLIAAGTEDVQVRLCDIASGAFSHTLSGHRDGVMSVEWSTSSEWV-------------------------------------------------LYTGGCDGAIRFWDIRRAGCFRVLDQS---QTQLGFRPPILKRTAVGSKVC........ 253

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhao Y, Hong DH, Pawlyk B, Yue G, Adamian M, Grynberg M, Godzik A., Li T. The retinitis pigmentosa GTPase regulator (RPGR)- interacting protein: subserving RPGR function and participating in disk morphogenesis. Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3965-70. Epub 2003 Mar 21.