current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [S] KOG0294 WD40 repeat-containing protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst MPPEMEIIEATNEELLLGFKLIKSPTDGFTDSVKFELKQTFADSSYARSITSLAVQWPWVASGGTDGRIFVYDMRTRKQSQIILSHAGRVNTLKFTPDLSLLLSGSDDGHMIATRVGSWTKEYDWQKAHAGQAVTHVSCHPSSKLALSLGGDQVLNTWNLVNGCVAHKTNLKNKATLDFQTGCLSWSKQGDHFTLSGPLVLEIWGIENAHVMRRIEMPSKPICITWLDGNECLTGLDNGNIAWISLKDEDDTPPTFILAHEVRVKAIAYLNEFLATVSIAGQIKVWKIDMETRKLEEIARSFMDCRPTDLGLLDLRQFGNVRPVEQRTKVEEKPKAKVESDQSAKPAAPRGFVTIEYEQDKKLDAEKKKEKKKNKKDEESSEESNSSEDKENDDFSDSDSDVSSDHGHRKRKPMKREQQPTPASKGKAKQQKKKLast
1 -102.000[S] KOG0294 WD40 repeat-containing protein  ali  100  1MPPEMEIIEATNEELLLGFKLIKSPTDGFTDSVKFELKQTFADSSYARSITSLAVQWPWVASGGTDGRIFVYDMRTRKQSQIILSHAGRVNTLKFTPDLSLLLSGSDDGHMIATRVGSWTKEYDWQKAHAGQAVTHVSCHPSSKLALSLGGDQVLNTWNLVNGCVAHKTNLKNKATLDFQTGCLSWSKQGDHFTLSGPLVLEIWGIENAHVMRRIEMPSKPICITWLDGNECLTGLDNGNIAWISLKDEDDTPPTFILAHEVRVKAIAYLNEFLATVSIAGQIKVWKIDMETRKLEEIARSFMDCRPTDLGLLDLRQFGNVRPVEQRTKVEEKPKAKVESDQSAKPAAPRGFVTIEYEQDKKLDAEKKKEKKKNKKDEESSEESNSSEDKENDDFSDSDSDVSSDHGHRKRKPMKREQQPTPASKGKAKQQKKK 434
2 -58.600[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  14  403.PSSGKSFIMGADEALESELGPGEANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNILRGPLLGHTD-AVWGLAYSAAHQRLLSCSADGTLRLWNTTEVAPALSV-FNDIKELGIPASVDLVSSDPSHMVASFKGYTSIFNMETQQRILTLESSCQINRVISHPTLISITAHEDRHIKFYDNNTGK--LIHSMVAHLEAVTSLAVDGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKEESIHDVAFHPSKCYIASAGADALAKVF....................................................................................................... 779
3 -55.200[T] KOG4378 Nuclear protein COP1  ali follow..  10  8.PSWRLLAASG-GDTVKLFDVSADSGDP-------CVLSYTPSPGCAVNSVKWNHTNLVVASTGEDKKISLWRKNGQSLGTGGDSAEECLSAISFSKKGSYICSGGTGQIVKIWDLQRKLCIKKL-KGHTS-TITGVMYNCKDEHLASVSVGGDLIVHNLASGARATELK-GQVVQFVHVLRLLDYSRSSRHLLVTADGTVHLWDTTGRSPKMSWQHSAPTAGVCFSPSNIIASVGMDKKLYTYDSGSRR---SSSCIAYEAPFSSLAFNGYILVAGTSNGRVVFYDIRGKPQPVTVLHAFSNSEDVTSLSWQTSKPVIVNEKNYTSEMALLGSTVEDSVIPDPLPSTTPSASQSAMAPGSRGVSASTVNASSVEQTPNRNH.................................................... 394
4 -54.700[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  11  4..............................KRPNNSVILAQEAKRSKNDLMAYTNRDKALLESGVRRTSNLQ-----APIMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSG-AVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFK-----GHGNFVNSVQGSRRGQQLLCSGDRTIKIWDARKKHAAHTLESPFQVTAVCFGTGEQVISGGIDNEVKIWDIRKQA--VLHHLRGHSDTITGMSLSGDFILTNAMDNTLRVWDVRPYAPGERCVKQHNFEKNLLRCAWSPGSDKITSGSADRHVYIWDVNTRRI----YKLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGEID....................................................... 346
5 -53.600[R] KOG0286 G-protein beta subunit  ali follow..  13  2...............................GEMEQLRQEAEQLKKQIADARKACADVTLAEL--VSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLR--SSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKV-SRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVHTGDCMSLAVSDFNLFISGACDASAKLWDVREGT--CRQTFTGHESDINAICFNGEAICTGSDDASCRLFDLRADQELICFSHESIICG-ITSVAFSLSGRLLFAGYDDFNCNVWDSMKSER---VGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN......................................................... 340
6 -53.500[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  14  57.TEGAEIVDSIRKSLEEI-KLVYQPQAVFRVRPVTRCSASIPGHGEPVISAQFSPDGRGLASGSGDQTMRIWDIELELPLHTCKSHKSWVLCIAWSPDATKIASACKNGEICIWNAKTGEQIGKTLKRHKQ-WITSLAWQPTCRLLASCGKDGNIFIWDTVQGTVVRCLS-----GHTASVTCLRWGGEGLIYSGSQDRTVKMWRADDGVMCRNMTHAHWINTLALNGGERLVSGSDDFTLFMWNPKETK-QSINRMTGHMQLVNQVVFSTRYIASASFDKSVKLWCGRTGKYLASLRGHVG---PVYQVAWSADSRLLVSGSADSTLKVFELKTKSL---YYDLPGHGDEVFTVDWSPEGTKVVSGGKDKVLKLWR......................................................... 472
7 -53.200[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  13  29.DQGVTEDEAEQEQNDTMNNMVMDMS-----------VQGFFEHKDSVFSVSINPVHNLCASGGGDDLGYIWDITTGEQICQLTGHKDSIVAIDWSFDGTYIATGGMDSQVRLWKSSTGFEFITAFET--VDEIVWLSWHPKGLFLAAGCNDGSIWMWSLPSGKVVQVMY-----GHTAPVNAGKFIPPGVLATVDDSGTLIVWNPATGAPECRMSTAAGWTSFDCNEGNVLFLGGSSGKVKVVNINSSH--ILASLEAQTESVEAIALCLPICACASVDGTVALYDSASL----KFRKSLPHEQAVIDCKFLPNTPYLLTACADCVIRKWDVRSGQL---LGEYTGHQEPILCMAITPDGKRVVTGSDDTELLVFDCEH...................................................... 399
8 -53.000[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  10  39.AQNGRLFTGGSDTIIRTWSVPHHKDASPGKNSPVQYQGSLEQHTDWVNDMILCGHGKILISASNDTTVKVWNIERDNKIDCIRTHKDYVSCLAYAPIVEKAVSASFDHNIFVYDINANFKTVNNLIGCKDS-IYSLATTPNLSLVLGAGTEKCIRLFDPRTNEKIMKLR-----GHTDNVRALVVNDDGTRALSAGDATIRLWDIGQQRCIATCIHEEGVWTLQVDSSTTVYSAGKDKMVVKTPLYDFTKSQL--LFKEEAPVKKLLLSEKSLWVGTWKSDIKRWSIRPSAQLSIGGDE---DGPSTSNANHSVSASSSPPVTFKYIRVKDQKGQQ--STPELVIPGAPAIKKHAMLSDKRHVLTRDSDGNVALYDVLAARKIKRIFEEVVDENSRQVYIPSWFVVDSKSGMLQITLDELDALSSWLSSKDAG 480
9 -52.600[T] KOG0279 G protein beta subunit-like protein  ali follow..  15  25.VDNSDIVTSSRDKSIILWKLTKE------DKSYGVAQRRMTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVIVSASWDKTVKVWNLQNCKLRNTLA-----GHSGYLNTVAVSPDGSLCASGGDGVILLWDLAEGKKLYSLEAGSIIHSLCFSPNRYWLCAATENSIRIWDLESKSVVEGIGNKTKVIYCTSLNWSGNTLFSGYTDGVIRVWGIGR................................................................................................................................................ 325
10 -52.600[R] KOG0645 WD40 repeat protein  ali follow..  13  14.PMLPLFATSSQDKSVRIYNSNTYNLVHVIDG------------FHTRSIRRVA-ERPVLAVASFDSVVSINEKDDWECTAALEGHENEVKCIAWSCNGNYLATCSRDKSVWIWEATEDDDCLAVLQEHTQD-VKVVTWHPTEDLLVSGSYDNSICFWRDDGDDWALTCQLQ---GHTNTVWALAFSPNGNTLASADDGNVFLWIKISSNEDVATIHKGAVYTISWMNDATLCSAGGDGKIVVYQREKHDEALEQDHAHGVYEINSLEYLRDRLLSGGDDGECRVWSFK................................................................................................................................................. 322
11 -52.100[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  12  17.SEEVLVLAGASSGVIKLWDLEES-----------KMVRAFTGHRSNCSAVEFHPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHTRGISTIEFSPDGRWVVSGGLDNVVKVWDLTAGKLLHEF-KCHEG-PIRSLDFHPLEFLLATGSADRTVKFWDLETFELIGTTR-----PEATGVRAIAFHPDGQTLFCGLDDGLKVYSWEPVICRDGVDGWSTLGDFCINEGKFIGCSYYRNSVGIWVSDISELEPYGSEDKNECMVKRFSVLGGNLNVAQNPGSLKATLPLESGKVATMAYFGPAGDKYSSTSRDSDSGEESSYSERESIPFSRTKSGML------LRPAHVRKTLAKFEESKQSAVVQSATRKKSGLAVESEQNASKPFDAEDSIIKGITNKFEKALSSEPPTDEANRMFLKPPRIHRSSNSKYN 477
12 -51.900[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  318.TRTKVLVVAFSSGAFYLYELP-----------DVNMIHSLSISDYPISAALFNCTGDWVALASREGQLLVWEWQSEQYIMKQQGHSSEMTCIAYSSDGQFIATGGEDSKVKLWNTQSSFCFVTFSEH--TSGVTGIQFSRNKKFLVSSSLDGTVRAFDVNRYRNFRTF----TSPNPAQFSCVAVDYSGELVVAGGQDDIFLWSVKTGKLLEIISHEGPVVSIAFSTSSTLVSGSWDKTVKIWNCLESN--SEHETIDAVSDVTNVTFSGEEIAVATLSGNITIFDIKSAGQVTTIEGRNDLANYFSTIEYSADGECILAAGKSANICIYHVREAIEITQNHSLDGLNDFISRKHLSEFGNMALVEEREEAIRLPGVQRG-DMSSRRFQQEVRVFSVKFSPTGQ............................. 738
13 -51.900[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  13  25.PTEPWILASLYSGTLCIWNYQTQ-----------VMAKSFEVTELPVRSAKFVARKQWVVAGADDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWACTQIFEGHSHY-VMQVTFNPKDNTFASASLDRTIKIWNLGSPDPNFTLD-----AHQKGVNCVDYFTGGDLITGSDDHTAKVWDYQTKSCVQTLEHTHNVSAVCFHPEPIIITGSEDGTVRIWHATTYR--LENTLNYGLERVWAIGYSSRRVVIGYDEGTIMVKLGREI----PVASMDNTGKIIWAKHNEIQTANIKSIGADYEVTDGERLPLSV----KELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNR................................................... 387
14 -51.800[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  12  33.PNGEHLISCSEDDQIVIYDCEKG-----------TQSRTVNSKKYGVDLIHFTHANNTASSTKVDDTIRYLSLHDNKYLRYFPGHTKKVISLCISPVEDTFLSGSLDKTLRLWDLRSPNCQGLM----HLSGRPIAAYDPEGLIFAAGVNSESIKLYDLRSFDKGPFVTFKLNQEKECDWTGLKFSRDGKTILISTGSVIRLVDAFHGTPLQTFNNKGIPIEASFSDSQFIFSGSTDGRVHIWNADTGNKVSVLN-GDHPGPVQCVQFNPKMLASACTNMAFWLPTSEEG............................................................................................................................................... 316
15 -51.600[S] KOG0295 WD40 repeat-containing protein  ali follow..  16  74.QREINHGAPTRDKRQAADWIPRP-----------PETQKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYETGQLERTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLWDFGQTYDCLKSLKGHEH-TVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTFR-----GHNDWVRMIRISNDGTLFASASDQTVTVWSFATKSAKLVLRHEHAVECVEWAPDTILFSGSRDRSIKAWNINTGD--VLFTLLAHENWVRGLAFKGKYLISVADDKTLRVWELSAQRCMKAIEAHEHF---VSTVAFHQTSPFVITGSVDMSCKVWECR.................................................................................................... 404
16 -51.600[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  13  292.SEVEAVKDWSKRLHLGPRASLPS-----------VCMYTFHHTNNNMNCAEFSPDSTMIACGFQESYIRLWSIKADKKSVRLLSHSGPVYGTTFSPDNKYLLSCSEDASARLWSVDTKTALVAY-KGHTG-PVWDVAFGPFGHYFATASHDQTAQLWSCDHIYPLRVFA-----GHLSDVDCVTFHPNSAYVLTGSDKTCRLWDVHRGHSVRVFGHTQPVTAVAIADGHTMASADSEGLIHLWDIGTGR--RIKTMRGHRGNIYSLSFSSTVLVSGGSDCTVRAWDVFKTNYNNPVSSSLTG---SVVTPFSAKTSTFNEVNWSTS-----------PDQMVALYTKQTPIFNVSFTRRNLCLAISVS................................................................. 643
17 -51.500[R] KOG0646 WD40 repeat protein  ali follow..  11  2..EITVIASSSIDEGIGSWDLKTG-----------TEQLQFKPCASPAHGLTAVGESSQLSARNTSGSIFYWSWTKPQ-AEVKSYPVEPIKALAANNEGTYLVGGGISGDIYLWEVATGKLLKKWHGHYR--SVTCLVFSGDDSLLVSGSQDGSIRVWSLIRLFDDFQRQEHNFNEHTMSVTDIVIDYGGCIISSSEDRTCKVWSLSRGKLLKNIIFPSVINALALDPGGVFYAGARDSKIYIGAINATSEQVLGSVSEKGKAITCLAYCGNLLISGSEDGVVCVWDPKSLRHVRTLIHAKGSRKGP--VNNIQIVRKTIVANSNKTQVSWKSRGALIPPP-------EKYERPVEDTMDGIVTVDPPPFSDVPVYSSFLSADLIDEQVKELQQQGSAATEMEMERLKLEYKRSLQMNEQ.............. 416
18 -51.500[A] KOG0285 Pleiotropic regulator 1  ali follow..  11  87.KGSKELRKSATEKALVVGPTLPPRDLNNTGHAPWKNYRVLQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATGVLKLTLTGHIGQVRGLAVSNRHTYMFSAGDDKQVKCWDLEQNKVIRSY-HGHLH-GVYCLALHPTLDVVLTGGRDSVCRVWDIRTKMQIFVL------PHDSDVFSVLARPTDPQVITGSDSTIKFWDLRYGKSMATITHKKTVRAMALHKENDFVSASADNIKKFSLPKGE--FCHNMLSLQRDIINAVAVNEDVMVTGGDKGGLWFWDWKSGHNFQRAETILESEAGIYAACYDQTGSRLVTCEGDKTIKMWKEDED-----------ATPETHPLNFKPPKEIRR..................................................................... 476
19 -51.400[S] KOG0293 WD40 repeat-containing protein  ali follow..  11  284.HNGKYLASSSKDQTAIIWEISADG--------HISLKHTLVGHHKPVIAILWSPDDRQVLTCGAEEVIRRWDVDSGDCVHMYEKGGISPISCGWYPDGQGIIAGMTDRSICMWDLDGREKECWK--GQRTQKVSDIAMTDDGKWLVSVCKDSVISLFDREATVERLI-------EEEDMITSFSLSNDNKYILVNLNQEIRLWNIEGDPKIVSRRSRFIIRSCFGGKQAFIASGSEDSQVYIWHRSTGK--LIVELPGHAGAVNCVSWSPTMLASASDDGTIRIWGLDRINQQNQKKKLVQGS-SSNGVIHRCNGN..................................................................................................................... 589
20 -51.200[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  13  452.ADGQMQPVPFPPDALIGPGIPRHAR-----------QINTLNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQ-----GHTDGASCIDISNDGTKLWTGGDNTVRSWDLREGRQLQQHDFTSQIFSLGYCTGEWLAVGMESSNVEVLHVNKPD---KYQLHLHESCVLSLKFAGKWFVSTGKDNLLNAWRTPYG----ASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYE...................................................................................................... 767
21 -51.200[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  12  28.GDGNYALTCGKDRTIRLWNPHRG-----------ILIKTYKSHGREVRDVHVTSDNAKFCSCGGDRQVYYWDVSTGRVIRKFRGHDGEVNAVKFNDSSSVVVSAGFDRSLRVWDCRSHSVEPVQII--DTFLDTVMSVVLTKTEIIGGSVDGTVRTFDMRIGREMSDN-------LGQPVNCISISNDGNCVLAGCDSTLRLLDRTTGELLQVYKSKSFKTDCCLTSDAHVIGGSEDGLVFFWDLVDAK--VLSKFRAHDL-VNSIDVDFYKFFVAGDKRELPPEGRLYVDFFGRWYNSCLEK--MKKQQILTSIDFVIYVSNSPFFFYYR...................................................................................................... 342
22 -51.100[S] KOG1407 WD40 repeat protein  ali follow..  12  13.....................................SREYQGHKKKVHSVAWNSNGTKLASGSVDQTARIWNIESKAKDLELKGHTDSVDQLCWDPKHSLVATASGDKSVRLWDARSGKCTQQV---ELSGENINITYKPDGTHVAVGNRDDELTILDVRKFKPLHRRK------FNYEVNEIAWNMPGDFFFLTTLGTVEVLSYPSLKPLDTLTHTAGCYCIAIDKGRYFAVGSADSLVSLWDISDML--CLRTFTKLEWPVRTISFNGEYIASASEDLFIDIANVQTGR----TVHQIPCRAAMNSVEWNPKYNLLAYAGDDKNPKYNTDEGV.................................................................................................. 306
23 -51.100[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  74.PSGFYIASGDASGKIRIWDTVNKEHLHVFMSETGTSVGEISGQSKSINSADFRPARPFIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEFGSPAHKGGVYALAWKPDSTQLLTCSGDKTCRLWTVESRELVSEFVLRVVKGHNKPITVLGLSDDRSTIYTGSDGVVTNWNSGSGTNDRITGTGHGNQINGIAWGDFVYTCGIDDSLRQFSVEGNS--YTDYVVKLNCQPRGLAIDTSDVAVGGDDQKLHIYTLKGGVLEPKVELDHL--GAVTDVSYSPDLKYLVACDAHRKVVLYSVEEYKPAHN-KEWGFHSARVNTVAWSPNSLLVASGSLDTTIIIWSVANPAKHTIIKNAHPQSQITRLVWLDNNTVISTGQDCNTKVWHVEN........... 607
24 -51.000[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  30.PALHPFEVPREY-------VRALNATKLERVFAKPFLASLDGHRDGVNCLAKHPEKATVLSGACDGEVRIWNLTQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTLGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMT-----WGFDSISSVKFNPIETFLLGSCDRNIVLYDMRQATPLKKVILDMRTNTICWNPMEIFTAANEDYNLYTFDMRALD-TPVMVHMDHVSAVLDVDYSGKEFVSASFDKSIRIFPVDKSRSREVYHTKRM--QHVICVKWTSDSKYIMCGSDEMNIRLWKANASETSREKAAKDYNQKLKEKFQHYPHIKRIARHR-HLPKSIYSQIQEQRIM-KEARRRKEVNRIKHSKPGSVPLVSEKKKH................... 439
25 -50.700[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  10  5.......................................LLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVK-----EHSRQINDIQLSRDMTMFVTASDNTAKLFDSTTLEHQKTFRTERPVNSAALSNYDHVVLGGGQEAMDVTTTSTRFEEEFGRVKGHFGPINSVAFHGKSYSSGGEDGYVRIHYFDPQYFEFEFEA....................................................................................................................................... 325
26 -50.600[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali follow..  10  189.PVSDLLASGSGDSTARIWNLNENSNGGSTQRHCIREGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTE-NGNLASTLGQHKGPIFALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQFPFH--SAPALDVDWQNNMT-FASCSTDMCIHVCRLGCDHPVKTFQ-----GHTNEVNAIKWDPSGMLLASCSDMTLKIWSMKQDACVHDLQHSKEIYTIKWSPTGMLASASFDSTVRLWDVEQGV--CTHTLMKHQEPVYSVAFSGKYLASGSFDKYVHIWNTQSG----SLVHSYQGTGGIFEVCWNARGDKVGASASDGSVCVLD...................................................................................................... 521
27 -50.400[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  11  18.RDRTQIALSPNNHEVHIYKKNGS---------QWVKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFEAENVSKHIKKPIRST-VLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKMSEFGGSGTGGWVHGVSFSASGSRLAWVSDSTVSVADASKSVQVSTLKEFLPLLSVSFVSENSVVAAGHDCCPMLFIYDDRGDRNTALETLHQNSITQVSIDCRKFCTTGIDGAMTIWDFKTLESSIQGL........................................................................................................................................ 367
28 -50.300[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  89.AEAGYLETEGLEKTWRVKQ---TDIANEVDILSSRNQYDIVLPDFGPYKLDFTASGRHMLAGGRKGHLALLDMMNMSLIKEILKERGPVARLRFLKNHFLLASVNMSGQLHYQDVTHGGMVASIRTGK--GRTDVMEVNPYNSVVGLGHSGGTVTMWKPTSQAPLVQMQ-----CHPGPVSSVAFHPNGHLMATSGERKIKIWDLRKFEEVQTI-HSFHAKTLSFSQKGLLAAGT-GSFVQILGDSSGGSSHMNHSMVKGYQIEKVMFREDVIGIGHSMGWSSILIPGSGEPNFDSWVANP----FETSKQRREKESLLDKLPPETIMLDPSKIGAMRP---SRRKEKPSRGEIEAEKEVAIEAAKSTELKNKTKGRNKPSKRTKKKKEMVENAKRTFPEQEHNTAIKKRRIVEDAAAELPTSLKRFARKN.. 548
29 -50.200[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  12  75.PDGLHLAVGYEDGSIRIFSLLSG-----------EGNVTFNGHKAAITTLKYDQLGGRLASGSKDTDIIVWDVINESGLYRLKGHKDAITQALFLREKNLLVTSGKDTMVKWWDLDTQHCFKTMVGHRTRDRVVNLAVDKTGRILACHGTDSVLELFCILSKKEIQKKMDKTIGGHRSDVRTLSFSSDNIAVLSAAADSIKIWNRSTLQCIRTMTCEYALCSFFVPGDRQVVIGTKTGKLQLYDLASGN--LLETIDAHDGALWSMSLDQRGFVTGGADKSVKFWDFELVKDENSTQKRLSVDEDVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLKF----LSLYGHKLPVICMDISHDGALIATGSADRNVKIWGLDFG-DCHKSLFAHDDSVMYLQFVPKSHLFFTAGKDHKIKQWDADKFEHIQTLEGHH 675
30 -50.100[S] KOG0281 Beta-TrCP (transducin repeats containing)/Slimb proteins  ali follow..  17  214.YDDEKIISGLRDNSIKIWDKTSLECLK-------------VLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGL--MVTCSKDRSIAVWDMASATTLRRVLVGHRA-AVNVVDF--DDKYIVSASGDRTIKVWSTSTCEFVRTLN-----GHKRGIACLQY--RDRLVVSGSDNTIRLWDIECGACLRVLEHEELVRCIRF-DNKRIVSGAYDGKIKVWDLQAASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSP---SRTYTYIS......................................................................................................................... 507
31 -49.900[R] KOG0289 mRNA splicing factor  ali follow..  13  233..DTNKILTGGADKNVVVFDKSSE-----------QILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFP-----GHSGPITSIAFSENGYYLATAADSSVKLWDLRKLKNFKTLDNNFEVKSLIFDSGTYLALGGTDVQI--YICKQWT--EILHFTEHSGLTTGVAFHAKFIASTGMDRSLKFYSL.................................................................................................................................................. 504
32 -49.800[R] KOG2394 WD40 protein DMR-N9  ali follow..  10  190.KDGHDLLIGLNSGDVYTVSLRQQLQDVSKKVGALHYNKDGSVNNRQDRCTSITESTFPAIRDPTQFSVDKAKYSKSNPVARWHICQGSINSIAFSNDGAHLATVGRDGYLRIFDFLTQKLVCGGKSYY--GALLCCSWSMDGKYILTGGEDDLVQVWSMEDRKVVAWGE-----GHNSWVSGVAFDSNWSSPSVGQDTQLLLWDLEMDEIVVPLRAPGGSPTYSTGSSAHIPMGTLQPAPCKRDVPKLS--PIIAHRVHTEPLSGLMFTQESVVTACREGHIKIWTRPSESETQTNSSEANPTTALLSTSFTKDNKASLSSKIISGSTFKQ...................................................................................................... 556
33 -49.700[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  13  1.......MAQPYLPAEKFLS------------RKQETILLDEDEPAVVSSVRISPKKPYHVATTSSVRLTLYDTVVCEPLNLFSRFKKGVCSIDFRHDGRLLAIGGDEGKVRIFDVEKTTVALRVMQASQS-TVKSVHFSPRGDTVFSMADDGKIKQYRVADTAYGVNAVIIEIQAHEDAIRCGAVSSNDHIVLTGGDHKVRLWDIRSKEKSLELDCEHPVESVLFLPGEQLIATAAGPIVKIWDTTTGR--QLTALQAHYKTVTSLRLASTCLLSAGIDRRVNAFRTTNY----SLINSWSMPSPVLDIDVSRDDQTMAIGMGNLLALYRRAEIKK---EATASAAIEDKRSLIRTSAPPVKLVEKDRDMQKVDVVAKNADKLK................................................. 365
34 -49.400[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  10  4.QQQLILATGGYDHTIKVWQAHTGNC----------IKTMRFVETSQVNALDRTPDKTRLAACGYQ-CIRLYDLESNAPVINFDGVQKNVTRLGFQEDGNWMFTAGEDHHVRIWDMIAAPPHCSRIFDCEA-PVNAACLHPNQVEIAMGSQNGSVFLWDVKSERHERIVP-----EVDASIQDVAISPDGRYLAAANKGNCYIWSLTSQDQKMSTAHSRYILRCKFSDSRLLLTTSGDGTVCIWKTDDFS--KWRELCIENYWVWDAAFSSKWLFTASSDGIARLWKLQTKSSIRDYTGHTKA---ITALSFKDEIPVKSTNISDVQSSAKPPTQRD---------NPPGTNNLAFFETVGRVAMNPYMGNTTTELN......................................................... 362
35 -49.400[R] KOG2444 WD40 repeat protein  ali follow..  10  5...........................................FDNPPLCMKSNKDGSRLVVGFVDGSIRFYDTQQHEEEFQEIQTKSSIRGVDLDEHKKRVYAVTKNRSLCVFDIDTGKRVRCILKCHRS-VPTAICTLPKSQQLATADESGEVKTWNLDPEVASENANIRKWQEQDEDINDLKVDVKSNLLATSSDGTLGAYDLRKAKLKMRSELMHSELYSVCGTNRSVYVGGEDGYVEVFNLNEYGNLLERVESGFEMGVNGIVESGLLGLTSQGSNRMRLLNVQPSKRLGYAGYHGDEKSDIDAITISTDKSVFTMISMSCTIKKWDMGPIID----EIPILRAQDAKSKKMRKTEGFFDGLVGPKNDSDSDDDDEPKSKKRRNDEDSDEEIDEEEQEEDDEEEEEDS..................... 382
36 -49.300[A] KOG0299 U3 snoRNP-associated protein (contains WD40 repeats)  ali follow..  13  150..YENFVYSADKSGLIQKWEALQEKDTENRPIKFSRSRRGENDHVKEITCLAISNDGRWIVTGGLDHRIVIRDSVTLEPQHCWKHHRDAVMGLAMRRGTNEMFSCSADRSIKVWSLDQMSYIETL-FGHQD-VIFGVDALARERCVSVGGRDRTSRLWKIVEESQLVFRSMKATAGYMEGSVDCVAMIDEDHFVTGSNGVIALWSVQRKKPLFTYPQPRWITSLAAIPSNLFASGSWDGNIRLWKIAEGEPLTIATPLSVYGCINSLSLSLQVFAACGRETRVGRWKTLRGIPNSGFVFNI----PLTVIPSVTDGDEIDE................................................................................................................. 524
37 -49.200[S] KOG0282 mRNA splicing factor  ali follow..  11  175.TEKRKKFKENDASNIDGFLGPWAKYVDEKDVAEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYL-PKKQIHVWSGHTKGVSAVRLFPLGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSK-AVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFT------NRKVPYCVKFNPDEDFVAGMSDKKIVQWDIRSGEIVQEYDHLGAVNTIVFVENRRFVSTSDDKSLRVWEWDIPVDFK-YIAEPSMHSMPAVTLNGKWLACQSMDNQILIFGAQNRFRLNKKKIFHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKL----SRFKAHDKVCIGAVWHPETSKVITCGWDGLIKLWD......................................................... 579
38 -49.100[I] KOG0301 Phospholipase A2-activating protein (contains WD40 repeats)  ali follow..  13  37VTQGGCLISGGRDETVKFWAKKGKQYTKTHAFEQ----------PKGITVNSIAADGWRLFVGRRDGTIAVFGPSQAEPYAIFNEHKQNVCCLHINEKATHMLSGSWDSNVIIWPITELNFTTIVCPGHTL-SVWALASFPDLNTYLSASADKTIRMWFGDT-------TLSVFKGHTDVVRALVVLSSSHFLSAGNDGHIIHWDVASASILRKFATQAHEFIYSMTSDSHILTTGEDGTLEFWAIDGGKDVSEAVIQLPTTNTWDAKVLLN-IAVAGSDGRIYIMTTDKNRKADDDILD-AFDAEVVAKLTAKTERMKQEEHETVTIKVDIDDRPT-QLNLKYKKGTDPGLCAQEFLSENNLPIHYLEEITRFIKDRIPEARAFDLKSGKKVIVDGKEYDYALGVNFGKGEPDKQMPFNVNESPQFAAQR... 462
39 -48.700[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  12  2...AAIINQRVEQGESSMGG------------AKPALLHRITGHVARINDVILLSKDEGVWTASDDRSVRLYLKRDNDQFWPSHFMPVAPTSLYYSEETYKLLVGLINGNVYEFSVAD-MTESRKWTCHAG-PISGLGFALSSELIFSCSRDKSIVWHCSENSNKM--------GSYLLENSCTAMVIDLPFVFVGDGGHVTVLRIVDNQVSKLSAHTNAITSLTWDNKKVLYSGSSDHLIIMWDIGGGRGE-AYELNGHNGKVTTLCAAAKRLFSADEHGKLMCWDMNCKRVETPEWKTSDCCGSAVCGSCCDNWTTYPPMGYETKIRICNDCNARMKDNPQNFNEIHTGITAMHLQETLGLLVTSGQNRVIMIWDVRSVCSAPS................................................ 412
40 -48.600[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  11  204.PDSRVVVALSRDQTMSIHETETQEVVKEFVIETAKLVRKKRIASSNLDHLAYDVVSNRFLAISAEQNLIILDFENLKIARQIVGHDEIYSCCLLGKDESHMAVASNTSEIRLYNTKTLDCQLIR--GHTESVLSVVSPTWDTSLLASCSKDNSIIFWRLVTSPENDSCSVAAATGHANTVTALAISNTGRLASVSTDCTIKLWGLGVSTKLKEVKHGKDVNCVDISSDALIATGGMDKLVKLWQVDTHKMGIAGTLSGHRRGVGDVKFASHKLASCSGDMTIKIWNISEKSCLQTISGHSCA---VFRVIFARNDSQLISADSAGIIKIWTIKTADC---ECSIDAHTDKIWSLSKNHNESEFVTAGTDGRIVVWKDVTEEKQKAEDNKRREAIE...................................... 654
41 -48.400[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  14  183.PDRITIATGQVAGTSKDGK-QLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIANGGTNLCADSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNTITGDSSGNILVWGKGTNRISYAVQGAHEGG-ISPLCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIPEQTQGHTDELWGLAIHASKPQFLTCGDKHATLWDAVGHRPVWDKIIEDPAQSSGFHSGSVVAVGTLTGRWFVFDTETKD--LVTVHTDGNEQLSVMRYSGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVEPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAHIYGGHSSHVTNVDFLCEDS............................. 699
42 -48.200[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  15  137.NNESLLAVCTETGALELFDSRFYDRQNEENQPSARRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQTSKVFDLSTQQCITRLGYHSHSVKQVNFCNDSPNLVSCSRDGSIIFWDMRTHGITIDGEHFQKDCSITSATWLPQSTVISSCSANSALKLWDLRTVHTVRPLPAATTSKRDFGVTNVCTSPDGERIYAASDSIIYEYSSRHLNS-PRLRISSFYVKLACSDGATLACGGKTSGVVVFDTTRNCSSSAMLTGGHTKDVTAVDWSSEQLASISDDGSVRVWNSSLHGSAANLREKNF--SEIFYWGFSE........................................................................................................................ 489
43 -47.800[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  11  116.CDGSLVATGSVDASIKILDVERMLAKSAREQQGHPVIRTLYDHTDEVSYLEFHPKEHILASASRDGTVKLFDIAKPSKAHKVFTDCEPVLCLSFHPTGDYVAIGTEHNVLRVYDVATTQCFVSAIPQQHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRCINTIAEAH---GGAAICSLEFTRNGKYLLSSGDSLVYLWELCTSRPIQTYTQEHQTEAVFNHTEDVLFPDEATTSLCSWNSRNGCRLTL-NSLGHNGPVRYITHSGPAFLTCSDDFRARFWYRRANNQ............................................................................................................................................. 424
44 -47.700[DK] KOG0973 Histone transcription regulator HIRA, WD repeat superfamily  ali follow..  13  18.PSGKKFITCTSNGLVVVWNAEPVLDKKKASNENVPKLLFQVESQSQSNSCRWSPDGKRFAFGSDDSSVSVWEYVGLKECCVLRGHSMEVLTVEWSPNGKYLASGSIDYRIIIYNARKLPDRITVLNDIQL-PVKGLSWDPIGKYLASLEGDKKLRFWATDSWQCVKSVT--ESNIEETMLTRLDWSPDGKYLMTPAAVRIKLIQRQTWKSDQFLGHHKGTTCVRAMPRTCAAVGSRDKSISIWVFPGTLKPLFVINNIFNHTVMDFAWCGRNLLACSQDGTVKVIHLSESV---EMISNEAMSDLCYQIYSIRPPRYELTDKEEDESQDSFNLSDLSSSANNASFVTCPEDVLIKRKKLVAAQQSSDIQLTKSMEDNSKENESKNSEKTMMEERNKQIDVRKDGKRRIQPVFCGTTTADPMTSLSSEGKKTVA 491
45 -47.700[R] KOG1539 WD repeat protein  ali follow..  12  198.PALDVVAIGCADGKIHVHNIKLDEVISIWNLNKKRLQSVIR-DAHDSSIISLLANEPVLMSASADNSLKMWIFDTNRLLRFRSGHSAPPLCIRFYSNGRHILSAGQDRAFRLFSVIQEQQSRELSQRHLLLAILACAISACGNFAVVGTAGGWIERFNLQSGISRGSYSEKRRYAHDGEVIGVACDSTNTLMISAGHGDLKVWDFKKRELKSQWDVGCSLVKIVYHVNGLLATVADDFVIRLYDVVTLK--MVREFRGHTDRITDLCFSGKWVISSSMDGSLRIWDVILA----KQIDGVHVDVPITALSLSPNMDVLATAHSDQNVYLWVNQSMFSGLPSVESYASGKDVVNVKLPSVSALTSSEADDDMDRQVLENSEALQASISQKQIPELVTLSLLPKSQWQSLINLDI--KARNKPIEPPKKPEK... 749
46 -47.100[Z] KOG0313 Microtubule binding protein YTM1 (contains WD40 repeats)  ali follow..  13  56LIKGQFLRMPLDK-HMEVENISSEEVVEIEYVEKCTAPQPEQCMFHDDWISSIKGAEEWILTGSYDKTSRIWSL-EGKSIMTIVGHTDVVKDVAWVKKDSLLLSASMDQTILLWEWNVERKALHCCRGHAG-SVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEIVTLSGHMEAVSSVLWSDAEEICSASWDHTIRVWDVGSGSLKSTLTGNKVFNCISYSLCKRLASGSTDRHIRLWDPRTKDSLVSLSLTSHTGWVTSVKWSPTQLISGSLDNIVKLWDTRSCKAPLYDLAAHE--DKVLSVDWTDTGL-LLSGGADNKLYSYRYSPTT................................................................................................. 418
47 -47.100[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  10  2..DDNTAPKKNSEKKARVFDLQAMFAQT---ISNAPRTEEPTHVPQSVSVSSKSESGVSSSAVSDDEDDFMPDLPPGFQM--QQSEAGPSSSRAEGPEDSDDSDFDETEAISIIKLIPAACEAKISHG--TQAISALRVEPPGVRFASGGLDYYVKLFDFQKMDMSMRYDKELLPAESHVINSLAFSPNGETLVVASEAIIRLLDRAGKQWSETVRHTATVNCVEFNPLNEFISCSDDGSLRLWNLDDHKVITTKGANGKRVSPQVCTFSGKWIAAGCDDGSVQAWKYGSQYVNVNYLVRKAHNGSITSIAFSPDSKRLLSRGFDDTLKMWSLDNPKEPLLVKTGLENAFKSTDCGFSPRAEVVFTGTSPGTLQFFDPMTF-DLVYKIDYPGISCHRIQWHPRLNQIIAGLSDGTIHVYYDQTMSQR....... 453
48 -47.000[BK] KOG1063 RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily  ali follow..  10  327.HQPLSILSASMDKTMMIWRPEKKTGV-----VNVVCVGELSHCALGFYGGHWSPNSLSILAHGYGGAFHLWRNVSSQMQKVPSGHFAAVTDVTWARTGEYLLSVSQDQTTRVFSAWKWHELARPQVHGHDINCVAMVQGKGNHRFVSGAEEKVVRVFEAPLSFLKTLNHSHKLYGHGNELFSLCSDHKGNLVASSCKAQIWLWEVGTWKAVGRLQHSLTVTHLEFSDDTLLLSVSRDRHFSVFSIQRTDNKLMAKVEAHKRIIWACSWNGHQFATSSRDKTVKIWSVENDARIKQILVLPPFGSSVTAVAWTGLDRCVAVGMESGLIELSNVKIIETEEGTEPFMCHVSAVNRLAWRPTEKCLTSCGDDNCVRVFNFK....................................................... 839
49 -46.900[U] KOG1332 Vesicle coat complex COPII, subunit SEC13  ali follow..  12  5....................................INTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIADLRGHEGPVWQVAWAHPGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHGLILACGSSDGAISLLTYTGEGQWEVKKI--NNAHTIGCNAVSWAPAVVFASGGCDNLIKLWKEEEDGQWKEEAHSDWVRDVAWAPSSTIASCSQDGRVFIWTCDDASSWSPKLLHKFNDVVWHVSWSANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSSVTEGQQNE..................................................................................................................... 321
50 -46.900[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  12  24.GTE-AILSAADDHVFLLTNTATNESQQILNMPETFFPTSLHIFPRS---QTKGGQNDVFAVSTSDGKINILS-RNGKVENMVDAHNGAALCARWNSDGTGLLSSGEDGFVKMWSRSGMLRSV----AQFATAVYCVAWDSTSSNVLYCNADHCYIKSLKMQVAPI------KWKAHDGIILCCDWNPTSDLIVTGGDLKFKVWDGFGQILFNSSVHDYPITSISWNTDGTLFAVGSHNILRLCDKSGWS---HSLEKMNAGSVMALSWSGTQLAVGTAAGLVFHAHIIDKRLTYEEFEIVQTQKTERTVNIIVQCEKIFLVSDGMTITIFTYEGRKLINNPPGQVMALLDERKIDLANDTLVVRDRADNKVLHFFDPTTGKAQGDGNLKHEHDIVELTVNQCGPLNDR......................... 475
51 -46.700[R] KOG1334 WD40 repeat protein  ali follow..  13  264...............................VQRFRLQYLLGSHAGSVSTIHFNQRGTRLASSGDDLRVIVWDWVRQKPVLNFSGHDINVIQAKFFPNDSTLAMCGHDGQVRVAELINASYCENTKAKHRG-PAHELALEPDSYKFLTSGEDAVVFTIDLRQDRPASKVVVTRENDKKVGLYTISMNPANIYQFAVGDQFVRIYDQRRIDKKENNDFPTNITCVVYSDGTELLASYNDEDIYLFNSSLSDGAQVKRYKGHRNCVNFYGPRSEFVVSGSDCGHVFFWEKSSSQIIQFMEGDRG--DIVNCLEPHPYLPVLATSGLDQHVRIWTPTAKTA----TELTGLKDVIKKNKQERDEDNLNYTDSFDNRMLRFFV---RHLLQRAHQPGWRDHGAEFPDEEELDESSSTSDTSEEEGQD........... 674
52 -46.600[R] KOG1273 WD40 repeat protein  ali follow..  10  2.........................NAPIIDPLQGDFPEVIEEYLEHGVIKCFNHRGSLLAAGCADGGCVIWDFETRGIAKEIRDNSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTILQQPPFSPAAACFNKCGDLVYIGNSKGEILIVDYKSVRVLALVS----ASGAAPVKNIVFSRNGQYLLTNSDRTIRIYENLLPAKNKMKTTKMHWKAPCFSGDGEWVVGGGEHKIYIWDRAGH---LVKILEGPKEALIDLAWHPVIIVSVSLAGLVYIWAKDYTENWSAFAPDFKE---EENEEYVEREDEFDLIPETEKVKVLDVNEDE---EVDIDTVEKDAFSDSDMSVEELRYLPAEPIPDTNDQQDNLVESIKLIEGQISASPASEEAGQNGHHASSPQAGKKDSNS............... 472
53 -46.500[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  14  2..............................SAVCGGAARMLRTPGRHGYAAEFSPLPGRLACATAQGTLLILDPDEGLRLFRSFDWNDGLFDVTWSENNEVLITCSGDGSLQLWDTAKAAGPLQVYKEHAQE-VYSVDWSQTRGLVVSGSWDQTVKLWDPTVGKSLCTFR-----GHESIIYSTIWSPIPGCFASASDQTLRIWDVKAAGVRIVIAHQAEILSCDWCNENLLVTGAVDCSLRGWDLRNVR-QPVFELLGHTYAIRRVKFSASVLASCSYDFTVRFWNFSKPDSLLETVEHHTE---TCGLDFSLQSPQVADCSWDETIKIYDPACLT................................................................................................. 320
54 -46.500[R] KOG0288 WD40 repeat protein TipD  ali follow..  11  198.QQVDGIVRRNEDGTDHFVESTI----------PSTCANRIHAHEGGCGSIVFEYNSGTLFTGGQDRAVKMWDTNSGTLIKSLYGSLGNILDMAVTHDNKSVIAATSSNNLFVWDVSSGRVRHTL-TGHTDK-VCAVDVSKFSRHVVSAAYDRTIKLWDLHKGYCTNTV------LFTSNCNAICLSIDGLTVFSGHDGNLRLWDIQTGKLLSEVAHSSAVTSVSLSNGNRILTSGRDNVHNVFDTRTLE--ICGTLRASGNRLACISPDDDYVAAGSADGSVHVWSLSKGNIVSILKEQTSP---ILCCSWSGIGKPLASADKNGYVCTWT...................................................................................................... 515
55 -46.300[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  12  136.SANVLAIAL--GDTVYLWDASSGSTSEL---------VTIDEDKGPVTSINWTQDGLDLAVGLDNSEVQLWDCVSNRQVRTLRGGH-ESRVGSLAWDNHILTTGGMDGKIVNNDVRIRSSIVETYLGHTEE-VCGLKWSESGNKQASGGNDNVVHIWDRSLASSKQTRQLHRFEEHTAAVRALAWCPFQASLLATGDGKIKFWNTHTGACLNSVETGSQVCSLLWSQSELSSHGFTQNQLTLWKYPSMS--KMAELNGHTSRVLFMAQSGCTVASAAGDENLRLWNVFGE----PPKTTKKAASKKYPELFSHVNSL.................................................................................................................... 443
56 -46.300[R] KOG2096 WD40 repeat protein  ali follow..  11  7.VGIASVILGALIAVLFFGSYFRK-----------RTSEVQSMAKAEPQDPIRNPKSNHPAPKKNHPKSQASDKNQNKDLNTLKGHGDAVTGLCFSSDGKSLATACADGVIRVFKLDDASSKSFNRWEFAGGHPTAVAFADDASSIVVACHHMSSIKWDHHHIHEKRSVL-----TISGATATYGTADGSVVIASCSGTDIVLWHGKTGRNLGHVDNQLKNHMAAVSNGRFLAAAAFTADVKVWEIVYQKDSRVMQLKGHKSAVTWLCFSSEQIITASKDGSIRVWNINVRYHLDEDPKTLKVPLHYDRLSLCPEGKILAASH-GSTLQWLCAETGNVLD--TAEKAHEGDITCISWAPKAITVGTSGDDKKVKLWEAPKSQSL.................................................. 454
57 -46.200[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  10  101.LYQQYAVPADSTPDVPVDCILTK-----------FIRTAMNKVKCPVYSVCWSPEGKRLITGCQTGEFTLWNGTAFNFETILQAHDSAIRALKWASNEQWLLSADQGGYVKYWQPNMNNAHMFS--AHKDEAIRGLAFAPTDVKFATASDDGTARVWDFARYTEERVLR-----GHGAEVRCIDWHPTKGLIATGSQQPVKIWDPKSGSCLATLQHKSSVMAVEFNNGNWLLTGGRDHLVKMYDIRMMK--EMRTYRAHKKEVISLAWHPILFVSGGGDGSIVYWMVDGEKEIGLLEHAHD--QAIWSMKWHPLGHILATGSNDNNTKFWARNEDIFGLSNTNMIGHLDKEREPRMAPPKPSIETQETYRPDTFIPGGLDEHLYEQLNRDHNMMTTDSTLLVPDDLTRQNFAPMIGAKRTLIKQPPAKKAQRQ 526
58 -45.800[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  10  1.................................................MSFFNRSNTTSALGTSTAMANEKDLANDIVI--NSPAEDSISDIAFSPQQDFMFSASSDGKVRIWDVQNGVPQGRAQHESSS-PVLCTRWSNDGTKVASGGCDNALKLYDIASGQTQ------QIGMHSAPIKVLRFPSNTECIVTGSDKTIKYWDMRQPQPVSTVMMPERVYSMDNKQSLLVV-ATAERHIAIINLANPTTIFKATTSPLKWQTRCVACEADGYAIGSVEGRCSIRYIDDGMQKKSGFS-QSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQRHR----KGYPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNRPDYPNVIRLHATTDEE...................................... 358
59 -45.600[R] KOG2321 WD40 repeat protein  ali follow..  10  63.RDGKYAMAGVYKPHIKVFDFA-----------EMSLKFERHTDAENVQFEILSDDWTKSVHLQTDRTVDFLNLEQGRFLNPLKSPTGGVNVIDINPMHQLLAFGTDAGSVEFWDPRDRSRVGILEIPSNSRSVTALKYRNDGLNVAIGLSDGATLLYDLRSSSPYMSK----DQGYSMPIKSLHWMDSALRVLSADSKIIKIWEKDTGKPFSSIEPTVELNDVCPIEGTLILTANEGSPMHAFYIPSLNPAPR--CSFLDNITEEMEYDDYKFVTKKELLNLGLDHLVGTQKIVKERLEKQRASKIRSQNRPKVNAGLASRLSYQENKLRKKTGVTDGPSILEDERFKNVFTDKEFEVDEDTLEYKQLHPSRSEARGLTAAEESEEEKEHTKGIKFSSDEESLSDMEEENETFDALVDRRKTEQQVSNEKTPQ 580
60 -45.400[R] KOG2055 WD40 repeat protein  ali follow..  117.SRLRKLRQYEDEDMVNGLQYARTEEEDEFNALSEKSVIPKSLKSLFKSSVSYINQSSKLLAPGTINIKRLKDANFQA------PSHSGIRCMSIHPYFPLLLTCGFDRTLRIYQLDGKVNPLVTSLHLRSSALQTALFHPDGKRVIAAGRRKYMYIWDLESAQVQKVSRMYGQENFQPSMERFHVDPTGKYIALEGSGHINLLHALTGQFATSFKIEGVLSDVLFTDGSEMLVLSYGAEVWHFNVEQRSVVRRWQVQDGSTTHFCLDPSNKYLAIGSKSGIVNIYDLQTSNADAAVTTLDNITFSINSMSFSQDSQVLAIASKKDTLRLVHVPSFSVFRNWPTSATPLGRVTCLAFGKGGE-LCVGNEAGRVGLWKLAHYDLKFVP---DKIINWEIRLGKFGY............................. 539
61 -45.400[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  408.PRAKRVKLNIDAEYLIPKLPSPRD----LQPFPTVESMVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCIRTI-ETDEVVRCVAWCPNPKLIIAVATGNRLLLVNPKVGDKVLRVVITHFK-PIRQVTWHGRGDYLATVMPEGANRIHQLSKRRSQIPFS-----KSKGLIQFVLFHPVKPCFFVATQHNIRIYDLVKQELVKKLLNSKWISGMSIHKGDNLLVSTYDKKMLWFDLDLST-KPYQTMRLHRNAVRSVAFRYPLFASGSDDQAVIVSHGMVYNDLLQN--EKRDEFGVLDVNWHPVQPWVFSTGADSTIRLYT...................................................................................................... 784
62 -44.900[R] KOG1188 WD40 repeat protein  ali follow..  11  3.....KIEEQFANLHIVKCSLGTKEPTYLLGI--------------DTSKTVQAGKENLVAVLCSNGSIRIYDKERLNVLREFSGYPGLLNGVRFANSCDSVYSACTDGTVKCWDARVARKPVQLFKGYPSNIFISFDINCNDHIICAGDDDALLVFWDARMNSQNLSTTKDSLETHSDDVTQVRFHPSNPNMVVSGDGLVNVFDINIDNEEDALNSISSVSCIGWSGKGQIYCMTHDEGFYWWDLNHLDTEVVNMKEDALDYLIGGLYHEKHVIGGTNKGRIHLMNCSMSGLTHVTSLQGGHAATVRSFCWNVQDDSLLTGGEDAQLLLWKPGAIE---KTFTKKESMKIASSVHQRVRVHSNDSYKRRKKQ............................................................. 387
63 -44.700[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  14  227.REALEVPSAARAGRMVEM---------QKKLQSLAPLCSQVGDTRPVSSAAFSEDSSLLLTSSWSGLCKLWSVPDCELKQTLRGHASYVGGVALRPGVKAMASGGHDGAVKLWGFNNEESIADI-TGHMPHRVSKVAFHPSGRFLATACYDSSWRLWDLEQKTEVLHQE-----GHAKPVHCLSYHSDGSVLVTGGDAFGRVWDLRTGRCIMFLEHLGAVFGVDFSNGFHIATGSQDNTCKIWDLRRRQ--PVYTIPAHTNLISDVKYQGSFLVTCSYDSTTKIWSNKTWQPLKTLQGHDN---KVISVDIAPNSQYIATTSFDRTFKLWSPDS................................................................................................... 553
64 -44.500[S] KOG3881 Uncharacterized conserved protein  ali follow..  11  1MPPPFRALTFDSLGLIKVTEARGQ------ERGIPTVVNTWGEMNASRSVLAASLRNPLLAVARKDGNVEVINPCNGDLHFSYSVHLFRKKIDDQTERSCTLLTCTKKGDVSLRSVKFPDAHGNSTDDASSGEILVGKVDGSENFSLFGGKRVEANIWDLEQCTKIWSAKCPPKNNLG--FTSATFKDDHRKFVTGTSHQVRLYDISTQRVLSFDFRETAITSIAEDDGHTIYVGNASADLASFDIRTGKLL--SFLGKCSGSIRSVVRQHQVIASCGLDRYLRVYDVKTRQ----LISAVFLKQHLTGLVFDSGFSGEETAVANTVAEAATEEKMTIQEDDETEKAPVKRKKSKKEKRSREIVFEGEDDEEN---EDEIEKAPVKTKKSKKEKRSREKVSEGEEKDELRSKKTREHKKKTKIVKHNQED.... 468
65 -44.200[S] KOG0270 WD40 repeat-containing protein  ali follow..  142.PSDNLVLAARTEDDVSYLDIVRDPALYVHHDLMLPAFPLCVEWLDYKVGSNSEEAANYAAIGTFDPQIEIWNLKKSKTGHITTHHTDAVLSMAHNKYFRVLASTSADHTVKLWDLNSGNAARSLASIHSNKNVSSSEWHMNGSILLTGGYDSRVALTDVRISDESQMSKYWS-AMAGEEIETVTFASENIILCGTDSGNVYSFDIRNNENRKPVAHDAGISTLCSNPGMMSTGAMGEKTVKLWKFPLDDASMVLSRDFDVGNVLTSSFAPDTMVIGGVNKVLKLWDVFTNRSVRKSFKSELEN--VQARAKEEAQKIGKSSRIARKYTSNDNPDTVITI---DDQGEDEEEREGGDEHDDMA....................................................................... 576
66 -44.200[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  13  1............................MTTVTPSAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLKGEF-LHGGAVLDCCFHDDFSGFSVGA-DYKVRRIVFNVGKEDIEYFDFSILFFYTLCLFCDVTGQVITGSWDKTVKCWDPRGASGPERTQV---GTYLQPERVYSMSLVGHRLVVATGRHVNIYDLRNMSQPEQ-SLKYQTRCVRCYPNGTYALSSVEGRVAMEFFDLSEAAQAKKYRDIVYPVNSIAFHYGTFATGGCDGFVNIWDGNNKKRLYQYSKY---PTSISALSFSRDGQLLAVASSYTFEEGEKSQEPEA................................................................................................ 331
67 -44.000[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  13  24ILEEAVRSKITKDQDDDDDDGSSSSSYIVLSGGGGEGRSRRVIGTDLPYRMAIHPRQGGLICALPENIIEDDNEEESEKVVKELKDVGQQLSLSFNQDGTVLATGAEDGTLRVFEWPSMKTLLNESKTHAS--VKSLTFSESGKFLVSLG-APLCRVWDVNASAAIASLS----KEKDEMFASCRFSVDNSAANTQRGGSIITWDTTSWRRRSSIKRNNSISAFNVSDGKLLAVGTLEGDVLIIDSTKMQTNQI-VKKAHLGLVTALTFSSRCLVSVSFDSRARLTVIKQKGEKRRVYLWVAA---LFVLVYVVLYYLMVAMGIIH............................................................................................................ 383
68 -43.900[R] KOG4227 WD40 repeat protein  ali follow..  10  63.NNGGQLVSGGDDRRVLLWHMEQAIH------SRVKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETLDVF-AHEDAVYGLSVSPVNNIFASSSDDGRVLIWDIRESPHGEPFCLANYPSAFHSVMFNPEPRLLATANSKEGVGLWDIRKPQSSLLRY--GGNLSLQSAMSVRFNSNGTQLLALRRLPPVLYDIHSRLPVFQFDNSCTMKSCCFAGDRYILSGSDDFNLYMWRIPADPEAAFMVLKGHRSIVNQVRFNPHMICSSGVEKIIKIWSPYKQPGCTGDLDGRI--EDDSRCLYTHEEYISLVLNSGSGL-SHDYANQSVQEDPRMMAFFDSLVRREIEGWSSDSDSDLSESTILQLHAGVSERSGYTDSESSASTVDESADNAFHLGPLRVTTTNTVASTPPTPTCEDAASRQQR 512
69 -43.700[KL] KOG4283 Transcription-coupled repair protein CSA, contains WD40 domain  ali follow..  12  10.....................................................TGRIRSNSFANRFKSRRILSLQLSNRKDFVSPHRGSVNSLQVDLEGRYLLSGAADGSAAVFDVQRATDYEASENGHKY-AISSAIWYPDTGLFITGSFDHYLKVWDTNTAQAVVDFKMP---GKVYRTAMSSMAMSHTLIAAGTDVQVRLCDIASGAFSHTLSHRDGVMSVEWSTSSVLYTGGCDGAIRFWDIRRAG--CFRVLDQSQTQL-GFRPPILKRTAVGSKVC........................................................................................................................................................ 253
70 -43.300[YU] KOG2445 Nuclear pore complex component (sc Seh1)  ali follow..  14  1....................................MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDELSDSWRAHDSSIVAIDWASPGRIIASASYDKTVKLWEEDPDQNKLCTLNDSKGS-LYSVKFAPAGLKLACLGNDGILRLYDALEPSDLRSWTLTSEANHLQSDFCLSWCPSREKLAVSALEQAIIYQRGKDGKLHVAGHKSLIRSISWAPSQLIATGCKDGRIRIFKITEKLSELLSEHDDHNGEVWSVSWNGTILSSAGDDGKVRLWKATYSNE............................................................................................................................................. 338
71 -43.200[BL] KOG1009 Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats)  ali follow..  12  23.HGTARLASAGVDTNVRIWKVEKGPD----GKAIVEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWKVNDNTVVKTLRGHLEDVYDICWATDGNLMASASVDNTAIIWDVSKGQKISIF-NEHKS-YVQGVTWDPLGQYVATLSCDRVLRVYSIQKKRVAFNVSMFHDDSMKSFFRRLSFTPDGSLLLTPACVESGENVMNTTYVFSR-CPGKATLAVRCCPYRLVFAVASEDSVLLYDTQQSFPFGY-VSNIHYHTLSDISWSGAFLAISSTDGYCSFVTFEKDE-----LGIPLKEKPVLNMRTPDTAKKTKSQTHRGSSPGPRPVEGTPASRTQDPSSPGTTPPQARQAPAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPT 516
72 -43.100[S] KOG0283 WD40 repeat-containing protein  ali follow..  11  365.KKGKDHKHGKANEWVKVRPTGKS----YKELSALHMCQEIQAHEGAVWTIKFSQDAHYLASGGADRVIHVWEVQECELMSMNEGSLTPIHPSLCDSSGNEITVVEKKKKGKGSSGRRHNHIPDYVKGHLDA-ILDLSWSKSQL-LLSSSMDKTVRLWDIETKTCLKLF------AHNDYVTCIQFSPDENYFLSGSDAKIRIWSIQDRHVVEWSDLHEMVTAACYTDGQGALIGSHKGICRAYDTEDCKDVQSNKKSQAKRKITSFQFSPVEVLVTSADSRIRILDGSEVIHKFKGFRNTCS---QLSASYSQDGKYIICASEDSQVYLWKNDFHRTRSTLTDVSAAVPWHGHVRGEPPPVQIHSKRHSKRISTSSQPSSTISSPTKEETSATGPTTSNRNKKSGLPPMPKKAATKSQIQPEEEAGPELGSSE 822
73 -42.800[R] KOG0322 G-protein beta subunit-like protein GNB1L, contains WD repeats  ali follow..  11  25FQESDRLLAGTIKGSVFLWDLQTN-------------RSALHFEVGSDPITSLHHTPDRLVTQEKGGTITMFSIGGSSPGNHLGFCRSALHTNTSKTNEQLLFYPCEESSIGVLHVTDAAAPTQILVPDDPQLCFKPFECASQLFLLAGYESGHFLTWDISSSVILDVME------LAQDATSVDYDPVTNRGIVGGTDKLISFSYQRSSMQMQLGKNPGVNGVRIRDQKVFASAGWDGRIRIFSWKSLR--PLAVLTQHNGGVMDLAFSAPIMAAAGMDGQISLWDLYN................................................................................................................................................ 323
74 -42.700[S] KOG4328 WD40 protein  ali follow..  13  224.PNVKMVAAGDKLGNVGFWNLDCGNEEDN--------DGIYLFTPHSAPVSSIV-SLSRVISSSYDGLIRLMDVEKSV-FDLVYSTDEAIFSLSQRPNDQSLYFGQDYGVFNVWDLRAGKSVFHWELH--ERRINSIDFNPQNPVMATSSTDGTACLWDLRSMGAKKPKTL-STVNHSRAVHSAYFSPSGLSLATTSDNYIGVLSGANFENTCMIYHNNSKFKAVWGDDSYIYVGNLSKKIDVINPKLKRTVMELHNPLQRAIPCRIHCHPGTLAGSTAGGQVYVWTTK................................................................................................................................................. 516
75 -42.100[T] KOG1354 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  10  1.......MAGAGGGNDIQWCFSQVKGA----------VDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENDYLKSLEIEEKINKIRWLPQKNQFLLSTNDKTIKLWKISE-SPRRIFANAHTYH-INSISINSDYETYLSAD-DLRINLWHLEITDRSFNIKPANMEELTEVITAAEFHPNSCNTFVYSKGTIRLCDMRASALCDRHEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMEN-RPVETYQVHEYLRSCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENN---KPRTVLKPRKVCASGKRKKDEISVDSLD-------------FNKKILHTAWHPKENIIAVATTNN............................................................... 438

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhao Y, Hong DH, Pawlyk B, Yue G, Adamian M, Grynberg M, Godzik A., Li T. The retinitis pigmentosa GTPase regulator (RPGR)- interacting protein: subserving RPGR function and participating in disk morphogenesis. Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3965-70. Epub 2003 Mar 21.