current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [S] KOG0316 Conserved WD40 repeat-containing protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# Score Template Links and tools%idFirst MSATELPTKEAHILKGHEGAVLAARFNGDGNYALTCGKDRTIRLWNPHRGILIKTYKSHGREVRDVHVTSDNAKFCSCGGDRQVYYWDVSTGRVIRKFRGHDGEVNAVKFNDSSSVVVSAGFDRSLRVWDCRSHSVEPVQIIDTFLDTVMSVVLTKTEIIGGSVDGTVRTFDMRIGREMSDNLGQPVNCISISNDGNCVLAGCLDSTLRLLDRTTGELLQVYKGHISKSFKTDCCLTNSDAHVIGGSEDGLVFFWDLVDAKVLSKFRAHDLVNSIDVDFYLRLLKFFVAGDKRELPPEGRLYVDFFGRWYNSCLEKMKKQQILTSIDFVIYVSNSPFFFYYRLLast
1 -95.500[S] KOG0316 Conserved WD40 repeat-containing protein  ali  100  1MSATELPTKEAHILKGHEGAVLAARFNGDGNYALTCGKDRTIRLWNPHRGILIKTYKSHGREVRDVHVTSDNAKFCSCGGDRQVYYWDVSTGRVIRKFRGHDGEVNAVKFNDSSSVVVSAGFDRSLRVWDCRSHSVEPVQIIDTFLDTVMSVVLTKTEIIGGSVDGTVRTFDMRIGREMSDNLGQPVNCISISNDGNCVLAGCLDSTLRLLDRTTGELLQVYKGHISKSFKTDCCLTNSDAHVIGGSEDGLVFFWDLVDAKVLSKFRAHDLVNSIDVDFYLRLLKFFVAGDKRELPPEGRLYVDFFGRWYNSCLEKMKKQQILTSIDFVIYVSNSPFFFYYRL 343
2 -72.400[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  16  450RKTWNP----KFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWNTTEVAPALSVKELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLSSCQINRVISHPTLSISITAHEDRHIKFYDNNTGKLIHSMVAHLEA--VTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHESIHDVAFHPSKC--YIASAGADALAKVF............................................. 779
3 -71.200[S] KOG0293 WD40 repeat-containing protein  ali follow..  19  257CGKHQIPSQTAQILESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADSLKHTLVGHHKPVIAILWSPDDRQVLTCGAEEVIRRWDVDSGDCVHMYEKGGISPISCGWYPDGQGIIAGMTDRSICMWDLDGREKECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLFDREATVERLIEEEDMITSFSLSNDNKYILVNLLNQEIRLWNIEGDPKISRYKGHKRSRFIRSCFGGYKQAFIASGSEDSQVYIWHRSTGKLIVELPGHAGVNCVSWSPTNLHM-LASASDDGTIRIWGLDRINQQNQK-----------KKLVQGSSSNGVIHRCNGN.... 589
4 -70.400[R] KOG0286 G-protein beta subunit  ali follow..  16  37LEVVGRQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREVSRELSAHTGYLSCCRFLDDNN-IVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHEINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESIICGITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNVSCLGVTADGM--AVATGSWDSFLKIWN............................................ 340
5 -69.500[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  15  1MGTKRPNNSVILAQEAKRSKNDLMAYTNRDKALLESGVRRTSNLQAP-----IMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLSGSDDRTIKIWDARKKHAAHTLESPQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDT--ITGMSLSPEGDFILTNAMDNTLRVWDVRGERCVKVFQGHKNLLRCAWSPGSD--KITSGSADRHVYIWDVNTRRILYKLPGH-NGSVNAVDFSPKEPLILSGSSDKTLYLGEI 345
6 -69.200[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  18  3IKLID-SFKVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCEKGTQSRTVNSKKYGVDLIHFTHANNTASSTKVDDTIRYLSLHDNKYLRYFPGHTKKVISLCISPVEDTFLSGSLDKTLRLWDLRSPNCQGLM--HLSGRPIAAYDPEGLIFAAGVNSESIKLYDLRSFDKLNQEKECDWTGLKFSRDGKTILISTNGSVIRLVDAFHGTPLQTFTGYPNNKIPIEASFSPDSQFIFSGSTDGRVHIWNADTGNKVSVLNGDGPVQCVQFNPKYM--MLASACTNMAFWLPTSEEG........................................ 316
7 -68.300[S] KOG0282 mRNA splicing factor  ali follow..  22  271PEKCYLPKKQIHVWSGHTKGVSAVRLFPLGHLLLSCSMDCKIKLWEVGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNR-KVPYCVKFNPDEDLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYISMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKCIGAVWHPH-ETSKVITCGWDGLIKLWD............................................ 579
8 -67.500[S] KOG0295 WD40 repeat-containing protein  ali follow..  17  46GGILEKKTTVLRLQRKVNDLESKLQESQREINHGAPTRDKRQAADWIPRPPETQKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYETGQLERTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLWDFQTYDCLKSLKGHEHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTFRGHNVRMIRISNDGTLFASASLDQTVTVWSFATKSAKLVLRDHEHTNVTGQQPEGNSTHILFSGSRDRSIKAWNINTGDVLFTLLAHENVRGLAFHPKGK--YLISVADDKTLRVWELSAQRCMKAIEAH-EHFVSTVAFHQTSPFVITGSVDMSCKVWEC 403
9 -67.100[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  17  312.....LPSVCMYTFHHTNNNMNCAEFSPDSTMIACGFQESYIRLWSIKDSDGSVRLLSHSGPVYGTTFSPDNKYLLSCSEDASARLWSVDTKTALVAYKGHTGPVWDVAFGPFGHYFATASHDQTAQLWSCDHIYPLRVFAGHLSDVDCVTFHPNSAYVLTGSSDKTCRLWDVHRGHSVRVFNGHPVTAVAIAPDGHTMASADSEGLIHLWDIGTGRRIKTMRGHRGN--IYSLSFSRESTVLVSGGSDCTVRAWDVFKTNYNNPVSSSTGSVVTPFSAKTSTFNEVNWSTSPD-----------------------QMVALYTKQTPIFNVSFTRRNLCLA. 639
10 -67.100[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali follow..  16  166....EIPPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSEGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTE-NGNLASTLGQHKGPIFALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMT-FASCSTDMCIHVCRLGCDHPVKTFQGHTVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKE--IYTIKWSPTGPMLASASFDSTVRLWDVEQGVCTHTLMKHQEVYSVAFSPDGK--YLASGSFDKYVHIWNTQSGSLVHSYQGT--GGIFEVCWNARGDKVGASASDGSVCVLDL 522
11 -66.400[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  13  43DTMNNMMDMSVQGFFEHKDSVFSVSINPVHNLCASGGGDDLGYIWDITTGEQICQLTGHKDSIVAIDWSFDGTYIATGGMDSQVRLWKSSTGFEFITAFETVDEIVWLSWHPKGLFLAAGCNDGSIWMWSLPSGKVVQVMYGHTAPVNAGKFIPPGKRLATVDDSGTLIVWNPATGAPECRMTAAGWTSFDCNAEGNVLFLGGSSGKVKVVNINSSHILASLEAQTES--VEAIALCTALPICACASVDGTVALYDSASLKFRKSLPHEQAVIDCKFLPNTP--YLLTACADCVIRKWDVRSGQLLGEYTGHQEP-ILCMAITPDGKRVVTGSDDTELLVFDC 397
12 -66.300[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  17  5............LLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALL-KTNSAVRTCGFDFGGNIIMFSTDKQMVSFFDLDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERP---VNSAALSPNYDHVVLGGGQEAARFFHLAFEEEFGRVKGHGPINSVAFHPDGK--SYSSGGEDGYVRIHYFDPQYFEFEFEA................................ 325
13 -66.300[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  19  94......VTRCSASIPGHGEPVISAQFSPDGRGLASGSGDQTMRIWDIELELPLHTCKSHKSWVLCIAWSPDATKIASACKNGEICIWNAKTGEQIKTLKRHKQWITSLAWQPTCRLLASCGKDGNIFIWDTVQGTVVRCLSGHTASVTCLRWGGEGL-IYSGSQDRTVKMWRADDGVMCRNMTGHAINTLALNTDGERLVSGSDDFTLFMWNPETKQSINRMTGHMQL--VNQVVFSPDTRYIASASFDKSVKLWCGRTGKYLASLRGHGPVYQVAWSADSR--LLVSGSADSTLKVFELKTKSLYYDLPGH-GDEVFTVDWSPEGTKVVSGGKDKVLKLWR. 472
14 -65.700[A] KOG0285 Pleiotropic regulator 1  ali follow..  19  151RPEWHAPWKNYRVLQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATGVLKLTLTGHIGQVRGLAVSNRHTYMFSAGDDKQVKCWDLEQNKVIRSYHGHLHGVYCLALHPTLDVVLTGGRDSVCRVWDIRTKMQIFVL-PHDSDVFSVLARPTDPQVITGSHDSTIKFWDLRYGKSMATITNHKVRAMALHPKENDFVSASADNIKKFSLPKGEFCHNMLSLQRD--IINAVAVNEDGV-MVTGGDKGGLWFWDWKSGHNFQRAETEAGIYAACYDQTGS--RLVTCEGDKTIKMWKEDED---------------------ATPETHPLNFKPPKEIRRF 477
15 -65.300[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  17  19.......IIRDEHEYSNRSAVSALQYDAQNGRLFTGGSDTIIRTWSVPHHKDAGSLEQHTDWVNDMILCGHGKILISASNDTTVKVWNIERDNFIDCIRTHKDYVSCLAYAPIVEKAVSASFDHNIFVYDINANKTVNNLIGCKDSIYSLATTPNLSLVLGAGTEKCIRLFDPRTNEKIMKLRGHTVRALVVNDDGTRALSAGSDATIRLWDIGQQRCIATCIAHEEG--VWTLQVDSSFTTVYSAGKDKMVVKTPLYDFTKSQLLFKEEAVKKLLLSEKDNPVSLWVGTWKSDIKRWSIRPSAQLSIGGDEDGPAIKKHAMLSDKRHVLTRDSDGNVALYDV 420
16 -65.000[S] KOG1407 WD40 repeat protein  ali follow..  16  7....PFKSLHSREYQGHKKKVHSVAWNSNGTKLASGSVDQTARIWNIESKAKDLELKGHTDSVDQLCWDPKHSDVATASGDKSVRLWDARSGKCTQQV-ELSGENINITYKPDGTHVAVGNRDDELTILDVRKFKPLHRR-KFNYEVNEIAWNMPGDFFFLTTGLGTVEVLSYPSLKPLDTLTAHTCYCIAIDPKGRYFAVGSADSLVSLWDISDMLCLRTFTKLEWP--VRTISFNYSGEYIASASEDLFIDIANVQTGRTVHQIPCRAAMNSVEWNPKYN--LLAYAGDDKNPKYNTDEGVFRI..................................... 309
17 -64.200[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  15  299........ADEPRKEQRDVQLTAANYNTRTKVLVVAFSSGAFYLYELPDVNMIHSLSISDYPISAALFNCTGDWVALASREGQLLVWEWQSEQYIMKQQGHSSEMTCIAYSSDGQFIATGGEDSKVKLWNTQSSFCFVTFSEHTSGVTGIQFSRNKKFLVSSSLDGTVRAFDVNRYRNFRTFNPAQFSCVAVDYSGELVVAGGQDFDIFLWSVKTGKLLEIISGHEGP--VVSIAFSPTSSTLVSGSWDKTVKIWNCLESNSEHETIDASDVTNVTFSPSGE--EIAVATLSGNITIFDIKSAGQVTTIEGRNANYFSTIEYSADGECILAAGKSANICIYHV 656
18 -63.900[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  14  2....PLRLEIKRKLAQRSERVKSVDLHPTEPWILASLYSGTLCIWNYQTQVMAKSFEVTELPVRSAKFVARKQWVVAGADDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGACTQIFEGHSHYVMQVTFNPKDTNFASASLDRTIKIWNLGSPDPNFTLDAHQVNCVDYFTGGDYLITGSDDHTAKVWDYQTKSCVQTLEGHTHN--VSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGERVWAIGYIKSSR--RVVIGYDEGTIMVKLGREIPVASM--DNTGKIIWAKHNEIQTANIKSIGADYEVTDGE. 340
19 -63.900[T] KOG0279 G protein beta subunit-like protein  ali follow..  19  4......GLVLKGTMCAHTDMVTAIATPVDNDVIVTSSRDKSIILWKLTKGVAQRRMTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKLWNTLGECTISEADGHKEWVSCVRFSPNTLTIVSASWDKTVKVWNLQNCKLRNTLAGHSLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSI---IHSLCFSPNRYWLCAAT-ENSIRIWDLESKSVVEDLKVDIYCTSLNWSADGN--TLFSGYTDGVIRVWGIGR......................................... 325
20 -62.500[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  14  389VELYSLVRTSRITIGGHRSDVRTLSFSSDNIAVLSAAAD-SIKIWNRSTLQCIRTMTCEY--ALCSFFVPGDRQVVIGTKTGKLQLYDLASGNLLETIDAHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKDENSTLQLDEDVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLKFFLSLYGHPVICMDISHDGALIATGSADRNVKIWGLDFGDCHKSLFAHDDS--VMYLQFVPKSHLFFTAGKDHKIKQWDADKFEHIQTLEGHQEIWCLAVSPSGD--YVVSSSHDKSLRLWERTREPLILE-REMEREAEYEESVAKEDQPAVPGETQGDSYFTG. 747
21 -62.000[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  16  2............SLCGHTSPVDSVAFNSEEVLVLAGASSGVIKLWDLEESKMVRAFTGHRSNCSAVEFHPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHTRGISTIEFSPDGRWVVSGGLDNVVKVWDLTAGKLLHEFKCHEGPIRSLDFHPLEFLLATGSADRTVKFWDLETFELIGTTRPEAVRAIAFHPDGQTLFCGLDDG-LKVYSWEPVICRDGVDMGWS---TLGDFCINEGKFIGCSYYRNSVGIWVSDISELEPSEDKNECVKRFSVLNDQSERMLNVAQNPGSLKATLPLESGKVATMVSEKQNAASSTSRDSDSGEESSYSERESIPFSR. 371
22 -62.000[R] KOG0288 WD40 repeat protein TipD  ali follow..  24  212DHFVEIPSTCANRIHAHEGGCGSIVFEYNSGTLFTGGQDRAVKMWDTNSGTLIKSLYGSLGNILDMAVTHDNKSVIAATSSNNLFVWDVSSGRVRHTLTGHTDKVCAVDVSKFSRHVVSAAYDRTIKLWDLHKGYCTNTV-LFTSNCNAICLSIDGLTVFSGHMDGNLRLWDIQTGKLLSEVAGHSVTSVSLSRNGNRILTSGRDNVHNVFDTRTLEICGTLRASGNASNWSRSCISPDDDYVAAGSADGSVHVWSLSKGNIVSILKEQTSILCCSWSGIGK--PLASADKNGYVCTWT............................................ 515
23 -61.100[S] KOG0281 Beta-TrCP (transducin repeats containing)/Slimb proteins  ali follow..  18  186ESNWRCGRHNLQRIQCRSENSKGVCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQY--DERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGL--MVTCSKDRSIAVWDMASATDITLRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRF----DNKRIVSGAYDGKIKVWDLQSTLCLRTLVEHSGVFRLQFDEF----QIISSSHDDTILIWDFLNVPPSAQNETR-------------SPSRTYTYIS........ 507
24 -61.100[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  12  10.KFLSRKQETILLDEDEPAVVSSVRISPKKPYHVATTSSVRLTLYDTVVCEPLNLFSRFKKGVCSIDFRHDGRLLAIGGDEGKVRIFDVESKVALRVMQASQSTVKSVHFSPRGDTVFSMADDGKIKQYRVADTAYIIEIQAHEDAIRCGAVSSNDHIVLTGGYDHKVRLWDIRSKEKSLELCEHPVESVLFLPGEQLIATAA-GPIVKIWDTTTGRQLTALQAHYKT--VTSLRLATNSTCLLSAGIDRRVNAFRTTNYSLINSWSMPSPVLDIDVSRDDQ--TMAIGMGNLLALYRRAEIKKEATASAAIEDKRSLIRKIPKIDGMLSNFKHAAVIKL... 384
25 -61.100[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  13  16EILYRLMISQL-MYDGLEKFAMELSMLVKADQCAPSERLLHVMIAGMQTSYETAYVTSHKQACRAGAFSCDGSLVATGSVDASIKILDVERMPVIRTLYDHTDEVSYLEFHPKEHILASASRDGTVKLFDIAKPSVKKAVFTDCEPVLCLSFHPTGDYVAIGTEHNVLRVYDVATTQCFVSAHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRCINTIAEAHGGAAICSLEFTRNGKYLLSSGMDSLVYLWELCTSRPIQTYTGAGTTEAVFNHTEDY--VLFPDEATTSLCSWNSRNGCRLTLNSLGHNGPVRYITHSPNGPAFLTCSDDFRARFWYR 419
26 -60.900[R] KOG0645 WD40 repeat protein  ali follow..  15  1..............SGHTGRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNLVHVIDGHTRSIRRVAWRPIERPLAVASFDSVVSINEKDDWECTAALEGHENEVKCIAWSCNGNYLATCSRDKSVWIWEATEDDCLAVLQEHTQDVKVVTWHPTEDLLVSGSYDNSICFWRDDGDDCQLQGHTNTVWALAFSPNGNTLASADNDGNVFLWIKISSNQTSLPHIHKGA--VYTISWMNDAT-LCSAGGDGKIVVYQREKHDYEQDHAHGYEINSLEYLRDDR---LLSGGDDGECRVWSFK.......................................... 322
27 -60.300[R] KOG0289 mRNA splicing factor  ali follow..  17  125....TAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLSASIPGILALDLCPDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGP--ITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQNNFEVKSLIFDQSGT--YLALGGTD--VQIYICKQWTEILHFTEH-SGLTTGVAFGHHAKFIASTGMDRSLKFYSL 504
28 -60.200[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  11  258VKEFVITAKLVRKKRIASSNLDHLAYDVVSNRFLAISAEQNLIILDFENLKIARQIVGHDEIYSCCLLGKDESHMAVASNTSEIRLYNTKTLDCQLIRGHTESVLSVVSPTWDTSLLASCSKDNSIIFWRLSTLVPVAAATGHANTVTALAISNTGRALASVSTDCTIKLWGLGVSTKLKEVHGKDVNCVDISESDALIATGGMDKLVKLWQVDTHKIAGTLSGHRRG--VGDVKFAKNSHKLASCSGDMTIKIWNISEKSCLQTISGHCAVFRVIFARNDS--QLISADSAGIIKIWTIKTADCECSIDAHTDK-IWSLSKNHNESEFVTAGTDGRIVVWK. 635
29 -60.100[R] KOG1334 WD40 repeat protein  ali follow..  18  268........RLQYLLGSHAGSVSTIHFNQRGTRLASSGDDLRVIVWDWVRQKPVLNFSGHDINVIQAKFFPNDSTLAMCGHDGQVRVAELINAENTKRVAKHRGPAHELALEPDSYKFLTSGEDAVVFTIDLRQDRVVTRENDKKVGLYTISMNPANIYFAVGGHDQFVRIYDQRRIDLVYCDFPTNITCVVYSHDGTELLASYNDEDIYLFNSSLSDYVKRYKGHRNNDTIKCVNYGPRSEFVVSGSDCGHVFFWEKSSSQIIQFMEGDDIVNCLEPHPYLP--VLATSGLDQHVRIWTP-TAKTATELTGLKDV-IKKNKQERDEDNLNYTDSFDNRMLRFF 632
30 -60.100[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  11  18IKVWQATGNCIKTMRVETSQVNALDRTPDKTRLAACGYQ-CIRLYDLESNCPVINFDGVQKNVTRLGFQEDGNWMFTAGEDHHVRIWDMIAAPHCSRIFDCEAPVNAACLHPNQVEIAMGSQNGSVFLWDVKSERHERIVPEVDASIQDVAISPDGRYLAAANNKGNCYIWSLTSQDQKMSTHSRYILRCKFSPDSRLLLTTSGDGTVCIWKTDDFSKWRELCIENY--WVWDAAFSADSKWLFTASSDGIARLWKLQTKSSIRDYTGHTKITALSFKDEIP--VKSTNISDVQSSAKPPTQRD-------NPPGTNNLAFFETVGRVAMNPYMGNTTTELN. 362
31 -59.900[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  13  46VIIRNINPAIADVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKELKNEFQPIAGPIKDISWSPDNQRIVAVGEGREGHVFMSETGTSVGEISGQSKSINSADFRPARPFIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEFHKGGVYALAWKPDSTQLLTCSGDKTCRLWTVESRELVSEFV-MGTTVDDQQVSCLWQGDNLITVSLSGVITYLNVADSKPLRVVKGHNKITVLGLSDDRS--TIYTGSHDGVVTNWNSGSGTNDRI--TGTGHGNQINGIAAWGDFVYTCGIDDSLRQFSV 395
32 -59.700[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  15  431......TIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLATPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHD---FTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGK--WFVSTGKDNLLNAWRTPYGASIFQS--KESSSVLSCDISVDDKYIVTGSGDKKATVYEV 768
33 -59.100[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  11  103WRVKQTSSRNQYDIVLPDFGPYKLDFTASGRHMLAGGRKGHLALLDMMNMSLIKEIQKERGPVARLRFLKNHFLLASVNMSGQLHYQDVTHGGMVASIRTGKGRTDVMEVNPYNSVVGLGHSGGTVTMWKPTSQAPLVQMQCHPGPVSSVAFHPNGHLMATSGKERKIKIWDLRKFEEVQTIHSFHAKTLSFSQKGLLAAGT--GSFVQILGDSSGGSSHNYTRYMNGYQIEKVMFRPYEDVIGIGHSMGWSSILIPGSGEPNFDSWVANPFETSKQRREKEVHSLLDKLPPETIMLDPSKIGAMRPSRRKEKPS............................ 467
34 -59.000[R] KOG1273 WD40 repeat protein  ali follow..  13  3APIIDPLQGEVIEEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDFETRGIAKEIRDNSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTIPLSSAPMIVDFDIDCTTLLPVSVPEMPDVLAPPQRS-KCPESNPPFSPAAACFNKCGDLVYIGNSKGEILIVDYKSVRVLALVGAAPVKNIVFSRNGQYLLTNSHDRTIRIYENLLPTLFREFQDSVTKMHWKAPCFSGDGEWVVGGSGEHKIYIWD-RAGHLVKILEGPEALIDLAWHPVHP--IIVSVSLAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKVLDV 389
35 -58.500[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  12  14SSMGGAKPALLHRITGHVARINDVILLSKDEGVWTASDDRSVRLYLKRDNDQFWPSHFMPVAPTSLYYSEETYKLLVGLINGNVYEFDFNSMTESRKWTCHAGPISGLGFALSSELIFSCSRDKSIVWHCSENSN---KMGSYLLENSCTAMVIDLPFVFVGDHGGHVTVLRIVDNQSKLSAHTNAITSLTWDGNKKVLYSGSSDHLIIMWDIGGGREAYELNGHNGK--VTTLCAAPAAKRLFSADEHGKLMCWDMNCKRVETPEWKTSDC-NQPFFWNLQAMTYPPMGYETKIRICNDCNARMKDNPQNEIHTGITAMHLQETLGLLVTSGQNRVIMIWDV 404
36 -58.100[A] KOG0299 U3 snoRNP-associated protein (contains WD40 repeats)  ali follow..  12  130......KIETAQLRGRHMRPLVGVVAYENF--VYSADKSGLIQKWEALQEKDTENRNDHVKEITCLAISNDGRWIVTGGLDHRIVIRDSVTLEPQHCWKHHRDAVMGLAMRRGTNEMFSCSADRSIKVWSLDQMSYIETLFGHQDVIFGVDALARERCVSVGGRDRTSRLWKIVEESQLVFRSGGTSVDCVAMIDEDHFVTGSDNGVIALWSVQRKKPLFTYPLAHGPRWITSLAAIPYSNLFASGSWDGNIRLWKIAEGLIATPLSVYGCINSLSLSLQGKGKVFAACGRETRVGRWKTLRGIP--------------NSGFVFNIPLTVIPSVTDGD.... 520
37 -57.900[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  14  48TKLERVAKPFLASLDGHRDGVNCLAKHPEKATVLSGACDGEVRIWNLTQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYGDELHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETFLLSCASDRNIVLYDMRQATPLKKVLDMRTNTICWNPMEAIFTAANEDYNLYTFDMRADTPVMVHMDHVSA--VLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYHTKQHVICVKWTSDSK--YIMCGSDEMNIRLWKANASEKLGVLTSREKAAKDYNQHYPHIKRIARHRHLP-KSIYSQ 403
38 -57.600[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  16  114....TYYSRPSECLMMLNQLPFCLGFANNESLLAVCTETGALELFDSRSARRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQTSKVFDLSTQQCITRLGYHSHSVKQVNFCNDSPNLVSCSRDGSIIFWDMRTHGITHENSGRDCSITSATWLPQSTSISSCSANSALKLWDLRTVHTVRPLRDFGVTNVCTSPDGERIYAASRDSIIYEYSSRHLNFCKTYKDPRISSFYVKLACSPDGATLACGGKTSGVVVFDTTRNSSAMLTGGHTKVTAVDWSSEGQ---LASISDDGSVRVWNSSLHGSAANL------------REKNFSEIFYWGFSEK...... 490
39 -57.600[R] KOG0646 WD40 repeat protein  ali follow..  16  15IGSWDLTGTEQLQFKPCASPAHGLTAVGESSQLSARNTSGSIFYWSWTKPQ-AEVKSYPVEPIKALAANNEGTYLVGGGISGDIYLWEVATGKLLKKWHGHYRSVTCLVFSGDDSLLVSGSQDGSIRVWSLIRTLYEHNFNEHTMSVTDIVIDYGGCNIISSSEDRTCKVWSLSRGKLLKNIFPSVINALALDPGGCVFYAGARDSKIYIGAINATQVLGSVSEKGKA--ITCLAYCADGNLLISGSEDGVVCVWDPKSLRHVRTLIHAKGSRKGPVNNIQIVRKTIVANSNKTQVSWKSRGALIPPPLEKYERP----VEDTMDGIVTVDPPPFSDVPVYS. 373
40 -57.500[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  13  1..........MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFEAENSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVSTLKTEFLP--LLSVSFVSENSVVAAGH-DCCPMLFIYDDRGCLTFVSKLNSITQVSIYEVDKCRKFCTTGIDGAMTIWDFKTLESS..................................... 363
41 -57.400[T] KOG4378 Nuclear protein COP1  ali follow..  13  1....................MMSNLVEPSWRLLAASGGD-TVKLFDVSADSVLSYTPSPGCAVNSVKWNHTNLVVASTGEDKKISLWRKNGQSLGTGGDSAEECLSAISFSKKGSYICSGGTGQIVKIWDLQRKLCIKKLKGHTSTITGVMYNCKDEHLASVSVGGDLIVHNLASGARATELKDHVLRLLDYSRSSRLLVTAGDDGTVHLWDTTGRSKMSWLKQHSAP--TAGVCFSPSNEIIASVGMDKKLYTYDSGSRRSSSCIAYEAPFSSLAFGDNGY--ILVAGTSNGRVVFYDIRGKP----------QPVTVLHAFSNSEDVTSLSWQTSKPV... 329
42 -57.400[BK] KOG1063 RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily  ali follow..  12  291....TYQISVESVLIGHEDWVYSVEWQPPVISILSASMDKTMMIWRPEKKTCVGELSHCALGFYGGHWSPNSLSILAHGYGGAFHLWRNVSSQMQKVPSGHFAAVTDVTWARTGEYLLSVSQDQTTRVFSAWKNDARPQVHGHDINCVAMVQGKGNHRFVSGAEEKVVRVFEAPLSFLKTNGGGEGLDTFETVPEAAPAELKEPPIEDQLAFHTLWPESHKLYGHGNE--LFSLCSDHKGNLVASSCKAQSIWLWEVGTWKAVGRLQSHSTVTHLEFSYDDT--LLLSVSRDRHFSVFSIQRTDLMAKVEAH-KRIIWACSWNPFGHQFATSSRDKTVKIWSV 725
43 -57.400[I] KOG0301 Phospholipase A2-activating protein (contains WD40 repeats)  ali follow..  13  11METESMQYTISHVIEAHKSDTKALAVTQGGC-LISGGRDETVKFWAKKGKKTHAFEQPKGITVNSIAYAEDGWRLFVGRRDGTIAVFGPSQAEPYAIFNEHKQNVCCLHINEKATHMLSGSWDSNVIIWPITESFTTIVCPGHTLSVWALASFPDLNTYLSASADKTIRMWFGDTTLSVFKGHTDVVRALVVLSSSH-FLSAGNDGHIIHWDVASASILRKFATQAHE---FIYSMTLSDSHILTTGEDGTLEFWAIDGGKSEAVIQLPTNTWDAKVLLNSD---IAVAGSDGRIYIMTTDKNRKADD-----------DILDAFDAEVVAKLTAKTERM... 350
44 -56.800[R] KOG1539 WD repeat protein  ali follow..  13  170LQLWNITKKMLYQFKGWGSSVTSCVSSPALDVVAIGCADGKIHVHNIKLDEEIVTFEASRGAVTALSFSTDGRLLASGGSFGVISIWNLNKKRLQSVIDAHDSSIISLNFLANEPVLMSASADNSLKMWIFDTNRLLRFRSGHSAPPLCIRFYSNGRHILSAGQDRAFRLFSVIQEQQSRELSQRHILACAISACGNFAVVGTAGGWIERFNLQSGISRGSYYAHDGE--VIGVACDSTNTLMISAGYHGDLKVWDFKKRELKSQWDVGCSLVKIVYHRVNG--LLATVADDFVIRLYDVVTLKMVREFRGHTDR-ITDLCFSEDGKWVISSSMDGSLRIWDV 607
45 -56.600[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  14  431.DLQPFPTVESMVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCIRTI-ETDEVVRCVAWCPNPKLSIIAVATGNSNAEADEQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGANRIHQLSKRRSQIPFSKSKGLIQFVLFHPVKPCFFVAT-QHNIRIYDLVKQELVKKLLTNSISGMSIHPKGDNLLVSTYDKKMLWFDLDSTKPYQTMRLHRNA--VRSVAFHLRYPLFASGSDDQAVIVSHGMVYNPLKKLQTHEGVLDVNWHPVQP--WVFSTGADSTIRLYT............................................ 784
46 -56.400[R] KOG4227 WD40 repeat protein  ali follow..  16  42......RNLYKKDLLGHFGCVNAIEFSNNGQWLVSGGDDRRVLLWHMEQAKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETLDVF-AHEDAVYGLSVSPVNNIFASSSDDGRVLIWDIRESPHGECLANYPSAFHSVMFNPEPRLLATANSKEGVGLWDIRKPQSSLNLSLQSAMSVRFNSNGTQLLALRRRLPPVLYDIHSRLPVFQFQGYFNSCTMKSCCFAGDRQYILSGSDDFNLYMWRIPANGAFMVLKGHRSVNQVRFNPHTY--MICSSGVEKIIKIWSPKQPGCTGDLDGRIEDDSRCLYTHEEYISLVLNSGSGLSHDYA. 405
47 -56.400[R] KOG2096 WD40 repeat protein  ali follow..  13  21LFFGSYRKRTSEVQSMAKAEPQDPIRNPKSNHPAPKKNHPKSQASDKNQNKDLNTLKGHGDAVTGLCFSSDGKSLATACADGVIRVFKLDDARFLRINLPAGGHPTAVAFADDASSIVVACHHMSSIKWDHHHIHEKRSVLTISGATATYGTADGSVVIASCSEGTDIVLWHGKTGRNLGHVDTNKNHMAAVSPNGRFLAAAAFTADVKVWEIVYQKRVMQLKGHKSA--VTWLCFSPNSEQIITASKDGSIRVWNINVRYPLCDSGGNPLYDRLSLCPEGK---ILAASHGSTLQWLCAETGNVLDTAEKAHEGDITCISWAPKAMVLGTSGDDKKVKLWEA 448
48 -56.000[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  13  193QATWYHEGRLWLADYSLPRAKDRLVRAREALEVPSAARAGRMVEKKLQSLAPLCSQVGDTRPVSSAAFSEDSSLLLTSSWSGLCKLWSVPDCELKQTLRGHASYVGGVALRPGVKAMASGGHDGAVKLWGFNNEESIADITGHPHRVSKVAFHPSGRFLATACYDSSWRLWDLEQKTEVLHQEGHAVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGRCIMFLEGHLGA--VFGVDFSPNGFHIATGSQDNTCKIWDLRRRQPVYTIPAHTNISDVKYQQECG-SFLVTCSYDSTTKIWSNKTWQPLKTLQGHDNK-VISVDIAPNSQYIATTSFDRTFKLWSP 551
49 -55.900[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  12  65DFMPDLPPGF-QMQQSEAGPSSSRAEGPEDSDDSDFDETEAISIIKLIPAACEAKISHGTQAISALRVEPPGVRFASGGLDYYVKLFDFQKMDMSELLPAESHVINSLAFSPNGETLVVASGEAIIRLLDRAGKQWLNITKGHTATVNCVEFNPLNKNFISCSDDGSLRLWNLDDHKVITKCINKHPQVCTFSPDGKWIAAGCDDGSVQAWKYGSQYVYLVRKAHNGS--ITSIAFSPDSKRLLSRGFDDTLKMWSLDNPKVKTGLENAFKSTDCGFSPRAEVVFTGTSDTPGTLQFFDPMTFDLVYKIDYP-GISCHRIQWHPRLNQIIAGLSDGTIHVYY. 446
50 -55.600[R] KOG2055 WD40 repeat protein  ali follow..  210..........ANFQAPSHSGIRCMSIHPYFPLLLTCGFDRTLRIYQLDVNPLVTSLHLRSSALQTALFHPDGKRVIAAGRRKYMYIWDLESAQVQKVQENFQPSMERFHVDPTGKYIALEGRSGHINLLHALTGQFATSFK-IEGVLSDVLFTSDGSEMLVLSYGAEVWHFNVEQRSVVRRWQVQSTTHFCLDPSNKYLAIGSKSGIVNIYDLQTSKPVTTLDNITFS--INSMSFSQDSQVLAIASKKDTLRLVHVPSFSVFRNWPTSGRVTCLAFGKGGE---LCVGNEAGRVGLWKLAHYDLKFVPDKII---------------NWEIRLGKFGYVLL. 542
51 -55.600[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  15  5......CGGAARMLRTPGRHGYAAEFSPLPGRLACATAQGTLLILDPEAGLRLFRSFDWNDGLFDVTWSENNEHLITCSGDGSLQLWDTAKAGPLQVYKEHAQEVYSVDWSQTRGLVVSGSWDQTVKLWDPTVGKSLCTFRGHESIIYSTIWSPIPGCFASASGDQTLRIWDVKAAGVRIVIPAHQILSCDWCKNENLLVTGAVDCSLRGWDLRNRQPVFELLGHTYA--IRRVKFSPHASVLASCSYDFTVRFWNFSKPSLLETVEHHTETCGLDFSLQSPTQ-VADCSWDETIKIYDPACLTIPA.................................... 323
52 -55.300[S] KOG0283 WD40 repeat-containing protein  ali follow..  14  379VKVRPTALHMCQEIQAHEGAVWTIKFSQDAHYLASGGADRVIHVWEVQECELMSMNEGSLTPIHPSLCDSSGNEITVVEKKKKGKGSSGRSDKPVCSLKGHLDAILDLSWSKSQL-LLSSSMDKTVRLWDIETKTCLKLF-AHNDYVTCIQFSPDENYFLSGSLDAKIRIWSIQDRHVVESDLHEMVTAACYTPDGQGALIGSHKGICRAYDTEDCKLSQTNQIDVAKRKITSFQFSPVNPEVLVTSADSRIRILDGSEVIHKFKGFRNCSQLSASYSQDGK--YIICASEDSQVYLWKNDFHRTRSTLTTQSHEHFHCKDVSAAVPWHGHVRGEPP...... 748
53 -55.200[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  15  79.....LNHCENRLWQYGKQRILQQPDILYQQYAVPADSTPDVPVDCILTKFIRTAMNKVKCPVYSVCWSPEGKRLITGCQTGEFTLWNGTAFNFETILQAHDSAIRALKWASNEQWLLSADQGGYVKYWQPNMNNAHMFSAHKDEAIRGLAFAPTDVKFATASDDGTARVWDFARYTEERVLRGHEVRCIDWHPTKGLIATGSRDTPVKIWDPKSGSCLATLQEHKSS--VMAVEFNKNGNWLLTGGRDHLVKMYDIRMMKEMRTYRAHKKVISLAWHPIHEGL-FVSGGGDGSIVYWMVDGEKEIGLLEHAHDQAIWSMKWHPLGHILATGSNDNNTKFWAR 418
54 -54.900[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  14  71.....MNQNRTRILAFRNKPKSLLSTNHSDSPHQNPKPVKPRRYIPQNSERVLDPGLRDDFSLNLLDWGSANVLAIAL--GDTVYLWDASSGSTLVTIDEDKGPVTSINWTQDGLDLAVGLDNSEVQLWDCVSNRQVRTLRGG-HESRVGSLAWDNHILTTGGMDGKIVNNDVRIRSSIVLGHTEEVCGLKWSESGNKQASGGNDNVVHIWDRSLAQWLHRFEEHTAA--VRALAWCPFQASLLAGVGDGKIKFWNTHTGACLNSVETGSQVCSLLWSQSERELLSSHGFTQNQLTLWKYPSMSKMAELNGHTSR-VLFMAQSPNGCTVASAAGDENLRLWNV 417
55 -54.600[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  16  1..MTTVPSAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLKGEF-LHGGAVLDCCFHDDFSGFSVGA-DYKVRRIVFNVGK-EDILGTHDKAVRCVLFCDVTGQVITGSWDKTVKCWDPRGASGPERTQTYLQPERVYSMSLVGHRLVVATAGRHVNIYDLRNMQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEAAQAKAGRDIVYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRLYQYSKYPTISALSFSRDGQLLAVASSQEPEAIFVRSVNEIEVKPKPKVYPNPAA.......................... 354
56 -54.400[R] KOG2394 WD40 protein DMR-N9  ali follow..  10  166......EKDPVKSIHFSNSNPMCHAFAKDGHDLLIGLNSGDVYTVSLRQQLQ-GSVNNRQDRCTSISWVPSTFPAIRDPTQFSVDKAKYSKSNPVARWHICQGSINSIAFSNDGAHLATVGRDGYLRIFDFLTQKLVCGGKSYYGALLCCSWSMDGKYILTGGEDDLVQVWSMEDRKVVAWGEGHNVSGVAFDSNWSRFGSVGQDTQLLLWDLEMDEIVVPLRRAPGG--SPTYSTGSSAHWDNVGTLQPAPCKRDVPKLSPIIAHRVHEPLSGLMFTQES----VVTACREGHIKIWTRPSESETQTNSSNPTTALLSTSFTKDNKASLSSKIISGSTFKQ. 556
57 -54.100[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  17  87INILSRNGKVENMVDAHNGAALCARWNSDGTGLLSSGEDGFVKMWSR-SGMLRSVLAQFATAVYCVAWDSTSSNVLYCNADHCY-IKSLKMQVAPIKWKAHDGIILCCDWNPTSDLIVTGGEDLKFKVWD-GFGQILFNSSVHDYPITSISWNTDGTLFAVGS-HNILRLCDKSGWSHLEKMNAGSVMALSWSPDGTQLAVGTAAGLVFHAHIIDKRLIFTYEGRMALLDERKIDLANDTLVVRDRADNKVLHFFDPTTGKAQGDGNKHEDIVELTVNQCGPDRNVAFRDQIGAVHIAMVKTFGVSQRMVKI-GSLVEQLVFNDVTNMLCGIS-EGKIAVW.. 530
58 -54.100[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  12  156VVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTVRIWDSVTLNTLHVIGFFDRAVTCIAFSNGGTNLCAVDDDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGEITSLLLDTRRKLPLIRSKRKAKVVLCVTFSENGD-TITGDSSGNILVWGKGTNRISYAVHEGGISPLCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIPEQFGPILWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGS--VVAVGTLTGRWFVFDTETKDLVTVHTDGNEQ-LSVMRYSPDGNFLAIGSHDNCIYIYGV 557
59 -53.800[R] KOG0322 G-protein beta subunit-like protein GNB1L, contains WD repeats  ali follow..  10  1..MAVLPPDPVFSLRSPDGAVNSLCFQESDR-LLAGTIKGSVFLWDLQTNRSALHFEVGSDPITSLHHTPDR--LVTQEKGGTITMFSIGGSSYVKELGFCRSALHTNTSKTNEQLLFYPCEESSIGVLHVTDAAAPTQILVPDDPQLKPFECASQLFLLAGYESGHFLTWDISSSVILDVMLAQDATSVDYDPVTNRGIVGGPTDKLISFSYQRSSMQMQLGSEIKNPGVNGVRIRPDQKVFASAGWDGRIRIFSWKSLRPLAVLTQHGGVMDLAFSSQQHAPIMAAAGMDGQISLWDLYN......................................... 323
60 -53.200[S] KOG4328 WD40 protein  ali follow..  12  202.....LTLEPQNVARVVPGRIFVVQFLPNVKMVAAGDKLGNVGFWNLDCGNEIYLFTPHSAPVSSIVFQQNSSRVISSSYDGLIRLMDVEKSV-FDLVYSTDEAIFSLSQRPNDQSLYFGQDYGVFNVWDLRAGKSVFHWELHERRINSIDFNPQNPHMATSSTDGTACLWDLRSMGAKKPKHSRAVHSAYFSPSGLSLATTSLDNYIGVLSGANFENTCMIYHNNTSRWISKAVWGWDDSYIYVGNLSKKIDVINPKLKRTVMELHNPAIPCRIHCHPY-NVGTLAGSTAGGQVYVWTTK.......................................... 516
61 -53.000[U] KOG1332 Vesicle coat complex COPII, subunit SEC13  ali follow..  14  1.....MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGLIADLRGHEGPVWQVAWAHPGNILASCSYDRKVIIWREENGEKSHEHAGHDSSVNSVCWAPHGLILACGSSDGAISLLTYTGEEVKKINNAHTIGCNAVSWAPAVKRFASGGCDNLIKLWKEEEDGQKLEAHSDWVRDVAWAPSTSTIASCSQDGRVFIWTCDDASSPKLLHKFNDV--VWHVSWSITANILAVSGGDNKVTLWKESVDVCISDVNKGQGSASVTEGQQNE............................................................. 321
62 -52.000[R] KOG2444 WD40 repeat protein  ali follow..  12  4...............EFDNPPLCMKSNKDGSRLVVGFVDGSIRFYDTQQHEEEFQEFQTKSSIRGVDLDEHKKRVYAVTKNRSLCVFDIDTGKRVRCIKCHRSVPTAICTLPKSQQLATADESGEVKTWNLDPNANIRKWQEQDEDINDLKVDVKSNLLATSS-DGTLGAYDLRKAKLKMRSELMHSELYSVCGTNRSVYVGGEDGYVEVFNLNENLLERVESGFEMG--VNGIVELRSGLLGLTSQGSNRMRLLNVQPSKRLGYAGYHGGIDAITISTDKSTV-FTMISMSCTIKKWDMG--PIIDEIPILRAQDAKSKKMRKTEGFFDGLVGPKNDSDSD. 346
63 -51.700[R] KOG2919 Guanine nucleotide-binding protein  ali follow..  12  113....ELGRRCWTSSTEAQHYTKGCYWSPDGTCLLVPVHLDGMHVIEMPSDLYSADTVQEGGTVYDCVWYPETCLWLATRQHEPIHMWDAFDGSLRCSYSGYDMAAISLAFSHDGEQIYA-GYKRCIKIFDTSRPGRFCDDYPVKFAISCIAQTTAHPHLTCGNWHGYIQHFDLRCSHKTLGGHKGGITQLRYGEFGNLFSGARKCDKILQWDMRYKQPLVELQRHVDTNQRIQFDLASDSNWLASGDTRGFVNVWDLKKYGDPSVLPLHDCCNGVALNPAMPILATSSGQ-----FHFTDQSAQGDNVTLNGTET-TELPAPADVNQNQKEVLYENAVVMWWC 483
64 -51.600[Z] KOG0313 Microtubule binding protein YTM1 (contains WD40 repeats)  ali follow..  22  83IEYVECTAPQPEQCMFHDDWISSIKGAEEW--ILTGSYDKTSRIWSL-EGKSIMTIVGHTDVVKDVAWVKKDSLLLSASMDQTILLWEWNVEKALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEIVTLSGHMEAVSSVLWS-DAEEICSASWDHTIRVWDVGSGSLKSTLGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDVSLSLTSHTG--WVTSVKWSPTHEQLISGSLDNIVKLWDTRSCKALYDLAAHDKVLSVDWTDTGL---LLSGGADNKLYSYRYSPTT....................................... 418
65 -51.600[YU] KOG2445 Nuclear pore complex component (sc Seh1)  ali follow..  15  3...........PFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDELSDSWRAHDSSIVAIDWASPGRIIASASYDKTVKLWEEDPDNKLCTLNDSKGSLYSVKFAPAGLKLACLGNDGILRLYDALEPSDLRPPANHLQSDFCLSWCPSRFEKLAVSALEQAIIYQRGKDGAKLPGHKSLIRSISWAPSYQLIATGCKDGRIRIFKITEKLSPLASEESLTN--SNMFDNSADVDMDAQGRSDSNTELQSNLQVELLSEHDDHNGVWSVSWNLTGT--ILSSAGDDGKVRLWKATYSKCMSVITAQQ.............................. 349
66 -51.200[S] KOG0294 WD40 repeat-containing protein  ali follow..  12  2...........................PPEMEIIEATNEELLLGFKLIKSELKQTFADSSYARSITSLAVQWPWVASGGTDGRIFVYDMRTRKQSQIILSHAGRVNTLKFTPDLSLLLSGSDDGHMIATRVGSWTKEYDWQKAGQAVTHVSCHPSSKLALSLGGDQVLNTWNLVNGCVAHKTLDFQTGCLSWSKQGDHFTLSG-PLVLEIWGIENAHVMRRIE---MPSKPICITWL-DGNECLTGLDNGNIAWISLKDEDPPTFILAHEVVKAIAYLNE----FLATVSIAGQIKVWKIDMETRKLEEIARSFMDPTDLGLLDLRQFGNVRPVEQRTKVEE. 332
67 -50.900[R] KOG2321 WD40 repeat protein  ali follow..  12  51...............EYPEASNRIKCTRDGKYAMATGVKPHIKVFDFAEMSLKFERHTDAENVQFEILSDDWTKSVHLQTDRTVDFHSQGGIHYSTRIPKY---GRDLKYHYPNCDLYLAAAGDEVYRLNLEQGRFLNPLKSPTGGVNVIDINPMHQLLAFGTDAGSVEFWDPRDRSRVGILNSRSVTALKYRNDGLNVAIGLSDGATLLYDLRSSSPYMSKD-QGYSMPIKSLHWMDDGTARVLSADSKIIKIWEKDTGKPFSSIEPTVELNDVCPIEGTG--LILTANEGSPMHAFYIPSLNPAPRWCSFLDNITEEMEENPDDYKFVTKKELLNLGLDHL 401
68 -50.900[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  11  20ANEKDLAND-IVINSPAEDSISDIAFSPQQDFMFSASSDGKVRIWDVQNGVPQRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQ-TQQIGMHSAPIKVLRFPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPE-RVYSMDNKQSLLVVATAERHIAIINLANPTTIFKATTSPLQTRCVACYNEADGYAIGSVEGRCSIRYIDDGMQKKS-NGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQRHRLKGYPTLQSIPVCSFNRNGS--VFAYALSYDWHQGHMGNRPDYPNVIRLHA---------------TTDEEVKEKKK.... 364
69 -50.900[R] COG2319 FOG: WD40 repeat  ali follow..  12  213IYLWSKELGPTRVLEESIYDVSSVAYSYNGDILAVGRVDGTLQFWQDNERV-PRISIHHPGDIGVLAWKPETNRLLVGKGNGNIFVYDIIAVLVATITNAHDEQVCGLTWNHDGSQFASGGNDNRVCLFKGSDLRQPLYVWQQNAAVKALSFCPWQRSLLAGSHDKHIRFYNCFNGKKIDELYCGAITSIHWSPKYREFSVTTVQHRFAVYSWPQLECLVSVLPSVPDIRCVHSVLTSQTDSIIIASSNETIKFFDLSEESSWHNSRVLTWDSQILEMLEG-----IDGKIDSHLR............................................... 535
70 -50.700[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  4......NQQPPSNLQTYGVPIYAVDWILEEAVRSKITKDQDDDDDDGSSSSPIGRRVIGTDLPYRMAIHPRQGGLICALPENIIEDDNEEESEKVVKELKDVGQQLSLSFNQDGTVLATGAEDGTLRVFEWPSMKTLLNESKTHASVKSLTFSESGKFLVSLG-APLCRVWDVNASAAIASLSKEKFASCRFSVDNSVAANTQRGGSIITWDTTSWRRRSS----KRNNSISAFNVSADGKLLAVGTLEGDVLIIDSTKMQTNQIVKAHLGVTALTFSPDSR--CLVSVSFDSRARLTVIKQKGEKRRVYLWVAALLFVLVYVVLYYLMVAMGII........ 382
71 -48.600[BL] KOG1009 Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats)  ali follow..  11  1.....MKVITCEIAWHNKEPVYSLDFQHGTARLASAGVDTNVRIWKVEKGEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWNKENWTVVKTLRGHLEDVYDICWATDGNLMASASVDNTAIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYVATLSCDRVLRVYSIQKKRVAFNVSKMLFRRLSFTPDGSLLLTPAGCVESGENVMNTTYVIAHLPCPGKATLAVRLMSLPYRLVFAVASEDSVLLYDTQQSFPFGYVSNIHHTLSDISWSSDGA--FLAISSTDGYCSFVTFEKDELGIPLKEKP---VLNMRTPDTAKKTKSQTHRGSSPGPR. 414
72 -48.400[R] KOG4497 Uncharacterized conserved protein WDR8, contains WD repeats  ali follow..  10  31LVVRDVNTLQILQLYTCLDQIQHIEWSADSLFILCAMKRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEHLRITVWSLCTKS-VSYIKYPKACLQGITFTRDGRYMALAERRDCVSIFVCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAVWDTCLEYKILLYSDGRLLSTYSAYEIKSVAWSPSSQFLAVGSYDGKVRILNHVTWKMITEFG-ANPKMGIGMLAFSPDSYFLATRNDNNAVWVWDIQKLRLFAVLEQLSPVRAFQWDPQQP--RLAICTGGSRLYLWSPAGCMSVQVPGEGDFA-VLSLCWHLSGDSMALLSKDHFCLCFLE 444
73 -48.400[R] KOG1310 WD40 repeat protein  ali follow..  18  41........SQEQELEGHQGCVNALAWNSNGSLLISGSDDLRINIWNYSSRKLLHSITGHTANIFCTKFVPEDELVVSGAGDAEVRLFNTSRLSPSALYQCHTRRVKKLAVEPNPNVVWSASEDGTLRQHDFRESTSCPPPPKQTLSLKSCDISARPHLLLVGGSDAFARLYDRRMLPPLASSRKRMLTHVTFSPNGEEVLLSYSGEHVYLMNVGAIDMKRRYVGHCNVGTDIKQALGQRGEYIASGSDDGRWFIWEKQTGRLMKVLVGDESLNCIQCHPFDS--VVATSGIDNTIKIWSPTASVPSIVAGGSAGP............................ 704
74 -48.400[KL] KOG4283 Transcription-coupled repair protein CSA, contains WD40 domain  ali follow..  15  4...........AIKDRETGRIRSNSFA---------NRFKSRRILSLQLSNRKDFVSPHRGSVNSLQVDLEGRYLLSGAADGSAAVFDVQRATDKQHENGHKYAISSAIWYPDTGLFITGSFDHYLKVWDTNTAQAVVDFKGKVYRTAMSSMAMSHTLIAAGTEDVQVRLCDIASGAFSHTLSGHGVMSVEWSTSSEVLYTGGCDGAIRFWDIRRAGCFRVLDQSQT-----QLGFRPPILKRTAVGSKVC............................................................................................ 253
75 -48.100[DK] KOG0973 Histone transcription regulator HIRA, WD repeat superfamily  ali follow..  14  2............TFVGHDTSILAIDCHPSGKKFITCGSNGLVVVWNAEP-PKLLFQVESQSQSNSCRWSPDGKRFAFGSDDSSVSVWEYVGLKECCVLRGHSMEVLTVEWSPNGKYLASGSIDYRIIIYNARKPDRITVLNDIQLPVKGLSWDPIGKYLASLEGDKKLRFWATDSWQCVKSVEETMLTRLDWSPDGKYLMTPAAVRLIKLIQRQTWKSDQFLAGHHKG--TTCVRAMPQLTCAAVGSRDKSISIWVFPGTLKPLFVINNFNHTVMDFAWCGR--NLLACSQDGTVKVIHLSESVIGEMISNEAMSDLCYQIYSIRPPRYELTD.......... 379

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhao Y, Hong DH, Pawlyk B, Yue G, Adamian M, Grynberg M, Godzik A., Li T. The retinitis pigmentosa GTPase regulator (RPGR)- interacting protein: subserving RPGR function and participating in disk morphogenesis. Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3965-70. Epub 2003 Mar 21.