current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats), from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360
# Score Template Links and tools%idFirst MGDQQQLILATGGYDHTIKVWQAHTGNCIKTMRFVETSQVNALDRTPDKTRLAACGYQCIRLYDLESNCTAPVINFDGVQKNVTRLGFQEDGNWMFTAGEDHHVRIWDMIAAPPHCSRIFDCEAPVNAACLHPNQVEIAMGSQNGSVFLWDVKSERHERIVPEVDASIQDVAISPDGRYLAAANNKGNCYIWSLTSQDQKMSTLRPNRKIPAHSRYILRCKFSPDSRLLLTTSGDGTVCIWKTDDFSKWRELCIENYWVWDAAFSADSKWLFTASSDGIARLWKLQTKSSIRDYTGHTKAITALSFKDEIPVKSTNISDVQSSAKPPTQRDNPPGTNNLAFFETVGRVAMNPYMGNTTTELNLast
1 -87.600[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali  100  1MGDQQQLILATGGYDHTIKVWQAHTGNCIKTMRFVETSQVNALDRTPDKTRLAACGYQCIRLYDLESNCTAPVINFDGVQKNVTRLGFQEDGNWMFTAGEDHHVRIWDMIAAPPHCSRIFDCEAPVNAACLHPNQVEIAMGSQNGSVFLWDVKSERHERIVPEVDASIQDVAISPDGRYLAAANNKGNCYIWSLTSQDQKMSTLRPNRKIPAHSRYILRCKFSPDSRLLLTTSGDGTVCIWKTDDFSKWRELCIENYWVWDAAFSADSKWLFTASSDGIARLWKLQTKSSIRDYTGHTKAITALSFKDEIPVKSTNISDVQSSAKPPTQRDNPPGTNNLAFFETVGRVAMNPYMGNTTTELN 362
2 -68.700[S] KOG0295 WD40 repeat-containing protein  ali follow..  13  29SVFLKESSLSENDIKPLGGILEKKWTTVLRLQR-KVNDLESKLQESQREINHGAPTRDRQAADWIPRPP--ETQKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYETGQ-LERTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLWDFQTYDCLKSLKGHEHTVSSVTFLPTGDFVLSASRDHTIKQWDISTG-------YCVYTFRGHNDWVRMIRISNDGTLFASASLDQTVTVWSFATKSAKLVLRDHEHAVECVEWAPDTAYLFSGSRDRSIKAWNINTGDVLFTLLAHENWVRGLAFHPKGKYLISVADDKTLRVWELSAIEAHEHFVSTVAFHQTSPFVITGSVDMSCKVWE 402
3 -68.400[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  15  112QFSPDGRGLASGSGDQTMRIWDIELELPLHTCK-SHKSWVLCIAWSPDATKIASACKNEICIWNAKTGE-QIGKTLKRHKQWITSLAWQPTCRLLASCGKDGNIFIWDTVQGT-VVRCLSGHTASVTCLRWGGEGL-IYSGSQDRTVKMWRADDGVMCRNMTGHAHWINTLALNTDYALRTSCFEPSKRCIKPDTVEECQKVA----------QTRYEAALEIAGGERLVSGSDDFTLFMWNPETKQSINRMTGHMQLVNQVVFSPDTRYIASASFDKSVKLWCGRTGKYLASLRGHVGPVYQVAWSADSRLLVSGSADSTLKVFELKTLPGHGDEVFTVDWSPEGTKVVSGGKDKVLKLWR 472
4 -67.600[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  13  36QYDAQNGRLFTGGSDTIIRTWSVPHHKDAFSARGQHTDWVNDMILCGHGKILISASNDTVKVWNIERDNKGFIDCIRTHKDYVSCLAYAPIVEKAVSASFDHNIFVYDINANFKTVNNLIGCKDSIYSLATTPNLSLVLGAGTEKCIRLFDPRTNEKIMKLRGHTDNVRALVVNDDGTRALSAGSDATIRLWDIGQQ-------RCIATCIAHEEGVWTLQVDSSFTTVYSAGKDKMVVKTPLYDFTKSQLLFKEEAPVKKLLLSEKDNSLWVGTWKSDIKRWSIRPSAQLSIGGDEDGPSTSNANHSVSASSSPPVTFKYIRVKDQKGQQPGAPAIKKHAMLSDKRHVLTRDSDGNVALYD 419
5 -66.800[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  13  203..VPDSRVVVALSRDQTMSIHETETQETLRVL--PLYESIEGGAIGHNGNLFTVGEEGVVKEFVIETAK--LVRKKRIASSNLDHLAYDVVSNRFLAISAEQNLIILDFENLKIARQIVGFHDEIYSCCLLGKDESHMAVASNTSEIRLYNTKTLDCQLIRGHTESVLSVVSPTWDTSLLASCSKDNSIIFWRLVTSPEQLPKLTCSSTMVAHGKDVNCVDISESDALIATGGMDKLVKLWQVDTHKMAGTLSGHRRGVGDVKFAKNSHKLASCSGDMTIKIWNISEKSCLQTISGHSCAVFRVIFARNDSQLISADSAGIIKIWTIKSIDAHTDKIWSLSKNHNESEFVTAGTDGRIVVWK 635
6 -66.600[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  13  291..LSEVEAVKDWSKRLHLGPRASLPSVCMYTFH-HTNNNMNCAEFSPDSTMIACGFQESIRLWSIKADDSDGSVRLLSHSGPVYGTTFSPDNKYLLSCSEDASARLWSVDTKT-ALVAYKGHTGPVWDVAFGPFGHYFATASHDQTAQLWSCDHIYPLRVFAGHLSDVDCVTFHPNSAYVLTGSSDKTCRLWDVHRG-------HSVRVFNGHTQPVTAVAIAPDGHTMASADSEGLIHLWDIGTGRRIKTMRGHRGNIYSLSFSRESTVLVSGGSDCTVRAWDVFKTNYNNPVSSSLTGSVVTPFSAKTSTFNEVNWSTSPDQ--MVALYTKQTPIFNVSFTRRNLCLAISVS........ 643
7 -66.600[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  12  400TFPPSSGKSFIMGADEALESELGP----------GELAGLTVANEADSLTYDIANNKDARKTWNPKF-------TLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWNTTEVAPALSV---FNDIKELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLENSSCQINRVISHPTLSISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESRKKFEESIHDVAFHPSKCYIASAGADALAKVF. 779
8 -66.000[R] KOG0286 G-protein beta subunit  ali follow..  11  2......................GEMEQLRQEAE-QLKKQIADARKACADVTLAELV-SGLEVVGRVQMR--TRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKV-HAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSRKVSRELSAHTGYLSCCRFLDDNN-IVTSSGDTTCALWDIETG-------QQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESCGITSVAFSLSGRLLFAGYDDFNCNVWDSMILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN 340
9 -65.600[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  12  411..VAYGRSPMVGFDPPPHMRVPTIPPNLAGI---PGGKPAYSFHVTADGQMQPVPFPDALIGPGIPRHA--RQINTLNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLATPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQ-------TLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQH-DFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPD-KYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGAKESSSVLSCDISVDDKYIVTGSGDKKATVYE 767
10 -64.900[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  16  286AVDKTGRILACHGTDSVLELFCILSKKEIQKKM-DKKMKKARKKAKLHSSKGEEEDNNLVELYSLNPSVRTSRITIGGHRSDVRTLSFSSDNIAVLSAAAD-SIKIWNRSTLQCIRTM---TCEYALCSFFVPGDRQVVIGTKTGKLQLYDLASGNLLETIDAHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKDENSTQKRLTRTLQLDEDVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLKFFLSLYGHKLPVICMDISHDGALIATGSADRNVKIWGLDFGDCHKSLFAHDDSVMYLQFVPKSHLFFTAGKDHKIKQWDIQTLEGHHQEIWCLAVSPSGDYVVSSSHDKSLRLWE 703
11 -64.700[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  14  24..HPTEPWILASLYSGTLCIWNYQTQVMAKSFE-VTELPVRSAKFVARKQWVVAGADDYIRVYNYNTMD--KVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWACTQIFEGHSHYVMQVTFNPKDNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDYLITGSDDHTAKVWDYQTK-------SCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYIKSSRRVVIGYDEGTIMVK-LGREIPVASMDNTGKIIWAKHNEIQTANIKSIGADYEVTDGEVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTA 381
12 -64.000[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  15  317..NTRTKVLVVAFSSGAFYLYELPDVNMIHSLS-ISDYPISAALFNCTGDWVALASREQLLVWEWQSEQ--YIMKQQGHSSEMTCIAYSSDGQFIATGGEDSKVKLWNTQSSF-CFVTFSEHTSGVTGIQFSRNKKFLVSSSLDGTVRAFDVNRYRNFRTFSPNPAQFSCVAVDYSGELVVAGGQDFDIFLWSVKTG-------KLLEIISGHEGPVVSIAFSPTSSTLVSGSWDKTVKIWNCLESNSEHETIDAVSDVTNVTFSPSGEEIAVATLSGNITIFDIKSAGQVTTIEGRNNYFSTIEYSADGECILAAGKSANICIYHVRELDGLNDFISRKHLSEFGNMALVEGGRVAIRLPG 711
13 -63.900[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali follow..  15  150..HEINNHSKPMEIDGDVEIPPNKA-----TVLRGHESEVFICAWNPVSDLLASGSGDTARIWNLNENSIREGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTENGN--LASTLGQHKGPIFALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMT-FASCSTDMCIHVCRLGCD-------HPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPMLASASFDSTVRLWDVEQGVCTHTLMKHQEPVYSVAFSPDGKYLASGSFDKYVHIWNTQSGSQGTGGIFEVCWNARGDKVGASASDGSVCVLD 521
14 -63.600[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  14  4.....................KRPNNSVILAQE-AKRSKNDLMAYTNRDKALLESGVRR------TSNLQAPIMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLCSGSDDRTIKIWDARKKHAAHTL--------ESPFQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDTITGMSLSPEGDFILTNAMDNTLRVWDVRGERCVKVFQGHEKNLLRCAWSPGSDKITSGSADRHVYIWDVNTLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGE 344
15 -63.200[A] KOG0285 Pleiotropic regulator 1  ali follow..  12  84PGPKGSKELRKSATEKALVVGPTLPPRDLN--NTGNPGKSTAILPAPGSFSTAALMERMPSRWPRPEAPWKNYRVLQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATGV-LKLTLTGHIGQVRGLAVSNRHTYMFSAGDDKQVKCWDLEQNKVIRSYHGHLHGVYCLALHPTLDVVLTGGRDSVCRVWDIRTKMQI--------FVLPHDSDVFSVLARPTDPQVITGSHDSTIKFWDLRYGKSMATITNHKKTVRAMALHPKENDFVSASADNIKKFSLPKGEFCHNMLSLQRDIINAVAVNEDGV-MVTGGDKGGLWFWDWKSGHESEAGIYAACYDQTGSRLVTCEGDKTIKMWK 454
16 -63.200[R] KOG1539 WD repeat protein  ali follow..  17  195VSSPALDVVAIGCADGKIHVHNIKLDEEIVTFEHASRGAVTALSFSTDGRPLLASGFGVISIWNLNKKRLQSVIR-DAHDSSIISLNFLANEPVLMSASADNSLKMWIFDTNDRLLRFRSGHSAPPLCIRFYSNGRHILSAGQDRAFRLFSVIQEQQSRELNHLLLAILACAISACGNFAVVGTAGGWIERFNLQSGISRGSFDMSEKRRYAHDGEVIGVACDSTNTLMISAGYHGDLKVWDFKKRELKSQWDVGCS-LVKIVYHRVNGLLATVADDFVIRLYDVVTLKMVREFRGHTDRITDLCFSEDGKWVISSSMDGSLRIWDVILAKHVDVPITALSLSPNMDVLATAHSDQNVYLWV 648
17 -62.400[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  15  50..SESGVSSSAVSDDEDDFMPDLPPGFQMQQ---SEAGPSSSRAEGPEDSDDSDFDETAISIIKLIPAA--CEAKISHGTQAISALRVEPPGVRFASGGLDYYVKLFDFQKMDMSMELLPAESHVINSLAFSPNGETLVVASGEAIIRLLDRAGKQWLNITKGHTATVNCVEFNPLNKEFISCSDDGSLRLWNLDDHKVITKCINKTKGANGKRVSPQVCTFSPDGKWIAAGCDDGSVQAWKYGSQYNYLVRKAHNGSITSIAFSPDSKRLLSRGFDDTLKMWSLDNPKLVKTGLENAFKSTDCGFSPRAEVVFTGTSPGTLQFFDPMTIDYPGISCHRIQWHPRLNQIIAGLSDGTIHVYY 446
18 -62.100[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  14  28..MDQGVTEDEAEQEQNDTMNNMVMDMSVQGFF-EHKDSVFSVSINPVHSNLCASGDDLGYIWDITTGE--QICQLTGHKDSIVAIDWSFDGTYIATGGMDSQVRLWKSSTGFEF-ITAFETVDEIVWLSWHPKGLFLAAGCNDGSIWMWSLPSGKVVQVMYGHTAPVNAGKFIPPGKRLATVDDSGTLIVWNPATGAPSSDDHRFDPGNEETAAGWTSFDCNAEGNVLFLGGSSGKVKVVNINSSHILASLEAQTESVEAIALCTALPICACASVDGTVALYDSASLKFRKSL-PHEQAVIDCKFLPNTPYLLTACADCVIRKWDVRSYTGHQEPILCMAITPDGKRVVTGSDDTELLVFD 396
19 -61.800[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  16  31.ADPKGKNFLYTN-GNSVIIRNIENPAIADVYT-EHSCAVNVAKYSPSGFYIASGDASKIRIWDTVNKEHLLKNEFQPIAGPIKDISWSPDNQRIVAVGEGREGHVFMSETGTSV-GEISGQSKSINSADFRPARPRIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEF-----GSPAHKGGVYALAWKPDSTQLLTCSGDKTCRLWTVESRELVSEVMGTTVDDQQVSCLWQGDNLITVSLSGVITYLNVADSKPLRVVKGHNKPITVLGLSDDRSTIYTGSHDGVVTNWNSGSITGTGHGNQINGIAAWGDFVYTCGIDDSLRQFS 394
20 -61.600[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  13  5..................................GHTSPVDSVAFNSEEVLVLAGASSVIKLWDLEES--KMVRAFTGHRSNCSAVEFHPFGEFLASGSSDTNLRVWDTRKKG-CIQTYKGHTRGISTIEFSPDGRWVVSGGLDNVVKVWDLTAGKLLHEFKCHEGPIRSLDFHPLEFLLATGSADRTVKFWDLETF-------ELIGTTRPEATGVRAIAFHPDGQTLFCGLDDG-LKVYSWEPVICRDGVDMGWSTL-GDFCINEGKFIGCSYYRNSVGIWVSDISELEPSEDKNECMVKRFSVLNDQSERMGSGPRGSVSP------DYETREIKNIYVDSTGGNLNVAQNPGSLKATL 319
21 -61.500[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  16  41..LVKADQCAPSERLLHVMIAGMQTLSDKDKTNSDDVLPGIDLEFEPEASALAPEPHSY------------ETAYVTSHKQACRAGAFSCDGSLVATGSVDASIKILDVERGHPVIRTLYDHTDEVSYLEFHPKEHILASASRDGTVKLFDIAKPSVKKAVFTDCEPVLCLSFHPTGDYVAIGTEHNVLRVYDVATTQCFVS----AIPSQQHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRCINTIAEAGAAICSLEFTRNGKYLLSSGMDSLVYLWELCTSRPIQTYTGQEHQTEAVFNHTEDYVLFPDEATTSLCSWNSRNSLGHNGPVRYITHSPNGPAFLTCSDDFRARFWY 418
22 -61.500[T] KOG0279 G protein beta subunit-like protein  ali follow..  17  1......................MAEGLVLKGTMCAHTDMVTAIATPVDNSDVIVTSDKSIILWKLTKEDGVAQRRMTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGE-STRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKLWNTLGECTISEADGHKEWVSCVRFSPNTLVIVSASWDKTVKVWNLQNC-------KLRNTLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGS-IIHSLCFSPNRYWLCAAT-ENSIRIWDLESKSVVEDLKVD---LKAEAEKTDGSTGIG--------------NKTKVIYCTSLNWSADGNTLFSGYTDGVIRVWG 322
23 -61.400[R] KOG0288 WD40 repeat protein TipD  ali follow..  157..MLIDRWMLQKMQD--AERLNEANDLYEEMLA-KLKANGLETLARQQVDGIVRRNEDTDHFVESTI-PSTCANRIHAHEGGCGSIVFEYNSGTLFTGGQDRAVKMWDTNSGT-LIKSLYGSLGNILDMAVTHDNKSVIAATSSNNLFVWDVSSGRVRHTLTGHTDKVCAVDVSKFSRHVVSAAYDRTIKLWDLHKGYCTNTV--------LFTSNCNAICLSIDGLTVFSGHMDGNLRLWDIQTGKLLSEVAGHSSAVTSVSLSRNGNRILTSGRDNVHNVFDTRTLEICGTLRASGNRLSRSCISPDDDYVAAGSADGSVHVWSLSKLKEQTSPILCCSWSGIGKPLASADKNGYVCTWT 515
24 -60.500[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  15  178..QYEDEERKQQQREQDQATWYHEGPDSLRIARYSLPRAKDRLVRAREALEVPSAARARMVEMQKKLQSLAPLCSQVGDTRPVSSAAFSEDSSLLLTSSWSGLCKLWSVPDCE-LKQTLRGHASYVGGVALRPGVKAMASGGHDGAVKLWGFNNEESIADITGHPHRVSKVAFHPSGRFLATACYDSSWRLWDLEQK-------TEVLHQEGHAKPVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGRCIMFLEGHLGAVFGVDFSPNGFHIATGSQDNTCKIWDLRRRQPVYTIPAHTNLISDVKYQQEGSFLVTCSYDSTTKIWSNKTLQGHDNKVISVDIAPNSQYIATTSFDRTFKLWS 550
25 -60.100[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  11  1.................MSATEL-PTKEAHILK-GHEGAVLAARFNGDGNYALTCGKDTIRLWNPHRGI--LIKTYKSHGREVRDVHVTSDNAKFCSCGGDRQVYYWDVSTGR-VIRKFRGHDGEVNAVKFNDSSSVVVSAGFDRSLRVWDCRSHSVEPVQIIDTFLDTVMSVVLTKTEIIGGSVDGTVRTFDMRIGREMSDN---------LGQPVNCISISNDGNCVLAGCLDSTLRLLDRTTGELLQVYKGHISFKTDCCLTNSDAHVIGGSEDGLVFFWDLVDAKVLSKFRAHDL-VNSIDVDFYLRKFFVAGDKRELPPEGRLYVDSCLEKMKKQQILTSIDFVIYVSNSPFFFYYR 342
26 -59.900[S] KOG0282 mRNA splicing factor  ali follow..  10  174..KTEKRKKFKENDASNIDGFLGPWAKYVDEK--DVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKKKQIHVWSGHTKGVSAVRLFPLGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKV-PYCVKFNPDEDLFVAGMSDKKIVQWDIRSG-------EIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTFKAHDKVCIGAVWHPETSKVITCGWDGLIKLWD 579
27 -59.300[R] KOG2096 WD40 repeat protein  ali follow..  14  4VLVVGIASVILGALIAVLFFGSYFRKRTSEVQS-MAKAEPQDPIRNPKSNHPAPKKNHKSQASDKNQNKRHDLNTLKGHGDAVTGLCFSSDGKSLATACADGVIRVFKLDDASSKLRINLPAGGHPTAVAFADDASSIVVGKLPLPSIKWDHHHIHEKRSVLTISGATATYGTADGSVVIASCSEGTDIVLWHGKTG-------RNLGHVDTNQLKNHMAAVSPNGRFLAAAAFTADVKVWEIKEVSRVMQLKGHKSAVTWLCFSPNSEQIITASKDGSIRVWNINVRYPLCDSGGNPLHYDRLSLCPEGKILAASH-GSTLQWLCAETEKAHEGDITCISWAPKAMVLGTSGDDKKVKLWE 447
28 -59.100[T] KOG4378 Nuclear protein COP1  ali follow..  17  1.......................................MMSNLVEPSWRLLAASGGDTVKLFDVSADSGDPLSYTPSPGCAVNSVKWNHTNLVVASTGEDKKISLWRKNGQSTGKDGGDSAEECLSAISFSKKGSRICSGGTGQIVKIWDLQRKLCIKKLKGHTSTITGVMYNCKDEHLASVSVGGDLIVHNLASGARATELKDPNGQVVQFVHVLRLLDYSRSSRLLVTAGDDGTVHLWDTTGRSPKMSLKQHSAPTAGVCFSPSNEIIASVGMDKKLYTYDSGSRRSSSCI-AYEAPFSSLAFGDNGYILVAGTSNGRVVFYDIRGKPSNSEDVTSLSWQTSKPVIVNEKNYTSEMAL. 342
29 -58.800[BK] KOG1063 RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily  ali follow..  14  187..NPGRFALALGGLDNKIKLYSGERTGKFTSVCKGHTDWIRSLDFSLPLHMLVSSSQDVIRIWKLVLVGDSVESVLIGHEDWVYSVEWQPPVISILSASMDKTMMIWRPEKKTVCVGELSHCALGFYGGHWSPNSLSILAHGYGGAFHLWRNVSSQMQKVPSGHFAAVTDVTWARTGEYLLSVSQDQTTRVFSAWKNDEGNEHELARPQVHGHDINCVAMVQGKGNHRFVSGAEEKVVRVFEAPLSPESHKLYGHGNELFSLCSDHKGNLVASSCKAQSIWLWEVGTWKAVGRLQSHSLTVTHLEFSYDDTLLLSVSRDRHFSVFSMAKVEAHKRIIWACSWNPFGHQFATSSRDKTVKIWS 724
30 -58.700[R] KOG0289 mRNA splicing factor  ali follow..  14  145AVPSSQPSVVGAGEPMDLGELVGMTPEIIQKL--QDKATVLTTERKKRGKTVP---EELVKPEELSKQVASHVGLHSASIPGILALDLCPDTNKILTGGADKNVVVFDKSSEQ-ILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKV-----TDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQDNNFEVKSLIFDQSGTYLALGGTDVQIYICKILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYS 503
31 -58.600[S] KOG1407 WD40 repeat protein  ali follow..  16  2.............EETTIPFKSLHSREY-----QGHKKKVHSVAWNSNGTKLASGSVDTARIWNIEPHSKAKDLELKGHTDSVDQLCWDPKHSLVATASGDKSVRLWDARSGK--CTQQVELSGENINITYKPDGTHVAVGNRDDELTILDVRKFKPLHRR-KFNYEVNEIAWNMPGDFFFLTTGLGTVEVLSYPS-------LKPLDTLTAHTAGCYCIAIDPKGRYFAVGSADSLVSLWDISDMLCLRTFTKLEWPVRTISFNYSGEYIASASEDLFIDIANVQTGRTVHQIPCRAA-MNSVEWNPKYNLLAYAGDDKNPKYNT---------------------------DEGVFRIFG 311
32 -58.400[S] KOG0293 WD40 repeat-containing protein  ali follow..  13  240VFHNTLDSDLSLYSDHQCGKHQIPSQ--TAQILESHTDEVWFLQFSHNGKYLASSSKDTAIIWEISADGHSLKHTLVGHHKPVIAILWSPDDRQVLTCGAEEVIRRWDVDSGD-CVHMYEKGGISPISCGWYPDGQGIIAGMTDRSICMWDLDGREKECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLFDREATV---------ERLIEEEDMITSFSLSNDNKYILVNLLNQEIRLWNIEGDPKISRYKGHKRSIRSCFGGYKQAFIASGSEDSQVYIWHRSTGKLIVELPGHAGAVNCVSWSPTNLMLASASDDGTIRIWGLDRKLVQGSSSNGVIHRCNGN............... 589
33 -58.400[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  12  46..LRGEGANLETLKDKKLKTQLASREKLYGKSA-KAAAKIEKWLLPAEAGYLETEGLETWRVKQVDILSSRNQYDIVLPDFGPYKLDFTASGRHMLAGGRKGHLALLDMMNMS--LIKEIQVRETVRDVAFLHNDQFFAAAQKKYAYIYGRDGT---ELHCLKERGPVARLRFLKNHFLLASVNMSGQLHYQDVTHG-------GMVASIRTGKGRTDVMEVNPYNSVVGLGHSGGTVTMWKPTSQAPLVQMQCHPGPVSSVAFHPNGHLMATSGKERKIKIWDLRKFEEVQTI--HSFHAKTLSFSQKGLLAAGTGSFVQILGDSMNHSMVKGYQIEKVMFRPYEDVIGIGHSMGWSSILI 408
34 -58.100[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  13  100..ILYQQYAVPADSTPDVPVDCILTKFIRTAMN-KVKCPVYSVCWSPEGKRLITGCQTEFTLWNGTAFN--FETILQAHDSAIRALKWASNEQWLLSADQGGYVKYWQPNMNN-AHMFSAHKDEAIRGLAFAPTDVKFATASDDGTARVWDFARYTEERVLRGHGAEVRCIDWHPTKGLIATGSRDTPVKIWDPKSG-------SCLATLQEHKSSVMAVEFNKNGNWLLTGGRDHLVKMYDIRMMKEMRTYRAHKKEVISLAWHPIHELFVSGGGDGSIVYWMVDGEKEIGLLHAHDQAIWSMKWHPLGHILATGSNDNNTKFWARNNMIGHLDKEREPRMAPPKPSIETQETYRPDTFIP 468
35 -58.000[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  14  4.........................................................................ILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGE-RLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALL-KTNSAVRTCGFDFGGNIIMFSTDKQMVSFFDLRDPSQ-IDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTF-RTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHY 313
36 -58.000[R] KOG0645 WD40 repeat protein  ali follow..  16  1............................................................................SGHTGRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNLVHVIDGFHTRSIRRVAWRPIERVLAVASFDSVVSINEKDDWECTAALEGHENEVKCIAWSCNGNYLATCSRDKSVWIWEATEDD----EFDCLAVLQEHTQDVKVVTWHPTEDLLVSGSYDNSICFWRDDDWALTCQLQGHTNTVWALAFSPNGNTLASADNDGNVFLWIKISSNQTSLPHIHKGAVYTISWMNDAT-LCSAGGDGKIVVYQREKHAHGVYEINSLEYLRDDR-LLSGGDDGECRVWS 320
37 -57.200[R] KOG2394 WD40 protein DMR-N9  ali follow..  16  79..TSSGYSASSGFRSATARLLGTGNGSRALSFVGNSNTSMTNTNFDGKGTYLVFNVSDAIFICDLNSQEKDPVKSIHFSNSNPMCHAFAKDGHDLLIGLNSGDVYTVSLRQQLQDVSSVNNRQDRCTSISWVPSTFPAIRDPTQFSVDKAKYSKSNPVARWHICQGSINSIAFSNDGAHLATVGRDGYLRIFDFLTQ-------KLVCGGKSYYGALLCCSWSMDGKYILTGGEDDLVQVWSMEDRKVVAWGEGHNSWVSGVAFDSNWSRFGSVGQDTQLLLWDLEMDEIIIAHRVHTEPLSGLMFTQES--VVTACREGHIKIWTNSSEANPTTALLSTSFTKDNKASLSSKIISGSTFKQ 556
38 -57.100[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  405YLCPRAKRVKLNIDAEYLIPKLPSPRDVESMVYRGHTDLVRSVSVEPKGEYLVSGSDDTVKIWEIATGRCIRTI---ETDEVVRCVAWCPNPKLIIAVATGNRLLLVNPKVGDK--VLVKKTDDLLAEAPSQDVIESERIKTAVQWSNAEADEQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGANRSALI-----QLSKRRSQIPFSKSKGLIQFVLFHPVKPCFFVAT-QHNIRIYDLVKQELVKKLLTNSKWISGMSIHPKGDNLLVSTYDKKMLWFDLDSTKPYQTMRLHRNAVRSVAFHLRYPLFASGSDDQAVIVSHGMVLQTHEFGVLDVNWHPVQPWVFSTGADSTIRLY. 783
39 -56.600[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  10  2.....AAIINQRVEQGESSMGG-AKPALLHRIT-GHVARINDVILLSKDEGVWTASDDSVRLYLKRDNDQFWPSIHHFMPVAPTSLYYSEETYKLLVGLINGNVYEFSVADDMTESRKWTCHAGPISGLGFALSSELIFSCSRDKSIVWHCSENSN---KMGSYLLENSCTAMVIDLPFVFVGDHGGHVTVLRIVDNQPNL-----VSKLSAHTNAITSLTWDGNKKVLYSGSSDHLIIMWDIGGGREAYELNGHNGKVTTLCAAPAAKRLFSADEHGKLMCWDMNCKRVETPEWKTSDCCQKCSCCDNWTTYPPMGYETKIRICNLAIPHEIHTGITAMHLQETLGLLVTSGQNRVIMIWD 403
40 -56.600[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  12  2..........................................................KIKLIDSVVRSFKVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCEKGTQS-RTVNSKKYGVDLIHFTHANNTASSTKVDDTIRYLSLHDNKYLRYFPGHTKKVISLCISPVEDTFLSGSLDKTLRLWDLRSPNCQGLM---------HLSGRPIAAYDPEGLIFAAGVNSESIKLYDLRSFDKFKLNQEKECDWTGLKFSRDGKTILISTNGSVIRLVDAFHGTPLQTFTGYPNNPIEASFSPDSQFIFSGSTDGRVHIWNADTGNDHPGPVQCVQFNPKYMMLASACTNMAFWLPT 312
41 -56.400[S] KOG0283 WD40 repeat-containing protein  ali follow..  13  320..SYLSKSVRLSKRRGAALLKNIKGVAHSMSLRADKDVSDGSTDSPKKGKDHKHGKANEVKVRPTGKSALHMCQEIQAHEGAVWTIKFSQDAHYLASGGADRVIHVWEVQECE-LMSMNEGSLTPIHPSLCDSSGNEITVVEKKKKGKGSSGRSDKPVCSLKGHLDAILDLSWSKSQL-LLSSSMDKTVRLWDIETKTCL--------KLFAHNDYVTCIQFSPDENYFLSGSLDAKIRIWSIQDRH-VVEWSDLHEMVTAACYTPDGQGALIGSHKGICRAYDTEDCKLSNKKSQAKRKITSFQFSPVNPEVLVTSADSRIRILDGSEVIRNTCSQLSASYSQDGKYIICASEDSQVYLWK 710
42 -55.900[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  11  2..............................SLHQFLLEPITCHAWNRDRTQIALSPNNEVHIYKKNGSQWVKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFEAENSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEMPFGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVSTLKTEFLPLLSVSFVSENSVVAAGH-DCCPMLFIYDDRGCLTFVSKLDIPKQSIQRNMSAMERFRNMDKRATT--NTALETLHQNSITQVSIKQDCRKFCTTGIDGAMTIWD 356
43 -55.700[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  11  282..HPTDTNIIVTCGEITSLLLDTRRKLPLIRSRTRKAKVVLCVTFSENGDTITGDSSGNILVWGKGTNR-ISYAVQGAHEGGISPLCMLRDGTLVSGGGKDRKLISWSGNYQKLRTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVW-DKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKD-------LVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVESDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQGHSSHVTNVDFLCEDSHLISGGKDTSIMQWR 715
44 -55.200[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  15  29..DPALHPFEVPREYNATKLERVFAKPFLASLD-GHRDGVNCLAKHPEKLATVLSGDGEVRIWNLTQRN--CIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETLLGSCASDRNIVLYDMRQATDMRALDTPVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYTKRMQHVICVKWTSDSKYIMCGSDEMNIRLWKANASEKLGVLTSREKAAKKFQHYPHIKRIARHR-HLPKSIYSQIQEARRRKEVNRIKHSKPGSVPLVSEKKKHV-VAV 443
45 -55.200[R] KOG2055 WD40 repeat protein  ali follow..  15  190..INQSSKLLAPGTINIKRLKDANFQA-------PSHSGIRCMSIHPYFPLLLTCGFDTLRIYQLDGKVNPLVTSLHLRSSALQTALFHPDGKRVIAAGRRKYMYIWDLESAQSRMYGQENFQPSMERFHVDPTGKYIALEGRSGHINLLHALTGQFATSF-KIEGVLSDVLFTSDGSEMLVLSYGAEVWHFNVEQRSVVRR--------VQDGVSTTHFCLDPSNKYLAIGSKSGIVNIYDLQTSKPVTTLDNITFSINSMSFSQDSQVLAIASKKDTLRLVHVPSFSVFRNWATPLGRVTCLAFGKGGE-LCVGNEAGRVGLWKLAHYD-DKIINWEIRLGKFGYVLLGIQVDVVI.... 555
46 -54.200[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  15  92..NHSDSPHQNPKPVKPRRYIPQNSERVLDAPGLRDDFSLNLLDWGSANV-LAIALGDTVYLWDASSGSTSELVTIDEDKGPVTSINWTQDGLDLAVGLDNSEVQLWDCVSNRQV--RTLRGGHESRVGSLAWDNHILTTGGMDGKIVNNDVRIRSIVETYLGHTEEVCGLKWSESGNKQASGGNDNVVHIWDRSLAS-SKQTRQWLHRFEEHTAAVRALAWCPFQASLLATGGDGKIKFWNTHTGACLNSVETGSQ-VCSLLWSQSERELLSGFTQNQLTLWKYPSMSKMAELNGHTSRVLFMAQSPNGCTVASAAGDENLRLWNVKTTKKAASKKYPELFSHVNSL.............. 443
47 -53.800[R] KOG1334 WD40 repeat protein  ali follow..  16  286..NQRGTRLASSGDDLRVIVWDWVRQKPVLNFESGHDINVIQAKFFPNCGLAMCGHDGQVRVAELINASYENTKRVAKHRGPAHELALEPDSYKFLTSGEDAVVFTIDLRQDRPVVTRENDKKVGLYTISMNPANIQFAVGGHDQFVRIYDQRRIDHHLVYCDFPTNITCVVYSHDGTELLASYNDEDIYLFNSSLSDG-AQYVKRYKGHRNNDTIKCVNFYGPRSEFVVSGSDCGHVFFWEKSSSQIIQFMEGRGDIVNCLEPHPYLPVLATSGLDQHVRIWT-PTAKTATELTGLKDVIKKNKQERDEDNLNYTDSFDNRMLRFFVQRAHQPGWRDHGAEFPDEEELDESSSTSDTSEEE 671
48 -53.500[R] KOG0646 WD40 repeat protein  ali follow..  13  2....EITVIASSSIDEGIGSWDLKTGTEQLQFK-PCASPAHGLTAVGEKQLSARNTSGSIFYWSWTKPQ---AEVKSYPVEPIKALAANNEGTYLVGGGISGDIYLWEVATGK-LLKKWHGHYRSVTCLVFSGDDSLLVSGSQDGSIRVWSLIRTLYEHNFNEHTMSVTDIVIDYGGCVIISSSEDRTCKVWSLSRGKLLKNI--------IFPSVINALALDPGGCVFYAGARDSKIYIGAINGTQVLGSVSEKGKAITCLAYCADGNLLISGSEDGVVCVWDPKSLRHVRTLIHAKGSRKGPVNNQIVRKTIVANSNKTQVSWKSRGAL--EKYERPVEDTMDGIVTVDPPPFSDVPVYS 373
49 -53.400[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  11  113..NSDGTGLLSSGEDGFVKMWSR-SGMLRSVLA-QFATAVYCVAWDSTSSNVLYCNADHCYIKSLKMQVA--PIKWKAHDGIILCCDWNPTSDLIVTGGEDLKFKVWDGFG--QILFNSSVHDYPITSISWNTDGTLFAVGS-HNILRLCD-KSGWSHSLEKMNAGSVMALSWSPDGTQLAVGTAAGLVFHAHIIDKRLTIYSSKNWNTPTMIEYNERTVNIIVQCEKIFLVSDGMTITIFTYEGRKLPPGQVMALLDERKIDLANDTLVVRDRADNKVLHFFDPTTGKAQGDGNKHEHDIVELTVNQCGRNVAFRDQIGAVHIAMVKTMVKIGSLVEQLVFNDVTNMLCGIS-EGKIAVWP 531
50 -53.300[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  10  2......NMDIGKALSDVGGLRDITSRANNSLPPTPDSSPAAPSKKHKLYDFLESRGKETPRKRIVFEKKSRPSECLMMLNQLPFCLGFANNESLLAVCTETGALELFDSRFYDRRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQTSKVFDLSTQQCITRLGYHSHSVKQVNFCNDSPNLVSCSRDGSIIFWDMRTHGKPVLRIRKAHENSGRDCSITSATWLPQSTVISSCSANSALKLWDLRTVHTVRPLSKRDFGVTNVCTSPDGERIYAASRDSIIYEYSSRHLNSKDPRLRISSFYVKLACSPDGATLACGGKTSGVVVFDTTLTGGHTKDVTAVDWSSEGQ-LASISDDGSVRVWN 464
51 -53.100[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  14  35..SPKKPYHVATTSSVRLTLYDTVVCEPLNLFS-RFKKGVCSIDFRHDGRLLAIGGDEGVRIFDVEKSSKVALRVMQASQSTVKSVHFSPRGDTVFSMADDGKIKQYRVADTAVPIIEIQAHEDAIRCGAVSSNDHIVLTGGYDHKVRLWDIRSKEKSLEL-DCEHPVESVLFLPGEQLIATAA-GPIVKIWDTTTG-------RQLTALQAHYKTVTSLRLATNSTCLLSAGIDRRVNAFRTTNYSLINSW-SMPSPVLDIDVSRDDQTMAIGMGNLLALYRRAEIKKEATASAAIEDKRSLIRTSAPPVKLVEKDRDMQKVDVVAKKIPKIDGMLSNFKHAAVIKLLRSAMDTAVVSYLR 403
52 -53.000[R] KOG1273 WD40 repeat protein  ali follow..  10  32..NHRGSLLAAGCADGGCVIWDFETRGIAKEIRNDCSAAITSVSWSKYGHRLLVSAADSLTLWDVSTGEQRSKCPESNPPFSPAAACFNKCGDLVYIGNSKGEILIVDYKSVRVLALVSASGAAPVKNIVFSRNGQYLLTNSHDRTIRIYENLLPAKNKMKTVTKMHWKAPCFSGDGEWVVGGSGEHKIYIWDRAG--------HLVKILEGPKEALIDLAWHPVHPIIVSVSLAGLVYIWAKDYTENWSAFAPDFKELENEEYVEREDEFDLIPETEKVKVLDVNEDEEVDIDTVEKDAFSDSDMSVEELRYLPAEPIPDTNDQQDNLVESIKLIEGQISASPASEEAGQNGHHASS.... 462
53 -52.600[R] KOG4227 WD40 repeat protein  ali follow..  13  18LSQRGLHGDPLLTQDFQRRRLRGCRNLYKKDLL-GHFGCVNAIEFSNNGQWLVSGGDDRVLLWHMEQARVKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETL--DVFAHEDAVYGLSVSPVNNIFASSSDDGRVLIWDIRESPHGECLANYPSAFHSVMFNPEPRLLATANSKEGVGLWDIRKPQSSLL----RYGGNLSLQSAMSVRFNSNGTQLLALRRRLPPVLYDIHSRLPVFQFDFNSCTMKSCCFAGDRQYILSGSDDFNLYMWRIPANGAFMVLKGHRSIVNQVRFNPHTYMICSSGVEKIIKIWSTGDLDGRIEDDSRCLYTHEEISLVLNSGSGLSHDYA 405
54 -52.400[A] KOG0299 U3 snoRNP-associated protein (contains WD40 repeats)  ali follow..  14  147.VVAYENFVYSADKSGLIQKWEALQEKDTENRE-NDDHEIGKAIKLHFR----------------PIKFSRSRRGENDHVKEITCLAISNDGRWIVTGGLDHRIVIRDSVTLEPQ-HCWKHHRDAVMGLAMRRGTNEMFSCSADRSIKVWSLDQMSYIETLFGHQDVIFGVDALARERCVSVGGRDRTSRLWKIVEESQLVSGGTSMKATAGYMEGSVDCVAMIDEDHFVTGSDNGVIALWSVQRKKPLVTIPPQPRWITSLAAIPYSNLFASGSWDGNIRLWKIAEGLRSFEPLSVYGCINSLSLSLQGKVFAACGRETRVGRWKTLRGIVFNIPLTVIPSVTDGDEIDE........... 524
55 -52.300[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  13  3FFNRSNTTSALGTSTAMANEKDLANDI---VINSPAEDSISDIAFSPQQDFMFSASDGKVRIWDVQNGV-PQGRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQ--TQQIGMHSAPIKVLRFPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPER-VYSMDNKQSLLVVATAERHIAIINLANPTTIFK-------ATTSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDGMQKSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQRHRLKGYPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNRPDYPNVATTDEEVKEKKK............... 364
56 -52.200[S] KOG0281 Beta-TrCP (transducin repeats containing)/Slimb proteins  ali follow..  13  133LIERMVRTDPLWKGLSESRGWD-------QYLFKNRPTDGPPNSFYRSLYPKIIQDIETISNWRCGRHNLQRIQCRSENSKGV--YCLQYDDEKIISGLRDNSIKIWDKTSLE-CLKVLTGHTGSVLCLQY--DERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGL--MVTCSKDRSIAVWDMASAT----DITLRRVLVGHRAAVNVVDF--DDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQY--RDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRF--DNKRIVSGAYDGKIKVWDLQTLVEHSGRVFRLQF--DEFQIISSSHDDTILIWD 484
57 -51.900[I] KOG0301 Phospholipase A2-activating protein (contains WD40 repeats)  ali follow..  12  1.......MADDGLGDVPMETESMPQYTISHVIE-AHKSDTKALAVTQGGCLISGGRDETVKFWAKKGKQTKTHAFEQPKGITVNSIAYAEDGWRLFVGRRDGTIAVFGPSQAEPY-AIFNEHKQNVCCLHINEKATHMLSGSWDSNVIIWPITESFTTIVCPGHTLSVWALASFPDLNTYLSASADKTIRMWFGDT---------TLSVFKGHTDVVRALVVLSSSH-FLSAGNDGHIIHWDVASASILRKFATQAHEF-IYSMTLSDSHILTTGEDGTLEFWAIDGGKSEAVIQLPTTNTWDAKVLLNSD-IAVAGSDGRIYIMTTDILDAFDAEVVAKLTAKTERMKQEEHETVTIKVD. 363
58 -51.200[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  13  26..SNNSDHLLVSSWDKRVRLYDVSTNSLKGEF--LHGGAVLDCCFHDDFSGFSVGADYKVRRIVFNVGKEDILGFDFSILFFYTLCLFCDVTGQVITGSWDKTVKCWDPRGASGPERQVGTYLQPERVYSMSLVGHRLVVATAGRHVNIYDLRNMSEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEAAQAKKRKSEAGRDIVYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRLYQYSKYPTSISALSFSRDGQLLAVASSYTAIFVRSVNEIEVKPKPKVYPNPAA............................................................ 354
59 -51.000[R] KOG2321 WD40 repeat protein  ali follow..  11  17SGEGVTQRLPNWISKRKLKKDYALSHRIELLQDFEYPEASNRIKCTRDGKYAMATGKPHIKVFDFAEMS--LKFERHTDAENVQFEILSDDWTKSVHLQTDRTVDFHSQGGIHYSTR----IPKYGRDLKYHYPNCDLYLAAAGDEVYRLNLEQGRFLNPLKSPTGGVNVIDINPMHQLLAFGTDAGSVEFWDPRDRSREIPSTVPSTPYSDNSRSVTALKYRNDGLNVAIGLSDGATLLYDLRSSSPYMSDQGYSMPIKSLHWMDDGTARVLSADSKIIKIWEKDTGKPFSSI-EPTVELNDVCPIEGTGLILTANEGSPMHAFYIPSLNFLDNITEEMEENPDDYKFVTKKELLNLGLDH 400
60 -50.900[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  15  1................................................................MSAVCGGAARMLRTPGRHGYAAEFSPLPGRLACATAQGTLLILDPDEAGLRLFRSFDWNDGLFDVTWSENNEVLITCSGDGSLQLWDTAKAGPLQVYKEHAQEVYSVDWSQTRGLVVSGSWDQTVKLWDPTVG-------KSLCTFRGHESIIYSTIWSPIPGCFASASGDQTLRIWDVKAAGVRIVIPAHQAEILSCDWCKNENLLVTGAVDCSLRGWDLRNRQPVFELLGHTYAIRRVKFSPHASVLASCSYDFTVRFWNFSTVEHHTEFTCGLDFSLQSPQVADCSWDETIKIYD 315
61 -50.400[R] KOG2919 Guanine nucleotide-binding protein  ali follow..  13  101..APVLQYFQGALVELGRRCWTSSTE---------AQHYTKGCYWSPDGTCLLVPVHLGMHVIEMPSDTKLQSEVHVPEGGTVYDCVWYPHMNLWLATRQHEPIHMWDAFDGSLRCSDAVDEVMAAISLAFSHDGEQIYAGY-KRCIKIFDTSRPGRFCDDYPVKFAISCIAQTTAHPTLTCGNWHGYIQHFDLRCSHKQ----GPLFTLGGHKGGITQLRYGEFGNLFSGARKCDKILQWDMRNKQPLVELQRHVDTNQRIQFDSDSNWLASGDTRGFVNVWDLKKYGDPSVLPLHSDCCNGVALNPAMPILATSSGQFHFTD-GDNVTLNGTETTELPAPADVNQNQKEVLYENAVVMWW 482
62 -50.000[T] KOG1354 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  11  1........MAGAG-GGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGRVVIFQQEQENKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRMVEASPRRIFANAHTYHINSISINSDYETYLSAD-DLRINLWHLEITDKPANMEELTEVITAAEFHPNSNTFVYSSSKGTIRLCDMRASALEPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRD-YLSVKIWDLNMNRPVETYQVHEY-KFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSL----DFNKKILHTAWHPKENIIAVATTNN-LYIFQ 443
63 -50.000[U] KOG1332 Vesicle coat complex COPII, subunit SEC13  ali follow..  20  3..........................SVINTVDTSHEDMIHDAQMDYYGTRLATCSSDSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPGNILASCSYDRKVIIWREENGTEKSHEHAGHDSSVNSVCWAPHGLILACGSSDGAISLLTYTGEEVKKINNAHTIGCNAVSWAPAVKRFASGGCDNLIKLWKEEEDGQ-----KEEQKLEAHSDWVRDVAWAPSTSTIASCSQDGRVFIWTCDDASSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDVCISDVNKGQGSVSSVTEGQQNEQ.................................................. 322
64 -50.000[R] KOG4497 Uncharacterized conserved protein WDR8, contains WD repeats  ali follow..  14  17..SPDGKYLASCV-QYRLVVRDVNTLQILQLY--TCLDQIQHIEWSADSLFILCAMYKRVQVWSLEQPE---HCKIDEGSAGLVASCWSPDGRHILNTTEHLRITVWSLCTKS--VSYIKYPKACLQGITFTRDGRYMALAERRDCVSIFVCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAVWDTCLEYKILLYSLDGRLLSTY----SAYEWSLGIKSVAWSPSSQFLAVGSYDGKVRILNHVTWKMITEFANPKMGIGMLAFSPDSYFLATRNDNNAVWVWDIQKLR-LFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSVQVPGEGDFAVLSLCWHLSGDSMALLSKDHFCLCFL 443
65 -49.400[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  12  24..ILEEAVRSKITKDQDDDDDDGSSSSSYIVLSGGGGE---GRSGIPNVILICRVDLHTNSL------SEQPIGRRVIGTDLPYRMAIHPRQGGLICAL-PNSCRLFDWEEESEKVVKELKDVGQQLSLSFNQDGTVLATGAEDGTLRVFEWPSMKTLLNESKTHASVKSLTFSESGKFLVSLG-APLCRVWDVNASAAIASLS------KEKDEMFASCRFSVDNSVAANTQRGGSIITWDTTSWRRRSSLIKRNNSISAFNVSADGKLLAVGTLEGDVLIIDSTKMQTNQIVKAHLGLVTALTFSPDSRCLVSVSFDSRARLTVIKQKGWVAALLFVLVYVVLYYLMVAMGIIH...... 383
66 -49.400[S] KOG0294 WD40 repeat-containing protein  ali follow..  10  2...PPEMEIIEATNEELLLGFKLIKSPTLKQTFADSSYARSITSLAVQWPWVASGGTDRIFVYDMRTR--KQSQIILSHAGRVNTLKFTPDLSLLLSGSDDGHMIATRVGSWTKEYDWQKAHAGAVTHVSCHPSSKLALSLGGDQVLNTWNLVNGCVAHKTNTLDFQTGCLSWSKQGDHFTLSG-PLVLEIWGIENAHVMRRI--------EMPSKPICITWL-DGNECLTGLDNGNIAWISLKDEDPPTFILAHEVRVKAIAYL--NEFLATVSIAGQIKVWKIDMETRKLEEIARSFMPTDLGLLDLRQFGNVRPVEQRTKVEEKPKAKAAPRGFVTIEYEQDKKLDAEKKKEKKKNKKD 377
67 -49.200[BL] KOG1009 Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats)  ali follow..  15  7..............................EIAWHNKEPVYSLDFQHGTARLASAGVDTVRIWKVEKGPDEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWKVNDNKTVVKTLRGHLEDVYDICWATDGNLMASASVDNTAIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYVATLSCDRVLRVYSIQKKRVAFNVSKMLSGIDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTTRPIAHLPCPGKATLAVRCCPYRLVFAVASEDSVLLYDTQQSFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCSFVTFEKDE-KEKPVLNMRTPDTAKKTKSQTHRGSSPGPR 414
68 -48.900[DK] KOG0973 Histone transcription regulator HIRA, WD repeat superfamily  ali follow..  12  2..............................TFVGHDTGSILAIDCHPSGKKFITCGNGLVVVWNAENENVPKLLFQVESQSQSNSCRWSPDGKRFAFGSDDSSVSVWEYVGLINECCVLRGHSMEVLTVEWSPNGKYLASGSIDYRIIIYNARKPDRITVLNDIQLPVKGLSWDPIGKYLASLEGDKKLRFWATDSWQ-CVKSVTEPFESNIEETMLTRLDWSPDGKYLMTPAAVRLIKLIQRQTWKSDQFLAGHHKGTTCVRAMPQLTCAAVGSRDKSISIWVFPGTLKPLFVINNIFNHTVMDFAWCGRNLLACSQDGTVKVIHLSSNEAMSDLCYQIYSIRPPRYELTDKEEDESQ... 386
69 -48.900[R] KOG0322 G-protein beta subunit-like protein GNB1L, contains WD repeats  ali follow..  13  2.....................AVLPPDPVFSLRSPDMGAVNSLCFQESDRLLAGTIKGSVFLWDLQTN--RSALHFEVGSDPITSLHHTPDR--LVTQEKGGTITMFSIGGSSYVGNHLGFCRSALHTNTSKTNEQLLFYPCEESSIGVLHVTDAAAPTQILVPDDPCFKPFECASQLFLLAGYESGHFLTWDISSSV--------ILDVMELAQDATSVDYDPVTNRGIVGGPTDKLISFSYQRSQLGSELCIKNPGVNGVRIRPDQKVFASAGWDGRIRIFSWKSLRPLAVLTQHKNGVMDLAFSSQQVA------------------------------MWHAPIMAAAGMDGQISLWD 320
70 -48.700[R] COG2319 FOG: WD40 repeat  ali follow..  10  156VASEKDNKGKLNEKKNRSPENLLPFRILDAPEL-RDDFYTSLLSWSPKGD-LAIGLAENIYLWSKELGP---TRVLEESIYDVSSVAYSYNGDILAVGRVDGTLQFWQDNERVP--RISIHHPGDIGVLAWKPETNRLLVGKGNGNIFVYDIIAVLVATITNAHDEQVCGLTWNHDGSQFASGGNDNRVCLFKGSDL-------RQPLYVWQQNAAVKALSFCPWQRSLLATGHDKHIRFYNCFNGKKIDELYCGAQ-ITSIHWSPKYREFSVTTVQHRFAVYSWPQLECLVSVLPPDIRCVHSVLTSQTDSIIIASSNETIKFFDLRVLTWHGIFDSQILEMLEG---IDGKIDSHLR... 535
71 -48.400[S] KOG4328 WD40 protein  ali follow..  13  181..YVNKEFSIPVKPEKIEFDLDLLTLEPQNVAR-VVPGRIFVVQFLPNVKMVAAGDLGNVGFWNLDCGDNDGIYLFTPHSAPVSSIVFQQNSSRVISSSYDGLIRLMDVEKSV--FDLVYSTDEAIFSLSQRPNDQSLYFGQDYGVFNVWDLRAGKSVFHWELHERRINSIDFNPQNPVMATSSTDGTACLWDLRSMGAKKPK---TLSTVNHSRAVHSAYFSPSGLSLATTSLDNYIGVLSGANFENTCMIYHNNTSKFKAVWGWDDSYIYVGNLSKKIDVINPKLKRTVMELHNPRAIPCRIHCHPNVGTLAGSTAGGQVYVWTTK.................................. 516
72 -48.100[Z] KOG0313 Microtubule binding protein YTM1 (contains WD40 repeats)  ali follow..  12  56..LIKGQFLRMPLDKHEIEYVEKCTAPQPEQCM-FHDDWISSIKGAEEWILTGSY-DKTSRIWSLEG---KSIMTIVGHTDVVKDVAWVKKDSLLLSASMDQTILLWEWNVERKALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEESTNRPRKKQKTEQLG-----------------------LTRTPIVTLSGHMEAVSSVLWSDAEE-ICSASWDHTIRVWDVGSGSLKSTL-TGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDVSLSLTSHTGWVTSVKWSPTHQQLISGSLDNIVKLWDTRDLAAHEDKVLSVDWTDTGL-LLSGGADNKLYSYR 413
73 -47.400[YU] KOG2445 Nuclear pore complex component (sc Seh1)  ali follow..  14  3.........................................................................PFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTELSDSWRAHDSSIVAIDWASPGRIIASASYDKTVKLWEEDPDNKLCTLNDSKGSLYSVKFAPAGLKLACLGNDGILRLYDALEPSDTSEMKVLSIPPANHLQSDFCLSWCPSRFEKLAVSALEQAIIYKDGKLHVAAKLPGHKSLIRSISWAPSYQLIATGCKDGRIRIFKITEKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNTEEKALSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWK 332
74 -47.000[T] COG5170 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  1.......MDDIEDSLDQWKFAQCF-GDKGDVEDITEADIISAVEFDHTGDYLATGDGGRVVLFERNHSKKGCYLKSLEIEEKINKIRWCKRTNHFLLSTNDKTIKLWKLYEKNLKVVAENNLSDSFHSPMQGPLTTPSQLRLPRLNHHDMIIAAYPRRVYANAHAYHINSISVNSDAETYISAD-DLRINLWNLSISDHSFNIVDIKENMEELTEVITSAEFHPNCNHLMYSSSKGNIKLLDLRQSASKSFFSEIISSISDVKFSQNGRYILSRD-YLTLKIWDVNMKAPVKTIPLHDVDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLDYNKKILHASWHPFEDSVAIAATNN-LFVFS 461
75 -46.900[S] KOG2110 Uncharacterized conserved protein, contains WD40 repeats  ali follow..  11  2......................................HFFVRKYRGKAALLSIGTFDGYKIYNCDPFG--KCFHKIQGATSIVEMLFSTSLVALVEKDDGNNRKLKLINTKKSTTICELTFPTPLLAVKLNRKRLLAVLEEQVFAVCALSPNSENCYLAYPDSRDHEPRTEGESSSPNVSNSAVSGQVILWDVINC-------KQITKIEAHKDSLACLAFNSDGTMLATASDNGRIRVFAIPSGQRLYQFRSLPAQIYSIAFHPDSSLLTVTSSTQTVHIFRLKEVYSNLERQGLLPSSPPPKESLLRRSSRSLIGTVGGYLPQAYAHIPGDKVTSIAAFGPDNTIVNVATYDGNLYSFR 351

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhao Y, Hong DH, Pawlyk B, Yue G, Adamian M, Grynberg M, Godzik A., Li T. The retinitis pigmentosa GTPase regulator (RPGR)- interacting protein: subserving RPGR function and participating in disk morphogenesis. Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3965-70. Epub 2003 Mar 21.