current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [S] KOG0293 WD40 repeat-containing protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .
# Score Template Links and tools%idFirst MGVVEDTEPPLKRAKRLADEPNGFSANSSVRGSSVNSNSLGDLMARPLPSQGDDETIGSKGVIRKSEFVRIITRALYSLGYDKTGAMLEEESGISLHNSTIKLFLQQVKDGKWDQSVKTLHRIGFPDEKAVKAASFLLLEQKFLEFLKVEKIADALRTLRNEMAPLRINTKRVHELASSLISPSSFISHTTSTPGKESVNSRSKVLEELQTLLPASVIIPEKRLECLVENSLHIQRDSCVFHNTLDSDLSLYSDHQCGKHQIPSQTAQILESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGHISLKHTLVGHHKPVIAILWSPDDRQVLTCGAEEVIRRWDVDSGDCVHMYEKGGISPISCGWYPDGQGIIAGMTDRSICMWDLDGREKECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLFDREATVERLIEEEDMITSFSLSNDNKYILVNLLNQEIRLWNIEGDPKIVSRYKGHKRSRFIIRSCFGGYKQAFIASGSEDSQVYIWHRSTGKLIVELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDRINQQNQKKKLVQGSSSNGVIHRCNGNLast
1 -185.000[S] KOG0293 WD40 repeat-containing protein  ali  100  1MGVVEDTEPPLKRAKRLADEPNGFSANSSVRGSSVNSNSLGDLMARPLPSQGDDETIGSKGVIRKSEFVRIITRALYSLGYDKTGAMLEEESGISLHNSTIKLFLQQVKDGKWDQSVKTLHRIGFPDEKAVKAASFLLLEQKFLEFLKVEKIADALRTLRNEMAPLRINTKRVHELASSLISPSSFISHTTSTPGKESVNSRSKVLEELQTLLPASVIIPEKRLECLVENSLHIQRDSCVFHNTLDSDLSLYSDHQCGKHQIPSQTAQILESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGHISLKHTLVGHHKPVIAILWSPDDRQVLTCGAEEVIRRWDVDSGDCVHMYEKGGISPISCGWYPDGQGIIAGMTDRSICMWDLDGREKECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLFDREATVERLIEEEDMITSFSLSNDNKYILVNLLNQEIRLWNIEGDPKIVSRYKGHKRSRFIIRSCFGGYKQAFIASGSEDSQVYIWHRSTGKLIVELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDRINQQNQKKKLVQGSSSNGVIHRCNGN 589
2 -99.100[R] KOG1334 WD40 repeat protein  ali follow..  16  2........PGLKAAMVVASLILATQNPDSVQPFGYCSGAKKLSDVRILWRTIGASEVKLFPYRDKNDHQHLPEGVSNKDFQSGATRKLLLPGDQLQQTSFEMSHQEGSTGGLPDLVTESLFSSP-GVAAVTAASSDIEMAATEPSTGDGGDTRDGGFLNDASTENQNTDESSSEDVELESMGEGLFGYPLPRMCPRCGGTNHDQCLLDEDQALEEWISSETSAL-----PRSRWQVLTALRQRQLGSSARFVYEACGARTFVQRRLQYLLGSHAGSVSTIHFNQRGTRLASSGDDLRVIVWDWVRQK--PVLNFESGHDINVIQAKFFPNDSTLAMCGHDGQVRVAELINAENTKRVAKHRGPAHELALEPDSYKFLTSGEDAVVFTIDLRQDRVVTRENDKKVGLYTISMNPANYQFAVGGHDQFVRIYDQRRIDKVYCDFPTNITCVVYSHDGTELLASYNDEDIYLFNSSLSDQYVKRYKGHRNNDTIKCVNFYGPRSEFVVSGSDCGHVFFWEKSSSQIIQFMEGRGDIVNCLEPHPYLP-VLATSGLDQHVRIWTPTAKT---ATELTGLKDVIKKNKQERDED 616
3 -76.100[R] KOG0289 mRNA splicing factor  ali follow..  13  28.....................................................................RLIEKYIAENGTD-NNQPLSEEQLIDIKVAHPIRPKPPSLQDEWDAVMLHSFTLR-----------------------QLQTTRQELSHALYQHDAACRVIARTKEVTAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQD--KATVLTTERKKRGKTVPELVKPEELSKYRQVASHVGLHSASIPGILALDLCPDTNKILTGGADKNVVVFDKSSE---QILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFE---VKSLIFDQSGTYLALGGTDVQI--YICKQWTEILHFTEHSGLTTGVAFGHHA-KFIASTGMDRSLKFYSL............................ 504
4 -72.800[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  14  387.......................................................................................................................................................................................EHEINRADEVEALTFPPSSGKSFIMGAD----------EALESELGPGELAGLTVANEADSLTYDIANNKDALRKTWNP----KFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTADVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWNTTEVAPALSVKELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQDTTANSSCQINRVISHPTLSISITAHEDRHIKFYDNNTGKLI-HSMVAHLEA---VTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHEESIHDVAFHPSKC-YIASAGADALAKVF.............................. 779
5 -72.400[S] KOG0282 mRNA splicing factor  ali follow..  14  1MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHV--KEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLGHLLLSCSMDCKIKLWEVYGER--RCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRK-VPYCVKFNPDEDLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLKKIFKGHMVAGY-ACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD............................. 579
6 -71.200[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  19  1................................................................................................................................................................................................................................................................MSATELPTKEAHILKGHEGAVLAARFNGDGNYALTCGKDRTIRLWNPHRG---ILIKTYKSHGREVRDVHVTSDNAKFCSCGGDRQVYYWDVSTGRVIRKFRGHDGEVNAVKFNDSSSVVVSAGFDRSLRVWDCRSHSVEPVQIIDTFLDTVMSVVLTKTEIIGGSVDGTVRTFDMRIGREMSDNLGQPVNCISISNDGNCVLAGCLDSTLRLLDRTTGELL-QVYKGHISKSF-KTDCCLTNSDAHVIGGSEDGLVFFWDLVDAKVLSKFRAHDL-VNSIDVDFYLRLLFFVAGDKRELPPEGRLYVDFFGRWQILTSIDFVIYVSNSPFFF 339
7 -70.900[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  22  12......................................................................................................................................................................................................................................................................SFKVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCEKG---TQSRTVNSKKYGVDLIHFTHANNTASSTKVDDTIRYLSLHDNKYLRYFPGHTKKVISLCISPVEDTFLSGSLDKTLRLWDLRSPNCQGLM--HLSGRPIAAYDPEGLIFAAGVNSESIKLYDLRSFDKLNQEKECDWTGLKFSRDGKTILISTNGSVIRLVDAFHGTPL-QTFTGYPNNKGIPIEASFSPDSQFIFSGSTDGRVHIWNADTGNKVSVLNGHPGPVQCVQFNPKYM-MLASACTNMAFWLPTSEEG......................... 316
8 -70.600[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  24  15.....................................................................................................................................................................................................................................EAKRSKNDLMAYTNRDKALLESGVRRTSNLQ----APIMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDC--ENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLCSGSDDRTIKIWDARKKHAAHTLESPF-QVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAHHLRGHSDTITGMSLSPEGDFILTNAMDNTLRVWDVRPGERCVKVFQGHQHNEKNLLRCAWSPGSDKITSGSADRHVYIWDVNTRRILYKLPGHNGSVNAVDFSPKEP-LILSGSSDKTLYLGEIDE.......................... 347
9 -70.300[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  13  1........................................................MSATNGPQPQDLNRIVLDYLAKKGYSRTEAMLRLEASGSGVSVEEKLKSIEETPDAYTHTYTILRDWVDSSKAELHRILFPIFVHSYLNLLSQDHYEAAKQFYELDVKNLKSLSLPSHVAEDRTAQQYRQNKYQLHFSRITFDLLLHFLFENVSNGGSIIIKLINQHIDIHIVPGMDLEEEDMMHQNDPNNQSPKLLKEFRKLHELPSVCMYTFHHTNNNMNCAEFSPDSTMIACGFQESYIRLWSIKADKDSDGSVRLLSHSGPVYGTTFSPDNKYLLSCSEDASARLWSVDTKTALVAYKGHTGPVWDVAFGPFGHYFATASHDQTAQLWSCDHIYPLRVFAGHLSDVDCVTFHPNSAYVLTGSSDKTCRLWDVHRGHRVFNGHTQPVTAVAIAPDGHTMASADSEGLIHLWDIGTGRRI-KTMRGHRGN---IYSLSFSRESTVLVSGGSDCTVRAWDVFKTNYNNPVSSSLTGSVVTPFSAKTSTF---------NEVNWSTSPDQMVA--LYTKQTPIFNVSFTRRNL 636
10 -68.500[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  18  29...........................................................................................................................................................................DISTNELQILCNQLLGSSDDPVPISFFTTEGAEIVDSIRKSLEEIDFETTLKLVSASIPGHGEPVISAQFSPDGRGLASGSGDQTMRIWDILELPLHTCKSHKSWVLCIAWSPDATKIASACKNGEICIWNAKTGE--QIGKTLKRHKQWITSLAWQPTCRLLASCGKDGNIFIWDTVQGTVVRCLSGHTASVTCLRWGGEGL-IYSGSQDRTVKMWRADDGVMCRNMTGHAHWINTLALNTDYALRTSCFEPSKRCIKPDTVE-ECQKVAQTRYEAALEIAGGERLVSGSDDFTLFMWNPKETKQSINRMTGHMQ---LVNQVVFSPDTRYIASASFDKSVKLWCGRTGKYLASLRGHVGPVYQVAWSADSR-LLVSGSADSTLKVFELKTKSLYYDL--PGHGDEVFTVDWSPEGT 457
11 -67.500[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  11  1........................................................................................................................................................................................................................................................MAQPYLPAEKFLSRKQETILLDEDEPAVVSSVRISPKKPYHVATTSSVRLTLYDTVVC---EPLNLFSRFKKGVCSIDFRHDGRLLAIGGDEGKVRIFDVESKVALRVMQASQSTVKSVHFSPRGDTVFSMADDGKIKQYRVADTAYIIEIQAHEDAIRCGAVSSNDHIVLTGGYDHKVRLWDIRSKEKSLLDCEHPVESVLFLPGEQLIATAA-GPIVKIWDTTTGRQL-TALQAHYKT---VTSLRLATNSTCLLSAGIDRRVNAFRTTNYSLINSW-SMPSPVLDIDVSRDDQ-TMAIGMGNLLALYRRAEIKKEATASA--AIEDKRSLIRTSAPPV 342
12 -67.400[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali follow..  15  2.............................................................SITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPSAL----------------------------------ISILQKGLQYVEAEISINK-DGTVFDSRPIESLSLIVAVIPDVVQMRQQAFGEKLTQQQASAAATEASAMAKAATMTPAAISQPKNREATVNGEENGAHEINNHSKPMEIDGDV---EIPPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGREGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTE-NGNLASTLGQHKGPIFALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMT-FASCSTDMCIHVCRLGCDHKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACV-HDLQAHSKE---IYTIKWSPTGPMLASASFDSTVRLWDVEQGVCTHTLMKHQEPVYSVAFSPDGK-YLASGSFDKYVHIWNTQSGSLVHSYQ---GTGGIFEVCWNARGD 506
13 -67.100[A] KOG0299 U3 snoRNP-associated protein (contains WD40 repeats)  ali follow..  14  62..............................................................................................................................................................................................................DTYETAAEKRLRLAREYLDEVLVEDGGFDAKEVDRELLASRLKEDVLEKKGQMYLVKIETAQLRGRHMRPLVGVVAYENF--VYSADKSGLIQKWEALQEKDTENRRGENDHVKEITCLAISNDGRWIVTGGLDHRIVIRDSVTLEPQHCWKHHRDAVMGLAMRRGTNEMFSCSADRSIKVWSLDQMSYIETLFGHQDVIFGVDALARERCVSVGGRDRTSRLWKIVEESQATAGYMEGSVDCVAMIDEDHFVTGSDNGVIALWSVQRKKPLFTYPLAHPPQPRWITSLAAIPYSNLFASGSWDGNIRLWKIAEGLRSFEPLSVYGCINSLSLSLQGKGVFAACGRETRVGRWKTLRGIPNSGF---VFNIPLTVIPSVTDGD 520
14 -66.800[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  13  1..........................................................................................................................................................................................................................................................................MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGS-QWVKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFEAENSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQV-STLKTEFLP---LLSVSFVSENSVVAAGH-DCCPMLFIYDDRGCLTFVTLHQNSITQVSIYEVDKRKFCTTGIDGAMTIWDFKTLESS...................... 363
15 -66.700[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  11  2..............................................................................................................................................................................................................................................SFFNRSNTTSALGTSTAMANEKDLAND-IVINSPAEDSISDIAFSPQQDFMFSASSDGKVRIWDVQNGV--PQGRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQ-TQQIGMHSAPIKVLRFPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPE-RVYSMDNKQSLLVVATAERHIAIINLANPTTKATTSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDGMQKKSGFS--QSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQRHRLKGYPTLQASIPVCSFNRNGS-VFAYALSYDWHQGHMGNRPDYPNVIRLH----ATTDEEVKEKKK 364
16 -65.900[Z] KOG0313 Microtubule binding protein YTM1 (contains WD40 repeats)  ali follow..  16  29...........................................................................................................................................................................EIADLSNIINKLLKDKNEFHKHVEFDFLIKGQFLRMPLDKHMEVENISSEEVVEIEYCMFHDDWISSIKGAEEWILTGS--YDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLLLSASMDQTILLWEWNVERKVKALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEESTNRPRKKQKTEQLG----------------LTRTPIVTLSGHMEAVSSVLWSDAEE-ICSASWDHTIRVWDVGSGSKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDLVSLSLTSHTG---WVTSVKWSPTHQQLISGSLDNIVKLWDTRSCKPLYDLAAHEDKVLSVDWTDTGL--LLSGGADNKLYSYRYSPTT........................ 418
17 -65.800[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  17  5............................................................................................................................................................................................................................................................................LLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNG---ERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALL-KTNSAVRTCGFDFGGNIIMFSTDKQFVSFFDLDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTF-----RTERPVNSAALSPNYDHVVLGGGQEAARFFHLAFEEEFGRVKGHFGPINSVAFHPDGK-SYSSGGEDGYVRIHYFDPQYFEFEFE.................. 324
18 -65.600[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  18  15....................................................................................................................................................................................................................................NEVEEVIKDNDKLMDQGVTEDEAEQEQNDTMNNMMDMSVQGFFEHKDSVFSVSINPVHNLCASGGGDDLGYIWDITTG---EQICQLTGHKDSIVAIDWSFDGTYIATGGMDSQVRLWKSSTGFEFITAFETVDEIVWLSWHPKGLFLAAGCNDGSIWMWSLPSGKVVQVMYGHTAPVNAGKFIPPGKRLATVDDSGTLIVWNPATGAPENEETAAGWTSFDCNAEGNVLFLGGSSGKVKVVNINSSH-ILASLEAQTES---VEAIALCTALPICACASVDGTVALYDSASLKFRKSL-PHEQAVIDCKFLPNTP-YLLTACADCVIRKWDVRSGQLLGEY--TGHQEPILCMAITPDGK 381
19 -65.400[U] KOG1332 Vesicle coat complex COPII, subunit SEC13  ali follow..  20  1.....................................................................................................................................................................................................................................................................MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQ-ILIADLRGHEGPVWQVAWAHPGNILASCSYDRKVIIWREENGEKSHEHAGHDSSVNSVCWAPHGLILACGSSDGAISLLTYTGEEVKKINNAHTIGCNAVSWAPAVV-----------------------PGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQEEQKLEAHSDW---VRDVAWAPSTSTIASCSQDGRVFIWTCDDASSPKLLHKFNDVVWHVSWSITAN-ILAVSGGDNKVTLWKESVDGQVCISDVNKGQGSVSSVTEGQQNE 321
20 -65.200[R] KOG0286 G-protein beta subunit  ali follow..  16  12.....................................................................................................................................................................................................................................EQLKKQIADARKACADVTLAEL--VSGLEVVGRQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTT---NKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREVSRELSAHTGYLSCCRFLDDNN-IVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQEL-ICFSHESIIC-GITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNRVSCLGVTADGM-AVATGSWDSFLKIWN............................. 340
21 -65.100[A] KOG0285 Pleiotropic regulator 1  ali follow..  11  5................................................................................................................NREVETQSLKKLSLKSVRRAREIFSPVHGQFPQPDPESKRIRLCHKIQVAFGGV-----EPASKPTRIADHNSEKTAPLKALALPGPKGSKELRKSATEKALVVGPTLPPRDLNN--TGNPGKSTAILPAPGSFSSTAALMERMPSRWPRPWKNYRVLQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATG---VLKLTLTGHIGQVRGLAVSNRHTYMFSAGDDKQVKCWDLEQNKVIRSYHGHLHGVYCLALHPTLDVVLTGGRDSVCRVWDIRTKMQIFVL-PHDSDVFSVLARPTDPQVITGSHDSTIKFWDLRYGKATITNHKKTVRAMALHPKENDFVSASADN-IKKFSLPKGEFCHNMLSLQRD---IINAVAVNEDGV-MVTGGDKGGLWFWDWKSGHNFQRAETSEAGIYAACYDQTGS-RLVTCEGDKTIKMWKEDE----------DATPETHPLNFKPPKE 473
22 -65.100[S] KOG1407 WD40 repeat protein  ali follow..  22  1...........................................................................................................................................................................................................................................................MEETTIPFKSLH---SREYQGHKKKVHSVAWNSNGTKLASGSVDQTARIWNIEPHGHSAKDLELKGHTDSVDQLCWDPKHSLVATASGDKSVRLWDARSGKCTQQV-ELSGENINITYKPDGTHVAVGNRDDELTILDVRKFKPLHRR-KFNYEVNEIAWNMPGDFFFLTTGLGTVEVLSYPSLKDTLTAHTAGCYCIAIDPKGRYFAVGSADSLVSLWDISDM-LCLRTFTKLEWP---VRTISFNYSGEYIASASEDLFIDIANVQTGRTVHQIPCRAA-MNSVEWNPKY-NLLAYAGDDKNPKYNTDEGVFRI...................... 309
23 -64.000[S] KOG4328 WD40 protein  ali follow..  11  3..........................................................TEYERKRLENIRRNDEMLAALNVRAKASSLLSAAKRSRDDSKSFKKKKP------ASTPTVIRMSLRTRGLNPDSAGLPDGFSDFRMGSQITHNQPSPQKQSPRLLAPIPFESAYEGYGSYTQLVDTLLGIESKSCRGKLVKGEIGVVKD-ENESPMVRTRSSSRVSKVSVKKEEPEDDSFSDYVNKEFSIPVKPEKIEFDLDLTLEPQNVARVVPGRIFVVQFLPNVKMVAAGDKLGNVGFWNLDCGNE-DGIYLFTPHSAPVSSIVFQQNSSRVISSSYDGLIRLMDVEKSV-FDLVYSTDEAIFSLSQRPNDQSLYFGQDYGVFNVWDLRAGKSVFHWELHERRINSIDFNPQNPVMATSSTDGTACLWDLRSMGASTVNHSRAVHSAYFSPSGLSLATTSLDNYIGVLSGANFENTCMIYHNNTSRWISKFKAVWGWDDSYIYVGNLSKKIDVINPKLKRTVMELHNPRAIPCRIHCHPYNVGTLAGSTAGGQVYVWTTK........................... 516
24 -63.800[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  12  11..............................................................................LGTIYRNGNLVTPDGNSVISPVGNRIT-------YDLKNNKSRTLSLESRYNYTNIAL---DGSLLIAVNEKGEAQLISMMSCTVIHRHKFQTGVQCI--------------------CFSPNGAFFAVAVQNVVEITGEYNPFVLRRRF-LGGFDDVTWLDWSSDSRLLAIGCRDSSTKIVAINYTRTYNLSGHTDAIVACFFEANSLHLNTISRNGQLCLWECSLAPSLADEPRKEQRDVQLTAANYNTRTKVLVVAFSSGAFYLYELPDVNMIHSLSISDYPISAALFNCTGDWVALASREGQLLVWEWQSEQYIMKQQGHSSEMTCIAYSSDGQFIATGGEDSKVKLWNTQSSFVTFSEHTSGVTGIQFSRNKKFLVSSSLDGTVRAFDVNRYRNFRTFTSPNPAQ---FSCVAVDYSGELVVAGGQDFDIFLWSVKTGKLLEIISGHEGPVVSIAFSPVATSTLVSGSWDKTVKIWNCLESNSEHETI--DAVSDVTNVTFSPSGE 578
25 -63.300[S] KOG0295 WD40 repeat-containing protein  ali follow..  16  20......................................................................................................................................................................................................................................QNNGYSESFSVFLKESSLSENDIKPLGGILEKKTTVLRLQRKVNDLESKLQESQREINHGAPTRDKRQAADWIPRP---PETQKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYETGQLERTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLWDFQTYDCLKSLKGHEHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYYTFRGHNDWVRMIRISNDGTLFASASLDQTVTVWSFATKSAK-LVLRDHEHAVECVEQQPEGNSTHILFSGSRDRSIKAWNINTGDVLFTLLAHENWVRGLAFHPKGK-YLISVADDKTLRVWELSAQRCMKAIE--AHEHFVSTVAFHQTSP 387
26 -63.100[T] KOG4378 Nuclear protein COP1  ali follow..  12  1....................................................................................................................................................................................................................................................................................MMSNLVEPSWRLLAASG-GDTVKLFDVSADSDPCVLSYTPSPGCAVNSVKWNHTNLVVASTGEDKKISLWRKNGQSLGTVGDSAEECLSAISFSKKGSRICSGGTGQIVKIWDLQRKLCIKKLKGHTSTITGVMYNCKDEHLASVSVGGDLIVHNLASGARAVVQFVHVLRLLDYSRSSRLLVTAGDDGTVHLWDTTGRSPKMSWLKQHSAP---TAGVCFSPSNEIIASVGMDKKLYTYDSGSRRSSSCI-AYEAPFSSLAFGDNGY-ILVAGTSNGRVVFYDIRGKPQVTVLHAFSNSEDVTSLSWQTSKP 328
27 -63.100[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  10  2....................................................................................................................................................................................................................................................AAIINQRVEQGESSMGGAKPALLHRITGHVARINDVILLSKDEGVWTASDDRSVRLYLKRDNDQFWPS-IHHFMPVAPTSLYYSEETYKLLVGLINGNVYEFDFNSMTESRKWTCHAGPISGLGFALSSELIFSCSRDKSIVWHCSENSNK---MGSYLLENSCTAMVIDLPFVFVGDHGGHVTVLRIVDNQSKLSAHTNAITSLTWDGNKKVLYSGSSDHLIIMWDIGGGRGEAYELNGHNGK---VTTLCAAPAAKRLFSADEHGKLMCWDMNCKRVETPEWKTSDCCQKCPFFWNLQAMYPPMGYETKIRICNDCNARMKDLAIPHEIHTGITAMHLQETLG 388
28 -62.500[R] KOG0645 WD40 repeat protein  ali follow..  16  1..............................................................................................................................................................................................................................................................................SGHTGRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNLVHVID--GFHTRSIRRVAWRPIERVLAVASFDSVVSINEKDDWECTAALEGHENEVKCIAWSCNGNYLATCSRDKSVWIWEATEDDCLAVLQEHTQDVKVVTWHPTEDLLVSGSYDNSICFWRDDGDDCQLQGHTNTVWALAFSPNGNTLASADNDGNVFLWIKISSNQQTSLPHIHKGA---VYTISWMNDAT-LCSAGGDGKIVVYQREKHDYEQDHAHGVYEINSLEYLRDDR--LLSGGDDGECRVWSFK........................... 322
29 -62.100[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  11  2...........................................................................................................................................................................KVKMLSRNPDNYVRETKLDLQRVPRNYDPALHPFEVPREYVRALNAT----KLERVFADGHRDGVNCLAKHPEKLAVLSGACDGEVRIWNLQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETFLGSCASDRNIVLYDMRQATPLKKVI-LDMRTNTICWNPMEAFFTAANEDYNLYTFDMRALDTVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYHTKRMQH---VICVKWTSDSKYIMCGSDEMNIRLWKANASEKLGVLTSREKAAEKFQHYPHIKRI--ARHRHLPKSIYSQIQEQRIMKEA--RRRKEVNRIKHSKPGS 429
30 -61.900[R] KOG0322 G-protein beta subunit-like protein GNB1L, contains WD repeats  ali follow..  13  5......................................................................................................................................................................................................................................................................PPDPVFSLRSPDGAVNSLCFQESDR-LLAGTIKGSVFLWDLQTN---RSALHFEVGSDPITSLHHTPDR--LVTQEKGGTITMFSIGGSSYVKELGFCRSALHTNTSKTNEQLLFYPCEESSIGVLHVTDAAAPTQILVPDDPCFKPFECASQLFLLAGYESGHFLTWDISSSVIDVMELAQDATSVDYDPVTNRGIVGGPTDKLISFSYQRSSMQMQLGSELCIKNPGVNGVRIRPDQKVFASAGWDGRIRIFSWKSLRPLAVLTQHKNGVMDLAFSSQQVPIMAAAGMDGQISLWDLYN.......................... 323
31 -61.900[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  14  49...........................................................................IWDLRKGEKILILQGLKQ-EVTCLCPSPDGLHLAVGYEDGSIRIFSLLSGEGNVTFNGHKAAITTLKYDQ--------------GGRLASGSKDTDIIVWDVINESGLYRLKGHKDAITQALFLREKNLLVTSGKDTMVKWWDLDTQHCFKTM-VGHRTEVWGLVLLSEEKRLITGASDSELRVWDIARKAGSIMREGRDRVVNLAVDKTGRILACHGTDSVLELFCILSKKEIQKKMTIGGHRSDVRTLSFSSDNIAVLSAAAD-SIKIWNRSTLQCIRTMTCEY--ALCSFFVPGDRQVVIGTKTGKLQLYDLASGNLLETIDAHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKDRTLQLDEDVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLKFF-LSLYGHKLP---VICMDISHDGALIATGSADRNVKIWGLDFGDCHKSLFAHDDSVMYLQFVPKS-HLFFTAGKDHKIKQWDADKFEHIQTL--EGHHQEIWCLAVSPSGD 688
32 -61.400[YU] KOG2445 Nuclear pore complex component (sc Seh1)  ali follow..  17  1.........................................................................................................................................................................................................................................................................MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDSNWELSDSWRAHDSSIVAIDWASPGRIIASASYDKTVKLWEEDPDQKLCTLNDSKGSLYSVKFAPAGLKLACLGNDGILRLYDALEPSLSIPPANHLQSDFCLSWCPSRFEKLAVSALEQAIIYQRGKDGKKLPGHKSLIRSISWAPSYQLIATGCKDGRIRIFKITEKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLTGT-ILSSAGDDGKVRLWKATSNEFKCMSVITAQQ............. 349
33 -61.200[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  13  1MTEPIKE----AAKRSVEAVYTGGTVRWSANGQKLFSTCTNVVKVIDLADNTASYTIGDPEDELRITCTAV-RNRLLVAYNNQIIREYSIPLDPSTTKPELAR-TAPILVMEFNEEGHLL----ATGSADHIVKVWNLTEQQCTHTLKGPSVVSAILFGKHEKLVVGYIEGQLNMRGAPKKLVNTWKSHNSHITALLQVPDSRVVVALSRDQTMSIHETETQETLRVL--PLYESIEGGAIGHNGN-LFTVGEEGVVKEFVITAKLVRKKRIASSNLDHLAYDVVSNRFLAISAEQNLIILDFENLKIARQI--VGFHDEIYSCCLLGKDESHMAVASNTSEIRLYNTKTLDCQLIRGHTESVLSVVSPTWDTSLLASCSKDNSIIFWRLVTSVPVAAATGHANTVTALAISNTGRFLASVSTDCTIKLWGLGVSSSTMVAHGKDVNCVDISESDALIATGGMDKLVKLWQVDTHKGIAGTLSGHRRG---VGDVKFAKNSHKLASCSGDMTIKIWNISEKSCLQTISGHSCAVFRVIFARNDSQ-LISADSAGIIKIWTIKTADCECSI--DAHTDKIWSLSKNHNES 620
34 -60.900[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  15  6......................................................................................................................................................................................................................................................................PSAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLKGEF----LHGGAVLDCCFHDDFSGFSVGA-DYKVRRIVFNVGKVEYFDFSILFFYTLCLFCDVTGQVITGSWDKTVKCWDPRGASGPERTGTYLQPERVYSMSLVGHRLVVATAGRHVNIYDLRNMQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEAAQRKSEAGRDIVYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRLYQYSKYPTSISALSFSRDGQLLAVASSYTEAIFVRSVNEIEVKPKPK--VYPNPAA......... 354
35 -60.900[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  14  1..............................................................................................................................................................MRDEILDPSNLVKNREILYRLMISQLMYDGLEKFAMELSMLVKADQCAPSERLLHVMIAGMQTLSDKDKTNSDDVLPGIDLEFEPEASALAPEPHSYE----------TAYVTSHKQACRAGAFSCDGSLVATGSVDASIKILDVERMLAKSVIRTLYDHTDEVSYLEFHPKEHILASASRDGTVKLFDIAKPSVKKKVFTDCEPVLCLSFHPTGDYVAIGTEHNVLRVYDVATTQCFVSAQQHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRCINTHGGAAICSLEFTRNGKYLLSSGMDSLVYLWELCTSRPI-QTYTGAGKQEHQTEAVFNHTEDYVLFPDEATTSLCSWNSRNGCRLTLSLGHNGPVRYITHSPNGP-AFLTCSDDFRARFWYRRANN........................ 423
36 -60.800[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  15  95...DNEEEESTDGEEVEDEEKDSKSKQTDDKPSGSGAASKKALTAELPKRDSSKPEYQDSDTSDEEDIRNTVGDEYKHIGYDWDAKKIIKPP----QGDQIDEFLRKIEDPDWRTVKDPLTGQDVRLTDEDIALIKRIVSGRIIEWFTSEVEKMPIK--KRSFLPSVSEKKRVSRMVHAL-PPEYLFDAKETKEWLKLKDEPHKRKLHFMPQKFKSLREVPAYSRYL--RERFLRCLDLYLCPRAKRVKLNIDAEYLIPKLFPTVESMVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCIRTI----ETDEVVRCVAWCPNPKLSIIAVATGNSNAEADEQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGAALIHQLSKRRSQIPFSKSKGLIQFVLFHPVKPCFFVAT-QHNIRIYDLVKQEKKLLTNSKWISGMSIHPKGDNLLVSTYDKKMLWFDLDLSTKPYQTMRLHRNA---VRSVAFHLRYPLFASGSDDQAVIVSHGMVYNPLKKLQTHEFGVLDVNWHPVQP-WVFSTGADSTIRLYT............................. 784
37 -60.600[R] KOG2096 WD40 repeat protein  ali follow..  13  2..................................................................................................................................................................................................DSVLVVGIASVILGALIAVLFFGSYFRKRTSEVQ-SMAKAEPQDPIRNPKSNHPAPKKNHPKSQASDKNQNDLNTLKGHGDAVTGLCFSSDGKSLATACADGVIRVFKLDDASSKRFLRINLPAGGHPTAVAFADDASSIVVACHHMSSIKWDHHHIHEKRSVLTISGATATYGTADGSVVIASCSEGTDIVLWHGKTGRNLGHVDTNQLKNHMAAVSPNGRFLAAAAFTADVKVWEIVYQKDQLKGHKSAVTWLCFSPNSEQIITASKDGSIRVWNINVRYHLDEPLCDSGGNPLHYDRLSLCPEGKILAASH-GSTLQWLCAETGNVLDTAKAHEGDITCISWAPKAIMVLGTSGDDKKVKLWEAPKSQSL...................... 454
38 -60.500[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  15  1............................................................................................................................................................................................................MSSCVNTSQTGPKKKISFIIRDEHEYSNRSAVSALQYDAQNGRLFTGGSDTIIRTWSVPVQYQGSLEQHTDWVNDMILCGHGKILISASNDTTVKVWNIERDNKHGFIDCIRTHKDYVSCLAYAPIVEKAVSASFDHNIFVYDINANKTVNNLIGCKDSIYSLATTPNLSLVLGAGTEKCIRLFDPRTNEKIMKLRGHTDNVRALVVNDDGTRALSAGSDATIRLWDIGQQRATCIAHEEGVWTLQVDSSFTTVYSAGKDKMVVKTPLYDFTKS-QLLFKEEAP---VKKLLLSEKDNSLWVGTWKSDIKRWSIRPSAQLSIGGDEDGAIKKHAMLSDKRH-VLTRDSDGNVALYDVLAARKIKDYIFEEVVDENSRQVYIPSWF 451
39 -60.500[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  12  1..............................................................................................................................................................................................................................................MEISSEDNNLMEKVLPPVEQVLTWTIQICMQESDVELETKVKKYLRGEGANLETLKDKKLKTQLASRE---KLYGKSAKAAAKIEKWLLPAEAGYLETEGLEKTWRVKDILSSRNQYDIVLPDFGPYKLDFTASGRHMLAGGRKGHLALLDMMNMSLIKEI-QVRETVRDVAFLHNDQFFAAAQKKYAY-IYGRDGTELHCLKERGPVARLRFLKNHFLLASVNMSGQLHYQDVTHGGMV-ASIRTGKGR---TDVMEVNPYNSVVGLGHSGGTVTMWKPTSQAPLVQMQCHPGPVSSVAFHPNGH-LMATSGKERKIKIWDLRKFEEVQTI----HSFHAKTLSFSQKGL 346
40 -60.300[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  11  12.....................................................................................................................................................................................................................................AQRSERVKSVDLHPTEPWILASLYSGTLCIWNYTQVMAKSFEVTELPVRSAKFVARKQWVVAGADDMYIRVYNYNTM---DKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGACTQIFEGHSHYVMQVTFNPKDNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDYLITGSDDHTAKVWDYQTKSQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYR-LENTLNYGLER---VWAIGYIKSSRRVVIGYDEGTIMVK-LGREIPVASMDNTGKIIWAKHNEIQTAN-IKSIGADYEVTDGERLPLS---VKELGTCDLYPQSLKHNPNGR 366
41 -60.300[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  13  396.......................................................................................................................................................................................NMSPQMSAAAAAAAVVAYGRSPMVGFD---PPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPHARQINTLNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLATPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDK--YQLHLHESC---VLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASI-FQSKESSSVLSCDISVDDK-YIVTGSGDKKATVYEV............................ 768
42 -60.200[BK] KOG1063 RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily  ali follow..  14  34.............................................................SFGAQNAVAVILTTLP--GHKASVNCTHWLPTSKFAFKAKKLDRQYLLSGDSDGIIILWELSTLNNDQQWRHVLQLPLSHK--AMFASASSDGVVNVWDVSFPSQPSEECKVVCLDS--ICVDTKAIVTLSLAELPQNPGRFALALGGLDNKIKLYSGERTGKFTSVCKGHTDWIRSLDFSLPLHTLVSSSQDKVIRIWKLVLSVESVLIGHEDWVYSVEWQPPVISILSASMDKTMMIWRPEKKTGVVCVGELSHCALGFYGGHWSPNSLSILAHGYGGAFHLWRNVSSQMQKVPSGHFAAVTDVTWARTGEYLLSVSQDQTTRVFSAWKNDARPQVHGHDINCVAMVQGKGNHRFVSGAEEKVVRVFEAPLSPLERNGGGEGLDTFETVPEAAPAELKEPPIEDQLAFHTLWPES-HKLYGHGNE---LFSLCSDHKGNLVASSCKAQSIWLWEVGTWKAVGRLQSHSLTVTHLEFSYDDT-LLLSVSRDRHFSVFSIQRTDNKLMAKVEAHKRIIWACSWNPFGH 709
43 -60.200[R] KOG4497 Uncharacterized conserved protein WDR8, contains WD repeats  ali follow..  13  3...................................................................................................................................................................................................................................FSEVFKLSSLLCKFSPDGKYLASCVQY-RLVVRDVNTLQILQLYTCLDQIQHIEWSADSLFILCAMKRGLVQVWSLEQP---EWHCKIDEGSAGLVASCWSPDGRHILNTTEHLRITVWSLCTKS-VSYIKYPKACLQGITFTRDGRYMALAERRDCVSIFVCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAVWDTCLEYKILLYSLDGRLLSEWSLGIKSVAWSPSSQFLAVGSYDGKVRILNHVTWKMITKPVTDRANPKMGIGMLAFSPDSYFLATRNDNNAVWVWDIQKLRLFAVL-EQLSPVRAFQWDPQQPR-LAICTGGSRLYLWSPAGCMSVQVP--GEGDFAVLSLCWHLSGD 428
44 -60.100[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  16  20.....................................................................................................................................................................................................................................RTQRGQPIVLGADPKGKNFLYTNGNSVIIRNIENPAIADVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKEH-LLKNEFQPIAGPIKDISWSPDNQRIVAVGEGREGHVFMSETGTSVGEISGQSKSINSADFRPARPRIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVSPAHKGGVYALAWKPDSTQLLTCSGDKTCRLWTVESRELVSEFVMGTTVD---DQQVSCLWQGDNLITVSLSGVITYLNVADSKPLRVVKGHNKPITVLGLSDDRS-TIYTGSHDGVVTNWNSGSGTND---RITGTGHGNQINGIAAWGD 379
45 -59.800[T] KOG0279 G protein beta subunit-like protein  ali follow..  18  4......................................................................................................................................................................................................................................................................GLVLKGTMCAHTDMVTAIATPVDNSVIVTSSRDKSIILWKLTKEDKSVAQRRMTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKLWNTLGECTISEADGHKEWVSCVRFSPNTLVIVSASWDKTVKVWNLQNCKNTLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL-----EAGSIIHSLCFSPNRYWLCAAT-ENSIRIWDLESKSVVEDLKTKVIYCTSLNWSADGN-TLFSGYTDGVIRVWGIGR.......................... 325
46 -59.600[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  16  5......................................................................................................................................................................................................................................................................CGGAARMLRTPGRHGYAAEFSPLPGRLACATAQGTLLILDPDEAG--LRLFRSFDWNDGLFDVTWSENNEVLITCSGDGSLQLWDTAKAGPLQVYKEHAQEVYSVDWSQTRGLVVSGSWDQTVKLWDPTVGKSLCTFRGHESIIYSTIWSPIPGCFASASGDQTLRIWDVKAAGVVIPAHQAEILSCDWCKNENLLVTGAVDCSLRGWDLRNVRQPVFELLGHTYA---IRRVKFSPHASVLASCSYDFTVRFWNFSKPSLLETVEHHTEFTCGLDFSLQSPTQVADCSWDETIKIYDPACLTIPA..................... 323
47 -59.500[R] KOG4227 WD40 repeat protein  ali follow..  15  8.....................................................................................................................................................................................................................................GGSMRSVVGFLSQRGLHGDPLLTQDFQRRRLRGRNLYKKDLLGHFGCVNAIEFSNNGQWLVSGGDDRRVLLWHMEQASRVKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETLDVF-AHEDAVYGLSVSPVNNIFASSSDDGRVLIWDIRESPHGECLANYPSAFHSVMFNPEPRLLATANSKEGVGLWDIRKPQSSLLLSLQSAMSVRFNSNGTQLLALRRRLPPVLYDIHSRLPVFQFDNQGYFNSCTMKSCCFAGDRQYILSGSDDFNLYMWRIPANGAFMVLKGHRSIVNQVRFNPHTY-MICSSGVEKIIKIWSPYKQPGC-TGDLDGRIEDDSRCLYTHEEY 389
48 -59.200[R] KOG0288 WD40 repeat protein TipD  ali follow..  16  8..............................................................VQEEKAMEAINDALRALRKRHLLEEGAHAPAISALSKPLISQGSEWKEKTEKLETELQQCYKAQSRLSEQLV--IEVAESRTSKAILQEKELLINDLQKELTQRREDCTRLQEELEIRSQLEEMTSRVQKAETENKMLIDRWMLQKMQD---AERLNEANDLYEEMLAKLKANGLETLARQQVDGIVRRNEDGTDHFVEIPSTCANRIHAHEGGCGSIVFEYNSGTLFTGGQDRAVKMWDTNSG---TLIKSLYGSLGNILDMAVTHDNKSVIAATSSNNLFVWDVSSGRVRHTLTGHTDKVCAVDVSKFSRHVVSAAYDRTIKLWDLHKGYCTNTV-LFTSNCNAICLSIDGLTVFSGHMDGNLRLWDIQTGKSEVAGHSSAVTSVSLSRNGNRILTSGRDNVHNVFDTRTLEICGTLRASGNRLASNWSRSCISPDDDYVAAGSADGSVHVWSLSKGNIVSILKEQTSPILCCSWSGIGK-PLASADKNGYVCTWT............................. 515
49 -59.200[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  13  5....................................................................................................................................................................................LSASRKTRHTEMVCGVGWIGTEA-ILSAADDHVFLLTNTATNESQQILNMPETFFPTSLHIFPQNDVFAVSTSDGKINILSRNGKVENMVDAHNGAALCARWNSDGTGLLSSGEDGFVKMWSRSGMLRSVLAQKWKAHDGIILCCDWNPTSDLIVTGGEDLKFKVWDG-FGQILFNSSVHDYPITSISWNTDGTLFAVGS-HNILRLCD-KSGWSHSLEKMNAGSVMALSWSPDGTQLAVGTAAGLVFHAHIIDKRNTPTMIEYNERTVNIIVQCEKIFLVSDGMTITIFTYEGRKLINLNPPGQVMALLDERKIDLANDTLVVRDRADNKVLHFFDPTTGKAQGDGNKHEHDIVELTVNQCGPRNVAFRDQIGAVHIAMVKTFGVSQRMV--KIGSLVEQLVFNDVTN 517
50 -58.900[S] KOG0270 WD40 repeat-containing protein  ali follow..  12  10..................................................RGFSSEFPEKYVLDDEEVERINQLAQLNL---DDAKATLEEAEGESGVEDDAATGSSNKLKDQLDIDDDLKEYN-------------------LEEYDDEEIADNEGGKDVSMFPGLSNDSDVKFHEGE-ISLPNQEDSQEEKQELQVYPSDNLVLAARTEDDVSYLDIYVYDDGA--FHSSDIPVEEGDEADPDVARGLVRDPALYVHHDLMLPAFPLCVEWLDYKVGSNSEEAANYAAIGTFDPQIEIWSKKKKKKSKTGHITTHHTDAVLSMAHNKYFRVLASTSADHTVKLWDLNSGNAARSLAHSNKNVSSSEWHMNGSILLTGGYDSRVALTDVRISDSKYWSAMAGEEIETVTFASENI-ILCGTDSGNVYSFDIRNNENTLKAHDAGISTLCSNKPGMMSTGAMGEKTVKLWKFPLDDSMVLSRDFDVGNVLTSSFAPDIEVAGTMVIGGVNKVLKLWDVFTNRSVKSFKSELENVQARAKEEAQ-KIGKSSRIARKYTSNDNPDTVI--TIDDQGEDEEEREGGDEHDDM 575
51 -58.600[R] KOG0646 WD40 repeat protein  ali follow..  14  2...................................................................................................................................................................................................................................................EITVIASSSIDEGIGSWDLTGTEQLQFKPCASPAHGLTAVGESSQLSARNTSGSIFYWSWTKPQ----AEVKSYPVEPIKALAANNEGTYLVGGGISGDIYLWEVATGKLLKKWHGHYRSVTCLVFSGDDSLLVSGSQDGSIRVWSLGNTLYEHNFNEHTMSVTDIVIDYGGCVIISSSEDRTCKVWSLSRGKLKNIIFPSVINALALDPGGCVFYAGARDSKIYIGAINATSQVLGSVSEKGKA---ITCLAYCADGNLLISGSEDGVVCVWDPKSLRHVRTLIHAKGSRKGPVNNIQIVRKTIVANSNKTQVSWKSRGALIPPPL-----EKYERPVEDTMDGI 358
52 -58.600[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  13  1..............................................................................................................................................................MNMDIGKALSDVGGLRDITSRANNSLPPTPDSSPAAPSKKHKLYDFLESRGKIETPRKRIVKPAQLCKELLIRQLGGSRSHPFSTKTSRHVGGRLNLE----TYYSRPSECLMMLNQLPFCLGFANNESLLAVCTETGALELFDSRFYDRQRRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQTSKVFDLSTQQCITRLGYHSHSVKQVNFCNDSPNLVSCSRDGSIIFWDMRTHGITHENSGRDCSITSATWLPQSTVISSCSANSALKLWDLRTVHTTTSKRDFGVTNVCTSPDGERIYAASRDSIIYEYSSRHLNSCKTYKDPRLRISSFYVKLACSPDGATLACGGKTSGVVVFDTTRNSSAMLTGGHTKDVTAVDWSSEGQ--LASISDDGSVRVWNSSLHGSAANLR-EKNFSEIFYWGFSEK.. 490
53 -58.400[I] KOG0301 Phospholipase A2-activating protein (contains WD40 repeats)  ali follow..  12  2.......................................................................................................................................................................................................................................................ADDGLGDVPMETESMQYTISHVIEAHKSDTKALAVTQGGC-LISGGRDETVKFWAKKGKQYTKTHAFEQPKGITVNSIAYAEDGWRLFVGRRDGTIAVFGPSQAEPYAIFNEHKQNVCCLHINEKATHMLSGSWDSNVIIWPITESFTTIVCPGHTLSVWALASFPDLNTYLSASADKTIRMWFGDTTLSVFKGHTDVVRALVVLSSSH-FLSAGNDGHIIHWDVASASIL-RKFATQAHE----FIYSMTLSDSHILTTGEDGTLEFWAIDGGKSEAVIQLPTTNTWDAKVLLNSD--IAVAGSDGRIYIMTTDKNRKADDDILDAFDAEVVAKLTAKTER 349
54 -58.400[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  13  1...............................................................................................................................................................................................................................................MGDQQQLILATGGYDHTIKVWQAHTGIKTMRFVETSQVNALDRTPDKTRLAACGYQ-CIRLYDLESNCT-APVINFDGVQKNVTRLGFQEDGNWMFTAGEDHHVRIWDMIAAPHCSRIFDCEAPVNAACLHPNQVEIAMGSQNGSVFLWDVKSERHERIVPEVDASIQDVAISPDGRYLAAANNKGNCYIWSLTSQDRKIPAHSRYILRCKFSPDSRLLLTTSGDGTVCIWKTDDFSKW-RELCIENYW---VWDAAFSADSKWLFTASSDGIARLWKLQTKSSIRDYTGHTKAITALSFKDEIP-VKSTNISDVQSSAKPPTQ--------RDNPPGTNNLAFFETVGR 347
55 -58.000[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  12  62.......PPAALPVAKKNSESKPKEPVFSAEEGYVKLFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKL--DCRNNLYLLPTGETVYFIASVNVEEQLQRHYAGH--DRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIATNLCAVDDSNDHVLSVWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGEITSLLLDTRRKLPLIRSKTRKAKVVLCVTFSENGD-TITGDSSGNILVWGKGTISYAVQGAHEGGISPLCMLRDGTLVSGGGKDRKLISWSGNYQKSGDFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWD-KIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRV............................ 716
56 -57.400[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  17  1..................................................................................................................................................................................................................................MSLCGHTSPVDSVAFNSEEVLVLAGASSGVIKLWDLESKMVRAFTGHRSNCSAVEFHPFGEFLASGSSDTNLRVWDTRKK---GCIQTYKGHTRGISTIEFSPDGRWVVSGGLDNVVKVWDLTAGKLLHEFKCHEGPIRSLDFHPLEFLLATGSADRTVKFWDLETFELIGTTRPEATGVRAIAFHPDGQTLFCGLDDG-LKVYSWEPVIDGVDMGWSTL-GDFCINEGKFIGCSYYRNSVGIWVSDISELEPYGAVSEDKNECMVKRFSVLNDQSERMGSGPRGSV------------SPDYETREIKNIYVDSTGG-NLNVAQNPGSLKATLPLESGKVATM----VSEKQNAAYFGPAGD 344
57 -57.300[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  13  35.......................................................................................................................................................................................EEPTHVPQSVSVSSKSESGVSSSAVSDD---EDDFMPDLPPGFQMQQSEAGPSSSRAEGPEDSDDSDFDETEAISIIKLPAACEAKISHGTQAISALRVEPPGVRFASGGLDYYVKLFDFQKMDMSYDKELLPAESHVINSLAFSPNGETLVVASGEAIIRLLDRAGKQWLNITKGHTATVNCVEFNPLNKEFISCSDDGSLRLWNLDDHKVIKGANGKRVSPQVCTFSPDGKWIAAGCDDGSVQAWKYGSQYLVRKAHNGSITSIAFSPDSKRLLSRGFDDTLKMWSLDNPKEPLLVKTG-LENAFKSTDCGFSPRAEVVFTGTTPGTLQFFDPMTFDLVYKIDYPGISCHRIQWHPRLNQ-IIAGLSDGTIHVYYDQTMSQRGVMS--CVTKPLKRNRASEVVR 473
58 -56.900[S] KOG0281 Beta-TrCP (transducin repeats containing)/Slimb proteins  ali follow..  16  53...............................................................DQVEFVEHLISRMCHYQHGHINSYLKP----MLQRDFITALPEQGLD----------------------------IAENILSYLDARSLCAAELVCKE-----------------------QRVISEGMLWKKLIERMVRTDPLWKGLSESRGW-------DQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVCLQYDDEKIISGLRDNSIKIWDKTSL---ECLKVLTGHTGSVLCLQY--DERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGL--MVTCSKDRSIAVWDMASATLRRVLVGHRAAVNVVDF--DDKYIVSASGDRTIKVWSTSTCERTLNGHKRGIACLQY--RDRLVVSGSSDNTIRLWDIECGACL-RVLEGHEELVRCIRF-----DNKRIVSGAYDGKIKVWDLQSTLCLRTLVEHSGRVFRLQFDE---FQIISSSHDDTILIWDFLNVPPSAQ--NETRSPSRTYTYIS.... 507
59 -56.100[R] KOG2444 WD40 repeat protein  ali follow..  10  1............................................................................................................................................................................................................................................................................MLVEFDNPPLCMKSNKDGSRLVVGFVDGSIRFYDTQQHEEEFQEIWKFQTKSSIRGVDLDEHKKRVYAVTKNRSLCVFDIDTGKRVRCIKCHRSVPTAICTLPKSQQLATADESGEVKTWNLDPNANIRKWQEQDEDINDLKVDVKSNLLATSS-DGTLGAYDLRKAKLKMRSELMHSELYSVCGTNRSVYVGGEDGYVEVFNLNEGNLLERVESGFEMG---VNGIVELRSGLLGLTSQGSNRMRLLNVQPSKRLGYAGYHDDGIDAITISTDKSTVFTMISMSCTIKKWDMGPII---DEIPILRAQDAKSKKMRKTEG 331
60 -56.100[R] KOG1188 WD40 repeat protein  ali follow..  12  27................................................................................................................................................................................................................................................................................LGIDTSKTVQAGKENLVAVLCSNGSIRIYDKERL---NVLREFSGYPGLLNGVRFANSCDSVYSACTDGTVKCWDARVAKPVQLFKGYPSNFISFDINCNDHIICAGTEDALLVFWDARKDSLGAYSETHSDDVTQVRFHPSNNMVVSGSSDGLVNVFDINIDNETTCNSISSVSCIGWSGKGKQIYCMTHDEGFYWWDLNHLDTDEPVTRLNIQDVREVVNMK-KTDTLHVIGGTNKGRIHLMNCSMSGVTSLQGGHAATVRSFCWNVQDD-SLLTGGEDAQLLLWKPGAIEKTFTK--KESMKIASSVHQRVRVH 376
61 -56.000[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  15  78...................................................................................................................................................................................................................................ILAFRNKPKSLLSTNHSDSPHQNPKPVKPRRYIPQNSERVAPGLRDDFSLNLLDWGSANVLAIAL--GDTVYLWDASSGSTSELV-TIDEDKGPVTSINWTQDGLDLAVGLDNSEVQLWDCVSNRQVRTLRGGH-ESRVGSLAWDNHILTTGGMDGKIVNNDVRIRSIVETYLGHTEEVCGLKWSESGNKQASGGNDNVVHIWDRSLASHRFEEHTAAVRALAWCPFQASLLAGVGDGKIKFWNTHTGACL-NSVETGSQ----VCSLLWSQSERELLSGFTQNQLTLWKYPSMSKMAELNGHTSRVLFMAQSPNGC-TVASAAGDENLRLWNVFGEPPK---TTKKAASKKYPELFSHVNS 442
62 -55.900[R] KOG2394 WD40 protein DMR-N9  ali follow..  10  126................................................................................................................................................................................................................................GSFAASNSNTSMTNTNFDGKGTYLVFNVSDAIF-LNSQEKDPVKSIHFSNSNPMCHAFAKDGHDLLIGLNSGDVYTVSLRQQLHYNKDGSVNNRQDRCTSISWVPSTFPAIRDPTQFSVDKAKYSKSNPVARWHICQGSINSIAFSNDGAHLATVGRDGYLRIFDFLTQKLVCGGKSYYGALLCCSWSMDGKYILTGGEDDLVQVWSMEDRKAWGEGHNSWVSGVAFDSNWSRFGSVGQDTQLLLWDLEMDE-IVVPLRRAPGGSPTYSTGSSAHWDNVIPMGTLQPAPCKRDVPKLSPIIAHRVHTEPLSGLMFTQES---VVTACREGHIKIWTRPSESETQTNSEANPTTALLSTSFTKDNK 541
63 -55.900[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  15  4......................................................................................................................................................................................................................................................................NQQPPSNLQTYGVPIYAVDWILEEAVRSKITKDQDDDDDDGSSSSSYIVLGRRVIGTDLPYRMAIHPRQGGLICALPENIIEDDNEEESEKVVKELKDVGQQLSLSFNQDGTVLATGAEDGTLRVFEWPSMKTLLNESKTHASVKSLTFSESGKFLVSLG-APLCRVWDVNASAAIASEKDEMFASCRFSVDNSVAANTQRGGSIITWDTTSWRRRSSKLIKRNNS---ISAFNVSADGKLLAVGTLEGDVLIIDSTKMQTNQIVKAHLGLVTALTFSPDSR-CLVSVSFDSRARLTVIKQKGEKRRV-YLWVAALLFVLVYVVLYY 374
64 -55.600[R] KOG2055 WD40 repeat protein  ali follow..  12  1..............................................................MEKDTEELELENAV--FG-NNFSSFLDKENETFDVMMNEAPELSEDNDAQEDELEKLEDAELFMFDTGSADGA----DSVPLDIIAGDNTVKEDEEASNEIPSIWEDSDDERLMISLQDHSRLRKLRQYEDEDMVNGLQARRLRTQFERVYPVPEWAKKQDVTEEEDSLKSLFKSSVSYINQSSKLLAPGTINIKRLKDA-----NFQAPSHSGIRCMSIHPYFPLLLTCGFDRTLRIYQLDGKVN-PLVTSLHLRSSALQTALFHPDGKRVIAAGRRKYMYIWDLESAQVQKVQENFQPSMERFHVDPTGKYIALEGRSGHINLLHALTGQFATSFK-IEGVLSDVLFTSDGSEMLVLSYGAEVWHFNVEQRSVVRRQDGVSTTHFCLDPSNKYLAIGSKSGIVNIYDLQTSNADAKPVTTLDNITFSINSMSFSQDSQVLAIASKKDTLRLVHVPSFSVFRNWATPLGRVTCLAFGKGGE--LCVGNEAGRVGLWKLAHYDLKFVPD----KIINWEIRLGKFGY 539
65 -55.400[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  13  1....................................................................................................................................................................................MNGGMMRGNQMPNVTLTIQPSTSSMQNSQPRVMPDVMGDGPGRRLRKLWQYGKQRILQQPDILYQQYAVPADSTPDVPVDCITKFIRTAMNKVKCPVYSVCWSPEGKRLITGCQTGEFTLWNGTAF---NFETILQAHDSAIRALKWASNEQWLLSADQGGYVKYWQPNMNNAHMFSAHKDEAIRGLAFAPTDVKFATASDDGTARVWDFARYTEERVLRGHGAEVRCIDWHPTKGLIATGSRDTPVKIWDPKSGSATLQEHKSSVMAVEFNKNGNWLLTGGRDHLVKMYDIRMMKEM-RTYRAHKKE---VISLAWHPIHELFVSGGGDGSIVYWMVDGEKEIGLLHAHDQAIWSMKWHPLG-HILATGSNDNNTKFWARNRPG-LSNTNMIGHLDKEREPRMAPPKP 453
66 -54.800[R] KOG1539 WD repeat protein  ali follow..  12  98...............................................................................KHVAKVDLLLVFGEHVLSLDVEGNMF-------WAGIEEHLAPIGNLQLTGKFTPTSIVHPDTYLNKVLVGSQEGPLQLWNINTKKM----------------LYQFKGWGSSVTSCVSSPALDVVAIGCADGKIHVHNIKLDEEIVTFEHASRGAVTALSFSTDGRPLASGGSFGVISIWNLNKKRLVIRDAHDSSIISLNFLANEPVLMSASADNSLKMWIFDTNDGDRLLRFRSGHSAPPLCIRFYSNGRHILSAGQDRAFRLFSVIQEQQSRELSQRHISRRAKKLRLKEEELKLKPVVSFDCAEIRERDGVFVSRNHLLLAILACAISACGNFAVVGTAGGWIERFNLQSGIKRRYAHDGEVIGVACDSTNTLMISAGYHGDLKVWDFKKRELKSQW-----DVGCSLVKIVYHRVNGLLATVADDFVIRLYDVVTLKMVREFRGHTDRITDLCFSEDGK-WVISSSMDGSLRIWDVILAKQIDGV---HVDVPITALSLSPNMD 632
67 -53.500[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  14  107.......................................................................................................................................................................................EMERDKVALLEEFERKKRARQINVSTDDYFGEGPAERRRRLKELL--AGLGENAINKRQYEDEERKQQQREQDQATWYHEGRLWLADYSLPRAKDRLVRAREALEVPSAARAGRMVEM-QKKLQSLAPLCSQVGDTRPVSSAAFSEDSSLLLTSSWSGLCKLWSVPDCELKQTLRGHASYVGGVALRPGVKAMASGGHDGAVKLWGFNNEESIADITGHPHRVSKVAFHPSGRFLATACYDSSWRLWDLEQKTEHQEGHAKPVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGRCI-MFLEGHLGA---VFGVDFSPNGFHIATGSQDNTCKIWDLRRRQPVYTIPAHTNLISDVKYQQECGSFLVTCSYDSTTKIWSNKTWQPLKTL--QGHDNKVISVDIAPNSQ 535
68 -53.300[R] KOG1273 WD40 repeat protein  ali follow..  15  18............................................................................................................................................................................................................................................................................EEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDFETRGIAKEIR--NDCSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTIPLSSAPMIVDFDIDCTTLLPVSVPEMPDVLAPPQRSKCP-ESNPPFSPAAACFNKCGDLVYIGNSKGEILIVDYKSVRLVSASGAAPVKNIVFSRNGQYLLTNSHDRTIRIYENLLPATLFREFQDSVTKM-HWKAPCFSGDGEWVVGGSGEHKIYIWDR-AGHLVKILEGPKEALIDLAWHPVHP-IIVSVSLAGLVYIWAKDYTENWSAFA-PDFKELEENEEYVERED 373
69 -53.300[S] KOG3914 WD repeat protein WDR4  ali follow..  10  1..........................................................................................................................................................................................................................................................................MSEQRVFKHPCQFLTWNSKHNYIVCCS-GPYLLGFSCSTGEKIEKHREAAAYGEAIRQVAFSKDYSRMATVSEDKCLRLWDSTQPDKIELLYQKNKRCADLCFAGSNE-IVFGDKFGDVYCVDE-----------NWFTTSEVTEEKKSNVVEGKQEPVNNDTLKDSKLQEPIMGHVSILTQLIVAQNPEIIITSDKDEHIRISRFPNAFVIEGFCLGHEDFVSRMS-----YDNRTLISGGGDNHVFVWDLENFKCLDAFDNQPMVVSVILPIFKRQLVAFACEGMAGLIFAKVTPEKRLLFHSALKLSGPVLDAVLLDTDT 336
70 -53.100[B] KOG0264 Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1  ali follow..  12  34..................................................................................................................................................................................................................................VMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHT------SDEQNHLVVARVHDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPIIATKTPSSDVLVFDYTECNPDLRLRGHQKEGYGLSWNSNLSHLLSASDDHTVCLWDINAGDAKAIFTGHSAVVEDVAWHLHESLFGSVADDQKLMIWDTRSNTTLVDAHTAEVNCLSFNPYSEILATGSADKTVALWDLRNLKLKLHTFESHKDE---IFQVHWSPNETILASSGTDRRLNVWDLSKIELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAEN------IYNDEESDVTTSELEGQGS 425
71 -52.300[R] KOG2321 WD40 repeat protein  ali follow..  1....................................................................................................................................................................................MSLKVQNPNNVRVYTVSGEGVTQRLPNWISKRKLKKDYALSHRIELLQDFEYPEASNRIKCTRDGKYAMATGVKPHIKVFDFAESLKFERHTDAENVQFEILSDDWTKSVHLQTDRTVDFHSQGGI------HYSTRIPKYGRDLKYHYPNCDLYLAAAGDEVYRLNLEQGRFLNPLKSPTGGVNVIDINPMHQLLAFGTDAGSVEFWDPRDRSRVGILEDNSRSVTALKYRNDGLNVAIGLSDGATLLYDLRSSSPYMSGYSMPIKSLHWMDDGTARVLSADSKIIKIWEKDTGKPFSSI-----EPTVELNDVCPIEGTGLILTANEGSPMHAFYIPSLNPAPRWCSFDNITEEMEENPADDYKFVTKKELLNLGLDHLVGTGVIRAYM---HGFFIDNNLYEKARL 426
72 -52.100[T] COG5170 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  15  2.......................................................................................................................................................................................................................................................DDIEDSLDQWKFAQCFGDKGDV-ITEADIISAVEFDHTGDYLATGDKGGRVVLFERNHSKKGCEYKKSLEIEEKINKIRWCKRTNHFLLSTNDKTIKLWKLYEKNLKVVANAHAYHINSISVNSDAETYISAD-DLRINLWNLSISDHSENMEELTEVITSAEFHPNCNHLMYSSSKGNIKLLDLRQSASFFSEIISSISDVKFSQNGRYILSRD-YLTLKIWDVNMEKAPVKTIPLHNDCIFDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLPGDRNLDYNKKILHASWHPFED-SVAIAATNN-LFVFS............................. 461
73 -51.800[S] KOG0283 WD40 repeat-containing protein  ali follow..  12  20LGDFEDEDDDRTHDRLSSALTFDMANASSSDEDEDFDDCRLSFSSAVSSLTTASRKFRTPAMSPDYDI-----RLLHGMGLASNKDMVSAVSIRRVVSNAPVVSNGEEKKMKKKMNHEVDEQDHDHVPVMLARSR--IERFLIEKRRKEEILGKISKQRLTRTYSTICPTRTRICQYQTPIRQTPAVCGNGKALRGGGEALTSVMSNARVGAFFLIKNLDTGKEFIVNEYDEEEFEKCVGYSPVVKELMRRENVNRINYEPVAHSMSLRVADKDVSDGSTDSPKKGKDHKHGKANEWVKVRPTGKSSALHMCQEIQAHEGAVWTIKFSQDAHYLASGGADRVIHVWEVQECELMSMNEGSLTPIHPSLCDSSGNEITVVEKKKKGKGSSGRSDKPVCSLKGHLDAILDLSWSKSQL-LLSSSMDKTVRLWDIETKTLKLFAHNDYVTCIQFSPDENYFLSGSLDAKIRIWSIQDRH--VVEWSDLHE---MVTAACYTPDGQGALIGSHKGICRAYDTEDCKLSNKKSQAKRKITSFQFSPVNPSEVLVTSADSRIRILDGSEVIHK--FKGFRNTCSQLSASYSQDGK 695
74 -51.600[E] KOG0280 Uncharacterized conserved protein  ali follow..  13...............................................................................................................................................................................................................................................................................YTDWPADVCKYSQVFEDVLVVG---TYMLDESTKLRHGKLV-----LYDTKEDVLSPHDASVLAVAHSTGHVSFYRHQFRAELMFLRDSSVLMLSLDFSDSGKELAVSMSNGSVLIIDIDSGVIKNKWKEHDYEAWTCHYSRDNNLLYSGGDDAALVCYDQRIPNSIQVHHSGVVSILSRAPFGPYIATGEYGDFMHTLDTRNIGKPLFSA-NLGGGVWRLEHMETTENYHKVLGILMHRGAQVLRISNDASKRIFKEHESMCYGGDWRHTDGLLATCSFYDKRVCLWED............................ 309
75 -51.400[S] KOG0294 WD40 repeat-containing protein  ali follow..  11  2...........................................................................................................................................................................................................................................................................................PPEMEIIEATNEELLLGFKLIKSPKFELKQTFADSSYARSITSLAVQWPWVASGGTDGRIFVYDMRTRKQSQIILSHAGRVNTLKFTPDLSLLLSGSDDGHMIATRVGSWTKEYDWAHAGQAVTHVSCHPSSKLALSLGGDQVLNTWNLVNGCVAHKTLDFQTGCLSWSKQGDHFTLSG-PLVLEIWGIENAHVMRRI-----EMPSKPICITWL-DGNECLTGLDNGNIAWISLKDEDPPTFILAHEVRVKAIAYLNE---FLATVSIAGQIKVWKIDMETRKLEEIARSFMDRPTDLGLLDLRQ 317

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhao Y, Hong DH, Pawlyk B, Yue G, Adamian M, Grynberg M, Godzik A., Li T. The retinitis pigmentosa GTPase regulator (RPGR)- interacting protein: subserving RPGR function and participating in disk morphogenesis. Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3965-70. Epub 2003 Mar 21.