current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [S] KOG0321 WD40 repeat-containing protein L2DTL, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490
# Score Template Links and tools%idFirst MNMDIGKALSDVGGLRDITSRANNSLPPTPDSSPAAPSKKHKLYDFLESRGKIETPRKRIVFEKKPLLHKPVHIQKKPAQLCKELLIRQLGGSRSHPFSTKTSRHVGGRLNLETYYSRPSECLMMLNQLPFCLGFANNESLLAVCTETGALELFDSRFYDRQNEENQPSARRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQTSKVFDLSTQQCITRLGRRGVDGYHSHSVKQVNFCNDSPYNLVSCSRDGSIIFWDMRTHGITIDGEHFQKPVLRIRKAHENSGRDCSITSATWLPQSTSQVISSCSANSALKLWDLRTVHTVRPLPAATTPELTTSKRDFGVTNVCTSPDGERIYAASRDSIIYEYSSRHLNSGFCKTYKDPRLRISSFYVKLACSPDGATLACGGGVQDKTSGVVVFDTTRNCSSSAMLTGGHTKDVTAVDWSSEGQLASISDDGSVRVWNSSLHGSAANLREKNFSEIFYWGFSEKLast
1 -113.000[S] KOG0321 WD40 repeat-containing protein L2DTL  ali  100  1MNMDIGKALSDVGGLRDITSRANNSLPPTPDSSPAAPSKKHKLYDFLESRGKIETPRKRIVFEKKPLLHKPVHIQKKPAQLCKELLIRQLGGSRSHPFSTKTSRHVGGRLNLETYYSRPSECLMMLNQLPFCLGFANNESLLAVCTETGALELFDSRFYDRQNEENQPSARRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQTSKVFDLSTQQCITRLGRRGVDGYHSHSVKQVNFCNDSPYNLVSCSRDGSIIFWDMRTHGITIDGEHFQKPVLRIRKAHENSGRDCSITSATWLPQSTSQVISSCSANSALKLWDLRTVHTVRPLPAATTPELTTSKRDFGVTNVCTSPDGERIYAASRDSIIYEYSSRHLNSGFCKTYKDPRLRISSFYVKLACSPDGATLACGGGVQDKTSGVVVFDTTRNCSSSAMLTGGHTKDVTAVDWSSEGQLASISDDGSVRVWNSSLHGSAANLREKNFSEIFYWGFSEK 490
2 -66.900[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  12  380..................PSSSRLPEHEINRADEVEALTFPPSSGKSFIMGADEALESEL-------------------------GPGELAGLTVANEADSLTYDIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKKSTSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNIDPYDSYDGPLLGHTDAVWGLAYSAAHQ-RLLSCSADGTLRLWNTTEVAPALS-------------FNDIKELGIPASVDLVSSDPSH--MVASFSKGYTSIFNMETQQRILTLESNVD---TTANSSCQINRVISHPTLSISITAHEDRHIKFYDNNTGK------LIHSMVAHLEAVTSLAVDPNGLYLMSGS----HDCSIRLWNLESK--TCIQEFTAHEESIHDVAFHPSKCIASAGADALAKVF........................... 779
3 -65.600[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  18  4...........................................................................KRPNNSVILAQEAKRSKNDLMAYTNRDKALLESGVRRTSNLQAPIMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYE----------DCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFK------GHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKKHAAHTLE-----------------SPFQVTAVCFGDTGEQ--VISGGIDNEVKIWDIRKQAVLHHL----------RGHSDTITGMSLSPEGDFILTNAMDNTLRVWDVRPYAPGCVKVFQGHQHNFEKNLLRCAWSPGSDKITSGS----ADRHVYIWDVNTR--RILYKLPGHNGSVNAVDFSPKEPILSGSSDKTLYLGEIDE....................... 347
4 -62.900[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  13  17.NELGGSGILVPVDISTNELQILCNQLLGSSDDPVPISFFTTEGAEIVDSIRKSLEEIDFETTLKLVYQPQAVFRVRPVTRCSASIPGHGEPVISAQFSPDGRGLASGSGDQTMRIELPLHTCKSHKSWVLCIAWSPDATKIASACKNGEICIWNAKTGEQIG----------KTLKRHKQWITSLAWQPTCRLLASCGKDGNIFIWDTVQGTVVRCLS------GHTASVTCLRWGGEG--LIYSGSQDRTVKMWRADDGVMC----------------RNMTGHAHWINTLALNTDYA--LRTSCFEPSKRCIKPDTVEECQKVAQTR-------------YEAALEIAGGERLVSGSDDFTLFMWNPKETK-----QSINRMTGHMQLVNQVVFSPDTRYIASAS----FDKSVKLWCGRTG--KYLASLRGHVGPVYQVAWSADSRLVSGSADSTLKVFELKTKSLYYDL-PGHGDEVFTVDWSPE 455
5 -61.900[A] KOG0285 Pleiotropic regulator 1  ali follow..  13  52......QVAFGGVEPASKPTRIADHNSEKTAPLKALALPGPKGSKELRKSATEKALVVGPT-----------------LPPRDLNNTGNPGKSTAILPAPGSFSERNLSTAALMAPWKNYRVLQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVA-----------TGVLKLTLTGHIGQVRGLAVSNRHTYMFSAGDDKQVKCWDLEQNKVIRSYH------GHLHGVYCLALHPTLD-VVLTGGRDSVCRVWDIRTKMQI-----------------FVLPHDSDVFSVLARPTDPQ--VITGSHDSTIKFWDLRYGKSMA----------TITNHKKTVRAMALHPKENDFVSASADNIKKFSLPKG------EFCHNMLSLQRDIINAVAVNEDGVMVTGGD-----KGGLWFWDWKSGETIVQPGSLESEAGIYAACYDQTGSLVTCEGDKTIKMWKED---------EDATPETHPLNFKPP 471
6 -61.900[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  14  4.NTAPKKNSEKKARVFDLQANAPRTEEPTHVPQSVSVSSKSESGVSSSAVSDDEDDFMPDLPPGF------------------QMQQSEAGPSSSRAEGPEDSDDSDFDETEAISIIKLIPKISHGTQAISALRVEPPGVRFASGGLDYYVKLFDFQKMDMSMRYDK------ELLPAESHVINSLAFSPNGETLVVASGEAIIRLLDRAGKQWSETVRDLNITKGHTATVNCVEFNPLNKNEFISCSDDGSLRLWNLDDHKVITKCINKHRKVIKTK---GANGKRVSPQVCTFSPDGK--WIAAGCDDGSVQAWKYGSQYVNVNY-------LVRKAHNGSITSIAFSPDSKRLLSRGFDDTLKMWSLDNPKEPLLVK---TGLENAFKSTDCGFSPRAEVVFTGTSSPDTPGTLQFFDPMTF--DLVYKIDYPGISCHRIQWHPRLNIIAGLSDGTIHVYYDQTMSQRGVMS-CVTKPLKRNRASEV 471
7 -61.900[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  12  5.ILDPSNLVKNREILYRLMISQ---LMYDGLEKFAMELSMLVKADQCAPSERLLHVMIAGMQT---------------LSDKDKTNSDDVLPGIDLEFEPEASALAPEPHS------YETAYVTSHKQACRAGAFSCDGSLVATGSVDASIKILDVERMLAKSAPEQQGHPVIRTLYDHTDEVSYLEFHPKEHILASASRDGTVKLFDIAKPSVKKAHK----VFTDCEPVLCLSFHPTGD-YVAIGTEHNVLRVYDVATTQ-------------CFVSAIPSQQHKAGVTCVKYSPTGK--LYATGSYDGDIKIWDGISGRCINTIAEAH--------GGAAICSLEFTRNGKYLLSSGMDSLVYLWELCTSRPIQTYTGAGTTGKQEHQTEAVFNHTEDYVLFPDE----ATTSLCSWNSRNG-CRLTLNSLGHNGPVRYITHSPNGPFLTCSDDFRARFWYRRANNQ.................... 424
8 -61.700[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  14  158.RLLAIGCRDSSTKIVAINYTKNRTYNLSGHTDAIVACFFEANSLHLNTISRNGQLCLWECSLAPSDLEDAER---VEKDALKEESTKEAEDVNHIKNEDETKSHPFFYKKITRHYLADEPRKEQRDVQLTAANYNTRTKVLVVAFSSGAFYLYELPDVNMIHSLSIQSEQYIMKQQGHSSEMTCIAYSSDGQFIATGGEDSKVKLWNTQSSFCFVTFS------EHTSGVTGIQFSRNKK-FLVSSSLDGTVRAFDVNRYRNFRTFTSPNPSVKTGKLLEIISGHEGPVVSIAFSPVATSSTLVSGSWDKTVKIWNCLESNSEHET----------IDAVSDVTNVTFSPSGEEIAVATLSGNITIFDIKSAGQVTTIEITARKNAQANYFSTIEYSADGECILAAG----KSANICIYHVREAEITQNHSLDGLNDFISRKHLSEFGNMALVGGRVAIRLPGVQRGDMSSRR-FQQEVRVFSVKFSPT 736
9 -61.400[R] KOG0286 G-protein beta subunit  ali follow..  17  2............................................................................GEMEQLRQEAEQLKKQIADARKACADVTLAELVSGLGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSY-----------TTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSR--ELSAHTGYLSCCRFLDDNN--IVTSSGDTTCALWDIETGQQK----------------TVFVGHTGDCMSLAVSPDFN--LFISGACDASAKLWDVREGTCRQ----------TFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHE----SIICGITSVAFSLSGRLLFAGY----DDFNCNVWDSMKS--ERVGILSGHDNRVSCLGVTADGMVATGSWDSFLKIWN.......................... 340
10 -61.400[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  12  38....FLYTNGNSVIIRNIEN-PAIADVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKE--------------HLLKNEFQPIAGPIKDISWSPDNQRIVAVGEGRERFTGTSVGEISGQSKSINSADFRPARPFIVTGSEDNTIAVFEGP-----------PFKFKMTKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEFG----SPAHKGGVYALAWKPDST-QLLTCSGDKTCRLWTVESRELVSEFVMGTTVDDQQKPLRVVKGHNKPITVLGLSDDRSTIYVYTCGIDDSLRQFSVEGNSYTDYVVKLNCQPRGLAPIKYEASSIAVNADTSDVAVGGDDQKLHIYTLKGGVLE-----PKVELDHLGAVTDVSYSPDLKYLVACD----AHRKVVLYSVEEYKPAHNKEWGFHSARVNTVAWSPNSLVASGSLDTTIIIWSVANPAKHTIIKNAHPQSQITRLVWLD 587
11 -61.100[S] KOG0282 mRNA splicing factor  ali follow..  12  154....................GSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKKKQIHVWSGHTKGVSAVRLFPLGHLLLSCSMDCKIKLWEVYG----------ERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFT-------NRKVPYCVKFNPDEDNLFVAGMSDKKIVQWDIRSGEIV----------------QEYDRHLGAVNTIVFVDENRR--FVSTSDDKSLRVWEWDIPVDFKYI---------AEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQN-RFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGD----GNGKLNIWDWKTT--KLYSRFKAHDKVCIGAVWHPHEKVITCGWDGLIKLWD.......................... 579
12 -61.000[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  12  36.GRYVAVPACEHVFIWDLRK-GEKILILQGLKQEVTCLCPSPDGLHLAVGYEDGSIRIFSL----------------LSGEGNVTFNGHKAAITTLKYDQLGGRLASGSKDTDIIVWDVINRLKGHKDAITQALFLREKNLLVTSGKDTMVKWWDLD-----------TQHCFKTMVGHRTEVWGLVLLSEEKRLITGASDSELRVWDIAYLQEIEDPEEPSIMREGRDRVVNLAVDKTGR-ILACHGTDSVLELFCILSKKEIQKKMDKKMKKARKKAKLTIGGHRSDVRTLSFSSDNI--AVLSAAADS-IKIWNRSTLQCIRTMTASGNLLETIDAHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKQKRLSVKQTRTLQLDEDVLCVSYSPNQKLLAVSL----LDCTVKIFYVDTL--KFFLSLYGHKLPVICMDISHDGAIATGSADRNVKIWGLDFGDCHKSL-FAHDDSVMYLQFVPK 644
13 -60.600[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  12  73.NRLLVAYNNQIIREYSIPLDPSTRTWKTIHTAPILVMEFNEEGHLLATGSADHIVKVWNL----------------TEQQCTHTLKGP-SVVSAILFGKHEKLVVGYIEGQRGAPKKLVNTWKSHNSHITALLQVPDSRVVVALSRDQTMSIHETETQETLRVLVIETAKLVRKKRIASSNLDHLAYDVVSNRFLAISAEQNLIILDFENLKIARQI-----VGFHDEIYSCCLLGKDESHMLASCSKDNSIIFWRLVTSPE-------NDSCSTLVPVAAATGHANTVTALAISNTGRAPFLASVSTDCTIKLWGLGVSTKLKEVKPKLTCSSTMVAHGKDVNCVDISESDALIATGGMDKLVKLWQVDTHKMQ--LGIAGTLSGHRRGVGDVKFAKNSHKLASCSG----DMTIKIWNISEK--SCLQTISGHSCAVFRVIFARNDSLISADSAGIIKIWTIKTADCECSI-DAHTDKIWSLSKNHN 618
14 -59.300[R] KOG0645 WD40 repeat protein  ali follow..  14  1...........................................................................................................................SGHTGRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNLVHVIDG----------FHTRSIRRVAWRPIERVLAVASFDSVVSINEKIDDD-----ECTAALEGHENEVKCIAWSCNGN-YLATCSRDKSVWIWEATEDD-------------EFDCLAVLQEHTQDVKVVTWHPTED--LLVSGSYDNSICFWRDDG--------DDWALTCQLQGHTNTVWALAFSPNGNTLASADNDGNVFLWIKISSNEDVAKQQTSLPHIHKGAVYTISWMNDATLCSAGG-----DGKIVVYQREKHDEALEQDHAHGVYEINSLEYLRDDRLLSGGDDGECRVWSFK........................ 322
15 -59.200[T] KOG0279 G protein beta subunit-like protein  ali follow..  19  9........................................................................................................................GTMCAHTDMVTAIATPVDNSVIVTSSRDKSIILWKLTKED------KSYGVAQRRMTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGESTRRFV------GHTKDVLSVAFSTDNR-QIVSASRDRTIKLWNTLGECKYT--------------ISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRN----------TLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKK--------YSLEAGSIIHSLCFSPNRYWLCAAT-----ENSIRIWDLESKSGSTGIGNKTKVIYCTSLNWSADGNLFSGYTDGVIRVWGIGR....................... 325
16 -59.200[BK] KOG1063 RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily  ali follow..  11  192..ALALGGLDNKIKLYSGERTGTSVCELKGHTDWIRSLDFSLPLHTLVSSSQDKVIRIWKLVLVYIEGPVFVSGTFTYQISVESVLIGHEDWVYSVEWQPPVISILSASMDKTMMIWRPEKELSHCALGFYGGHWSPNSLSILAHGYGGAFHLWRNVSSSK----ESENWQMQKVPSGHFAAVTDVTWARTGEYLLSVSQDQTTRVFSAWKNDEGNEAEDEHQVHGHDINCVAMVQGKGNH-RFVSGAEEKVVRVFEAPLSFSALGLSQKPIYLHSSSEPLERNGGGEGLDTFETVPEAAP--AELKEPPIEDQLAFHTLWPESHKL----------YGHGNELFSLCSDHKGNLVASSCKAQSASMAEIWLWEVGTWKAVG-RLQSHSLTVTHLEFSYDDTLLLSVS----RDRHFSVFSIQRTDNKLMAKVEAHKRIIWACSWNPFGHFATSSRDKTVKIWSVENDARIKQILVPFGSSVTAVAWTGL 752
17 -59.100[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  14  211.SFERGDAQLQPVKLQQMPMDKE-MEKIVEMDLEEEDMMHQNDPNNQSPKLLKEFRKLHEPNAEDAP----------------SRDYIPLPPHKGVDILSEVEAVKDWSKRLASLPSVCMYTFHHTNNNMNCAEFSPDSTMIACGFQESYIRLWSIKADKKSLPKSTEDSDGSVRLLSHSGPVYGTTFSPDNKYLLSCSEDASARLWSVDTKTALVAYK------GHTGPVWDVAFGPFGH-YFATASHDQTAQLWSCDHIYPL----------------RVFAGHLSDVDCVTFHPNSA--YVLTGSSDKTCRLWDVHRGHSVR----------VFNGHTQPVTAVAIAPDGHTMASADSEGLIHLWDIGTGRR-------KTMRGHRGNIYSLSFSRESTVLVSGG----SDCTVRAWDVFKT--NYNNPVSSSLTGSVVTPFSAKTSTFN-------EVNWSTSPDQMVAL-YTKQTPIFNVSFTRR 634
18 -59.000[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  11  1...MSSCVNTSQTGPKKKISFIIRDEHEYSNRSAVSALQYDAQNGRLFTGGSDTIIRTWSVPHHKSARGGVRSPGKNSPVQYQGSLEQHTDWVNDMILCGHGKILISASNDTTVKVWNIERCIRTHKDYVSCLAYAPIVEKAVSASFDHNIFVYDINA----------NFKTVNNLIGCKDSIYSLATTPNLSLVLGAGTEKCIRLFDPRTNEKIMKLR------GHTDNVRALVVNDDGT-RALSAGSDATIRLWDIGQQRCI----------------ATCIAHEEGVWTLQVDSSFTT--VYSAGKDKMVVKTPLYDFTKSQ----------LLFKEEAPVKKLLLSEKDNSLWVGTWKSDIKRWSIRPSAQ-------SIGGDEDGPSTSNANHSVSASSSPPV----TFKYIRVKDQKGQQSTPELVI-PGAPAIKKHAMLSDKRVLTRDSDGNVALYDVLAARKIKDYFEEVVDENSRQVYIPS 449
19 -58.700[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  13  4..............................................................................RLEIKRKLAQRSERVKSVDLHPTEPWILASLYSGTLCIQVMAKSFEVTELPVRSAKFVARKQWVVAGADDMYIRVYNYN-----------TMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWACTQ-----IFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPN----------------FTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQ----------TLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYR------LENTLNYGLERVWAIGYIKSSRRVVIGY----DEGTIMVKLGREI---PVASMDNTGKIIWAKHNEIQTAIKSIGADYEVTDGERLPLSV--KELGTCDLYPQSLKHNPN 364
20 -58.600[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  14  291....ASSASSTSLKSKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQANGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVGFDPPPHMTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGI-----------PRHARQINTLNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQL-DCLNRDNYIRSCKLLPDGC-TLIVGGEASTLSIWDLAAPT---------------RIKAELTSSAPACYALAISPDSK--VCFSCCSDGNIAVWDLHNQTLVRQF----------QGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQ--------QQHDFTSQIFSLGYCPTGEWLAVGM----ESSNVEVLHVNKPD---KYQLHLHESCVLSLKFAYCGKFVSTGKDNLLNAWRTPYGASI--FQSKESSSVLSCDISVD 750
21 -58.600[S] KOG0293 WD40 repeat-containing protein  ali follow..  13  159LRNEMAPLRINTKRVHELASSLISPSSFISHTTSTPGKESVNSRSKVLEELQTLLPASVII---------------PEKRLECLVENSLHIQRDSCVFHNTLDSDLSLYSDHQQIPSQTAQILESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGHI--------SLKHTLVGHHKPVIAILWSPDDRQVLTCGAEEVIRRWDVDSGDCVHMYE------KGGISPISCGWYPDGQ-GIIAGMTDRSICMWDLDGREKE----------------CWKGQRTQKVSDIAMTDDGK--WLVSVCKDSVISLFDREATVE------------RLIEEEDMITSFSLSNDNKYILVNLLNQEIRLWNIEGDPK--IVSRYKGHKRSRFIIRSCFGGYKQAFIASGS----EDSQVYIWHRSTG--KLIVELPGHAGAVNCVSWSPTNLLASASDDGTIRIWGLDRINQQNQKKLVQGSSSNGVIHRCN 587
22 -58.500[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  17  5.........................................................................................................................LLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSV-----------NGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALL-------KTNSAVRTCGFDFGGNIIMFSTDKQCFVSFFDLRDPSQIDNNEPYM----------KIPCNDSKITSAVWGPLGE--CIIAGHESGELNQYSAKSGEVLV----------NVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQ-------KTFRTERPVNSAALSPNYDHVVLGGGQEAGKFEARFFHLAFE--EEFGRVKGHFGPINSVAFHPDGKYSSGGEDGYVRIHYFDPQYFEFEFE............... 324
23 -57.600[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali follow..  14  90..........................DVVQMRQQAFGEKLTQQQASAAATEASAMAKAATMTPAAISQQNPPKN------------REATVNGEENGAHEINNHSKPMEIDGDVEIPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQRHCIREGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTENGNLA-------STLGQHKGPIFALKWNKKGN-YVLSAGVDKTTIIWDAHTGEAK----------------QQFPFHSAPALDVDWQNNMT---FASCSTDMCIHVCRLGCDHPVK----------TFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDAC------VHDLQAHSKEIYTIKWSPTGPATSNPNASASFDSTVRLWDVEQG--VCTHTLMKHQEPVYSVAFSPDGKLASGSFDKYVHIWNTQSGSLVHSYQ--GTGGIFEVCWNAR 504
24 -57.600[S] KOG0295 WD40 repeat-containing protein  ali follow..  15  9..................EEINRAIAEYMQNNGYSESFSVFLKESSLSENDIKPLGGILE----------------KKWTTVLRLQRKVNDLESKLQESQREINHGAPTRDKRQAAPPETQKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYE-----------TGQLERTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLWDFGQTYDCLK-----SLKGHEHTVSSVTFLPTGD-FVLSASRDHTIKQWDISTGYCV----------------YTFRGHNDWVRMIRISNDGT--LFASASLDQTVTVWSFATKSAKL----------VLRDHEHAVECVEWAPDTAYLFSGSRDRSIKAWNINTGD------VLFTLLAHENWVRGLAFHPKGKYLISVA----DDKTLRVWELSAQ--RCMKAIEAHEHFVSTVAFHQTSPVITGSVDMSCKVWECR........................ 404
25 -57.600[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  16  5.................................................................................................................ELPTKEAHILKGHEGAVLAARFNGDGNYALTCGKDRTIRLWNPH-----------RGILIKTYKSHGREVRDVHVTSDNAKFCSCGGDRQVYYWDVSTGRVIRKFR------GHDGEVNAVKFNDSSS-VVVSAGFDRSLRVWDCRSHSVE----------------PVQIIDTFLDTVMSVVLTKTE--IIGGSVDGTVRTFDMRIGREMSDN------------LGQPVNCISISNDGNCVLAGCLDSTLRLLDRTTGE--LLQVYKGH--ISKSFKTDCCLTNSDAHVIGGS----EDGLVFFWDLVDA--KVLSKFRAHDL-VNSIDVDFYLRFFVAGDKRELPPEGRLYVDFFGRWILTSIDFVIYVSNSPF 337
26 -57.100[R] KOG4227 WD40 repeat protein  ali follow..  11  5...................................................................................AGLGGSMRSVVGFLSQRGLHGDPLLTQDFQRRRLRGCRDLLGHFGCVNAIEFSNNGQWLVSGGDDRRVLLWHMEQA------IHSRVKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETLDVF-------AHEDAVYGLSVSPVNDNIFASSSDDGRVLIWDIRESPH--------------GEPFCLANYPSAFHSVMFNPVEPR-LLATANSKEGVGLWDIRKPQ-------SSLLRYGGNLSLQSAMSVRFNSNGTQLLALRRRLPPVLYDIHS--RLPVFQFDNQGYFNSCTMKSCCFAGDRDQYILSGS---DDFNLYMWRIPADPNGAFMVLKGHRSIVNQVRFNPHTYICSSGVEKIIKIWSPYKQPGCTGDLDGRIEDDSRCLYTHE 387
27 -57.100[R] KOG0288 WD40 repeat protein TipD  ali follow..  18  135..................LEIRSQLEEMTSRVQKAETENKMLIDRWMLQKMQD------------------AERLNEANDLYEEMLAKLKANGLETLARQQVDGIVRRNEDGTDHFSTCANRIHAHEGGCGSIVFEYNSGTLFTGGQDRAVKMWDTN-----------SGTLIKSLYGSLGNILDMAVTHDNKSVIAATSSNNLFVWDVSSGRVRHTLT------GHTDKVCAVDVSKFSSRHVVSAAYDRTIKLWDLHKGYCT-----------------NTVLFTSNCNAICLSIDGL--TVFSGHMDGNLRLWDIQTGKLLSEV----------AGHSSAVTSVSLSRNGNRILTSGRDNVHNVFDTRTLE--ICGTLRASGNRLASNWSRSCISPDDDYVAAGS----ADGSVHVWSLSKG--NIVSILKEQTSPILCCSWSGIGKLASADKNGYVCTWT.......................... 515
28 -57.000[T] KOG4378 Nuclear protein COP1  ali follow..  11  1.................................................................................................................................MMSNLVEPSWRLLAASGGD-TVKLFDVSADS-------GDPCVLSYTPSPGCAVNSVKWNHTNLVVASTGEDKKISLWRKNGQSLGTVVTGKDGGDSAEECLSAISFSKKGSRYICSGGTGQIVKIWDLQRKLCI----------------KKLKGHTSTITGVMYNCKDE--HLASVSVGGDLIVHNLASGARATELKDPNG---QVVQFVHVLRLLDYSRSSRHLVTAGDDGTVHLWDTTGRSPK-----MSWLKQHSAPTAGVCFSPSNEKIIASVG---MDKKLYTYDSGSR---RSSSCIAYEAPFSSLAFGDNGYLVAGTSNGRVVFYDIRGKPQPVTVLHSNSEDVTSLSWQTS 326
29 -56.600[R] KOG0289 mRNA splicing factor  ali follow..  15  108.YQHDAACRVIARLTKEVTAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQK-----------------LQDKATVLTTERKKRGKTVPEELVKPEELVASHVGLHSASIPGILALDLCPDTNKILTGGADKNVVVFDKS-----------SEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVR------AHESAVTGLSLHATGD-YLLSSSDDQYWAFSDIQTGRVLTKV--------------TDETSGCSLTCAQFHPDGL--IFGTGTMDSQIKIWDLKERTNVA----------NFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLK-----NFKTLQLDNNFEVKSLIFDQSGTYLALGGT------DVQIYICKQW--TEILHFTEHSGLTTGVAFGHHAKIASTGMDRSLKFYSL......................... 504
30 -56.300[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  11  2...................AEEEENQELYIAENEVEEVKLMDQGVTEDEAEQEQNDTMNNMVMDMSV----------------QGFFEHKDSVFSVSINPVHSNLCASGGGWDITTGEQICQLTGHKDSIVAIDWSFDGTYIATGGMDSQVRLWKSS-----------TGFEFITAFETVDEIVWLSWHPKGLFLAAGCNDGSIWMWSLPSGKVVQVMY------GHTAPVNAGKFIPPGVKRLATVDDSGTLIVWNPATGAPECRMSSDDH-----RFDPGNEETAAGWTSFDCNAEGN--VLFLGGSSGKVKVVNINSSHILA----------SLEAQTESVEAIALCTALPICACASVDGTVALYDSASLKFR-------KSLPHEQAVIDCKFLPNTPYLLTAC----ADCVIRKWDVRSG--QLLGEYTGHQEPILCMAITPDGKVVTGSDDTELLVFDCEH....................... 399
31 -56.200[R] KOG1334 WD40 repeat protein  ali follow..  13  270.......................................................................................................................QYLLGSHAGSVSTIHFNQRGTRLASSGDDLRVIVWDWVRQK----------PVLNFESGHDINVIQAKFFPNDSTLAMCGHDGQVRVAELINASYCENTK---RVAKHRGPAHELALEPDSPYKFLTSGEDAVVFTIDLRQDRPA-----------SKVVVTRENDKKVGLYTISMNPANIY-QFAVGGHDQFVRIYDQRRIDKKENNGVLKPHHLVYCDFPTNITCVVYSHDGTELLASYNDEDIYLFNSSLSDGAQYVKRYKGHRNNDTIKCVNFYGPRSEFVVSGS----DCGHVFFWEKSSS-QIIQFMEGDRGDIVNCLEPHPYLPLATSGLDQHVRIWTPTAKTA--TELTGLKDVIKKNKQERD 614
32 -55.700[R] KOG1539 WD repeat protein  ali follow..  12  111.EHVLSLDVEGNMFIWAFKGIEEHLAQLTGKFTPTSIVHPDTYLNKVLVGSQEGPLQLWNI----------------NTKKMLYQFKGWGSSVTSCVSSPALDVVAIGCADGKIHVHNIKTFEHASRGAVTALSFSTDGRLLASGGSFGVISIWNLNKKRLQSVIR----------DAHDSSIISLNFLANEPVLMSASADNSLKMWIFDTNDGDPRLLR--FRSGHSAPPLCIRFYSNGR-HILSAGQDRAFRLFSVIQEQQSRELSQRHISRRAKKLRVSRNHLLLAILACAISACGN--FAVVGTAGGWIERFNLQSGISRGSYFDMSE--KRRYAHDGEVIGVACDSTNTLMISAGYHGDLKVWDFKKRELK-------SQWDVGCSLVKIVYHRVNGLLATVA----DDFVIRLYDVVTL--KMVREFRGHTDRITDLCFSEDGKVISSSMDGSLRIWDVILAKQIDGV--HVDVPITALSLSPN 630
33 -55.600[R] KOG2096 WD40 repeat protein  ali follow..  14  2....................................DSVLVVGIASVILGALIAVLFFGSYFR----------------KRTSEVQSMAKAEPQDPIRNPKSNHPAPKKNHPKSQASDKNQTLKGHGDAVTGLCFSSDGKSLATACADGVIRVFKLDDASSKSFNCFLKFRFLRINLPAGGHPTAVAFADDASSIVVACHHMSSIKWDHHHIHEKRSVL------TISGATATYGTADGSV-VIASCSEGTDIVLWHGKTGRNL----------------GHVDTNQLKNHMAAVSPNGR--FLAAAAFTADVKVWEIVYQKDGS--VKEVSRVMQLKGHKSAVTWLCFSPNSEQIITASKDGSIRVWNINV-TLKVFPIPLCDSGGNPLHYDRLSLCPEGKILAASH-----GSTLQWLCAETG-NVLDTAEKAHEGDITCISWAPKAILGTSGDDKKVKLWEAPKSQSL................... 454
34 -55.400[R] KOG2055 WD40 repeat protein  ali follow..  10  104............................SDDERLMISLQDHSRLRKLRQYEDEDMVNGLQYARKKQDVTEEEDEFNALSEKSVIPKSLKSLFKSSVSYINQSSKLLAPGTINIKRLKD-ANFQAPSHSGIRCMSIHPYFPLLLTCGFDRTLRIYQLDG---------KVNPLVTSLHLRSSALQTALFHPDGKRVIAAGRRKYMYIWDLESAQVQKVSRMYG-QENFQPSMERFHVDPTGK-YIALEGRSGHINLLHALTGQFATSFK-----------------IEGVLSDVLFTSDGS--EMLVLSYGAEVWHFNVEQRSVVRRWQ---------VQDGVSTTHFCLDPSNKYLAIGSKSGIVNIYDLQTSNADAAPKPVTTLDNITFSINSMSFSQDSQVLAIASR--GKKDTLRLVHVPSFS-RNWPTSATPLGRVTCLAFGKGGELCVGNEAGRVGLWKLAHYDLKFVP---DKIINWEIRLGKF 537
35 -54.500[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  11  8.NNLMEKVLPPVEQVLTWTLIQI-CMQESDVELETKVKKYLRGEGANLETLKDKKLKTQLASREKLY----------------GKSAKAAAKIEKWLLPAEAGYLETEGLEKTWRVKQTD-DIVLPDFGPYKLDFTASGRHMLAGGRKGHLALLDMMNMS------------LIKEIQVRETVRDVAFLHNDQFFAAAQKKYAYIYGR--DGTELHCL-------KERGPVARLRFLKNHF-LLASVNMSGQLHYQDVTHGGMV----------------ASIRTGKGRTDVMEVNPYNS--VVGLGHSGGTVTMWKPTSQAPLVQM----------QCHPGPVSSVAFHPNGHLMATSGKERKIKIWDLRKFEE---------QTIHSFHAKTLSFSQKGLLAAGTG------SFVQILGDSSGGSSHNYHSMVKGYQIEKVMFRPYEDIGIGHSMGWSSILIPGSGEPNFDSWV--ANPFETSKQRRE 432
36 -54.400[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  10  245..CAVDDSNDHVLSVWDWQK-EEKLADVKCSNEAVFAADFHPTDTNIIVTCGEITSLLLDTRRKLPLIRSKD-------------RTRKAKVVLCVTFSENGDTITGDSSGNILVWGKGTAVQGAHEGGISPLCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIPESGDFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWD-------KIIEDPAQSSGFHPSGS-VVAVGTLTGRWFVFDTETKDLV----------------TVHTDGNEQLSVMRYSPDGN--FLAIGSHDNCIYIYGVSDNGR------KYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRPEGSDGTDINAVCRAHEKKLLSTG----DDFGKVHLFSYPCQFRAPSHIYGGHSSHVTNVDFLCEDSISTGGKDTSIMQWRV......................... 716
37 -54.400[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  17  2.........................................................................................................................SLCGHTSPVDSVAFNSEEVLVLAGASSGVIKLWDLE-----------ESKMVRAFTGHRSNCSAVEFHPFGEFLASGSSDTNLRVWDTRKKGCIQTYK------GHTRGISTIEFSPDGR-WVVSGGLDNVVKVWDLTAGKLL----------------HEFKCHEGPIRSLDFHPLEF--LLATGSADRTVKFWDLETFELIG----------TTRPEATGVRAIAFHPDGQTLFCGLDDG-LKVYSWEPVIC--------DGVDMGWSTLGDFCINEGKFIGCSY----YRNSVGIWVSDISGPRGSVSPDYETREIKNIYVDSTGGLNVAQNPGSLKATLPLESGKVATM---VSEKQNAAYFGPA 342
38 -54.300[S] KOG1407 WD40 repeat protein  ali follow..  17  2..................................................................................................................................................EETTIPFKSLH---------------SREYQGHKKKVHSVAWNSNGTKLASGSVDQTARIWNIEPHGHSKAKDL--ELKGHTDSVDQLCWDPKHSDLVATASGDKSVRLWDARSGKCT-----------------QQVELSGENINITYKPDGT--HVAVGNRDDELTILDVRKFKPLH-----------RRKFNYEVNEIAWNMPGDFFFLTTGLGTVEVLSYPSLKP------LDTLTAHTAGCYCIAIDPKGRYFAVGS----ADSLVSLWDISDM--LCLRTFTKLEWPVRTISFNYSGEIASASEDLFIDIANVQTGRTVHQI--PCRAAMNSVEWNPK 285
39 -54.300[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  11  2........................................................................................................................SLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQ----------VKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGV----WKPTLVILRINRAATFVKWSPLEN-KFAVGSGARLISVCYFEAENDW-------------VSKHIKKPIRSTVLSLDWHPNNV--LLAAGSCDFKCRVFSAYIKEVDEKKASTPMSEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQ------VSTLKTEFLPLLSVSFVSENSVVAAGH-----DCCPMLFIYDDRGDRNTALETLHQNSITQVSIYEVDKFCTTGIDGAMTIWDFKTLESSIQGLR.............. 368
40 -54.200[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  76.DVFAVSTSDGKINILSRN--GKVENMVDAHNGAALCARWNSDGTGLLSSGEDGFVKMWSR-----------------SGMLRSVLAQFATAVYCVAWDSTSSNVLYCNADKSLKMQVAPIKWKAHDGIILCCDWNPTSDLIVTGGEDLKFKVWDG------------FGQILFNSSVHDYPITSISWNTDGTLFAVGSHN-ILRLCDKSGWS-------HSLEKMNAGSVMALSWSPDGT-QLAVGTAAGLVFHAHIIDKRLTIVVTSSHIYIYSSKNWNTPTMIEYNERTVNIIVQCEK--IFLVSDGMTITIFTYEGRKL------INLNPPGQVMALLDERKIDLANDTLVVRDRADNKVLHFFDPTTGKA-----QGDGNLKHEHDIVELTVNQCGPLNDRNVAFRDQIGAVHIAMVKTF--GVSQRMVKIGSLVEQLVFNDVTNMLCGISEGKIAVWPLPNVAFHDRNLLQKSLIQKNIGSVGK 557
41 -54.200[YU] KOG2445 Nuclear pore complex component (sc Seh1)  ali follow..  14  2.......................................................................................................................QPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDK-------DTSNWELSDSWRAHDSSIVAIDWASPGRIIASASYDKTVKLWEEDPDQEECSGRRLCTLNDSKGSLYSVKFAPAHGLKLACLGNDGILRLYDALEPSDLRSWTLTSE---MKVLSIPPANHLQSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKDGKLHVAA-------KLPGHKSLIRSISWAPSYQLIATGCKDGRIRIFKITEKLSPLASE------ESLTNSNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQ--VELLSEHDDHNGEVWSVSWNLTGTLSSAGDDGKVRLWKATYSNKCMSVITAQQ........... 349
42 -53.700[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  15  7..............................................................................................................DSVVRSFKVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCE-----------KGTQSRTVNSKKYGVDLIHFTHANNTASSTKVDDTIRYLSLHDNKYLRYFP------GHTKKVISLCISPVED-TFLSGSLDKTLRLWDLRSPNCQGLM------------------HLSGRPIAAYDPEGL--IFAAGVNSESIKLYDLRSFD-----KGPFVTFKLNQEKECDWTGLKFSRDGKTILISTNGSVIRLVDAFHGTPLQTFT----YPNNKGIPIEASFSPDSQFIFSGS----TDGRVHIWNADTG-NKVSVLNGDHPGPVQCVQFNPKYMLASACTNMAFWLPTSEEG...................... 316
43 -53.600[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  11  4.........................GMMRGNQMPNVTLTIQPSTSSMQNSQPRIMNNHHHPHNRFQREHVMPDVMGDGPGRENRLWQYGKQRILQQPDILYQQYAVPADSTPDVPVDCILTAMNKVKCPVYSVCWSPEGKRLITGCQTGEFTLWNGT-----------AFNFETILQAHDSAIRALKWASNEQWLLSADQGGYVKYWQPNMNNAHMFSA------HKDEAIRGLAFAPTDV-KFATASDDGTARVWDFARYTEE----------------RVLRGHGAEVRCIDWHPTKGLIATGSRDTQQPVKIWDPKSGSCLA----------TLQEHKSSVMAVEFNKNGNWLLTGGRDHLVKMYDIRMMKE------MRTYRAHKKEVISLAWHPIHEGLFVSGG---GDGSIVYWMVDGE-KEIGLLEHAHDQAIWSMKWHPLGHLATGSNDNNTKFWARNRPGDTVENMIGHLDKEREPRMAPP 451
44 -53.300[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  10  7.LILATGGYDHTIKVWQAHTGNCIKTMRFVETSQVNALDRTPDKTRLAACGY-QCIRLYDLESNC---------------------------------------------------TAPVINFDGVQKNVTRLGFQEDGNWMFTAGEDHHVRIWDMIAAP----------PHCSRIFDCEAPVNAACLHPNQVEIAMGSQNGSVFLWDVKSERHERIVP------EVDASIQDVAISPDGR-YLAAANNKGNCYIWSLTSQD---------QKMSTLRPNRKIPAHSRYILRCKFSPDSR--LLLTTSGDGTVCIWKTDDFSKWREL----------CIENYWVWDAAFSADSKWLFTASSDGIARLWKLQTKSS------IRDYTGHTKAITALSFKDEIPVKSTNI----SDVQSSAKPPT--------QRDNPPGTNNLAFFETVGRAMNPYMGNTTTELN.......................... 362
45 -53.300[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  10  1............MKVKMLSRNPDNYVRETKLDLQRVPRNYDPALHPFEVPREYVRA-------------NATKLERVFAKPFLASLDGHRDGVNCLAKHPEKLATVLSGAC-NLTQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPG--------YGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMT------WGFDSISSVKFNPIETFLLGSCASDRNIVLYDMRQATPL-----------------KKVILDMRTNTICWNPMEAF-IFTAANEDYNLYTFDMRALD---------TPVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVY-----HTKRMQHVICVKWTSDSKYIMCGS----DEMNIRLWKANAS--EKLGVLTSREKAAKDFQHYPHIKRIARHRHLPKSIYSQIQEQRIM-KEARRRKEVNRIKHSKP 427
46 -52.900[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  17  1...............................................................................................................MSAVCGGAARMLRTPGRHGYAAEFSPLPGRLACATAQGTLLILDPDE----------AGLRLFRSFDWNDGLFDVTWSENNEVLITCSGDGSLQLWDTAKAAGPLQ-----VYKEHAQEVYSVDWSQTRGQLVVSGSWDQTVKLWDPTVGKSL----------------CTFRGHESIIYSTIWSPHIPG-CFASASGDQTLRIWDVKAAGVRI----------VIPAHQAEILSCDWCKNENLLVTGAVDCSLRGWDLRNVRQPVF-----ELLGHTYAIRRVKFSPHASVLASCS----YDFTVRFWNFSKP-DSLLETVEHHTEFTCGLDFSLQSPVADCSWDETIKIYDPACLTIPA.................. 323
47 -52.800[R] KOG1273 WD40 repeat protein  ali follow..  16  20...........................................................................................................................YLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDFE-----------TRGIAKEIRDNSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTI-------LQQTPLQARLNPGSPSLCLACPLSSAPMIVDFDIDCTTLLPVSVPEMPDPQRSKCPESNPPFSPAAACFNKCGD--LVYIGNSKGEILIVDYKSVRVLALVS---------ASGAAPVKNIVFSRNGQYLLTNSHDRTIRIYENLLPAKNKMKTVGSKCLTTKMHWKAPCFSGDGEWVVGGSACKG-EHKIYIWDRA---GHLVKILEGPKEALIDLAWHPVHPIVSVSLAGLVYIWAKDYTENWSAFAPDFKELEENEEYVER 371
48 -52.800[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  10  1....MAQPYLPAEKFLSRK--QETILLDEDEPAVVSSVRISPKKPYHVATTSSVRLTLYDTVV-----------------------------------------------------CEPLNLFSRFKKGVCSIDFRHDGRLLAIGGDEGKVRIFDVEKT------TGSSKVALRVMQASQSTVKSVHFSPRGDTVFSMADDGKIKQYRVADTAYGVNAVPIIEIQAHEDAIRCGAVSSINDHIVLTGGYDHKVRLWDIRSKEKSLEL-----------------DCEHPVESVLFLPGEQ---LIATAAGPIVKIWDTTTGRQLT----------ALQAHYKTVTSLRLATNSTCLLSAGIDRRVNAFRTTNYSL--------NSWSMPSPVLDIDVSRDDQTMAIGMG----NLLALYRRAEIKKNADKLKIPKIDGMLSNFKHAAVIKFRSAMDTAVVSYLRVVMRGAIHRALAGQERSVQKNILV.. 428
49 -52.400[T] KOG1354 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  1....MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQEN--------------KIQSHSRGEYNVYSTFQSHEPEFDYLKSL----------------EIEEKINKIRWLPQKNQFLLSTNDKTIKLWKISERDRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSAD-DLRINLWHLEITDRSFNIVKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGR---YMMTRDYLSVKIWDLNMENQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITL------EASRENNKPRTVLKPRKVCASGKRKKDEISVDSL----------------DFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN...................... 447
50 -52.400[R] KOG2394 WD40 protein DMR-N9  ali follow..  10  37.KYKLHYEKTHSSGLLHYAHGKTVTQAQLKERAAPSTPTGTSSGYSASSGFRSATARLLGTGNGSRANGGGKSVSTSSRISGSFAASNSNTSMTNTNFDGKGTYLVFNVSDLNSQEKDPVKSIHFSNSNPMCHAFAKDGHDLLIGLNSGDVYTVSLRQQLQDVSKKLVGALHYNSVNNRQDRCTSISWVPSTFPAIRDPTQFSVDKAKYSKSNPVARWH------ICQGSINSIAFSNDGA-HLATVGRDGYLRIFDFLTQKLV----------------CGGKSYYGALLCCSWSMDGK--YILTGGEDDLVQVWSMEDRKVVA----------WGEGHNSWVSGVAFDSNWSRFGSVGQDTQLLLWDLEM------DEIVVPLRRAPGGSPTYSTGSSAHWDNVIPM-GTLQPAPCKRDVPKL--SPIIAHRVHTEPLSGLMFTQES-VVTACREGHIKIWTRPSESETQTNSSNPTTALLSTSFTKD 539
51 -52.400[A] KOG0299 U3 snoRNP-associated protein (contains WD40 repeats)  ali follow..  11  19..................ATSKREKENQKLERNGPANEDLASISSESEFNGFEDEIDEENEDTYETAAEKRLRLARE-DEVKNELVEDGGFDAKEVDRELLASRLKEDVLEKKGQMIETAQLRGRHMRPLVGVVAYENF--VYSADKSGLIQKWEALQEKDTENRENKFSRSRRGENDHVKEITCLAISNDGRWIVTGGLDHRIVIRDSVTLEPQHCWK------HHRDAVMGLAMRRGTNE-MFSCSADRSIKVWSLDQMSYI----------------ETLFGHQDVIFGVDALARER--CVSVGGRDRTSRLWKIVEESQLV-FRSGGTSMKATAGYMEGSVDCVAMIDEDHFVTGSDNGVIALWSVQRKKPLFTYPLAHTIPPQPRWITSLAAIPYSNLFASGS----WDGNIRLWKIAEGLRSFEPLPLSVYGCINSLSLSLQGKFAACGRETRVGRWKTLRGIPNSGF--VFNIPLTVIPSVTD 518
52 -52.200[U] KOG1332 Vesicle coat complex COPII, subunit SEC13  ali follow..  19  7.............................................................................................................................................................................TVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILI----ADLRGHEGPVWQVAWAHPMGNILASCSYDRKVIIWREENGT---------------EKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEG-------QWEVKKINNAHTIGCNAVSWAPAVKRFASGGCDNLIKLWKEEEDGQ----KEEQKLEAHSDWVRDVAWAPSTSTIASCS----QDGRVFIWTCDDASSNSPKLLHKFNDVVWHVSWSITANLAVSGGDNKVTLWKESVDGQISDVNKGQGSVSASVTEGQQ 319
53 -51.900[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  13  391.......................................................................................................................SRYLRERFLRCLDLYLCPRAKRVKLNIDAEYLIPKLPSPRD----LQPFPTVESMVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCIRTI-------ETDEVVRCVAWCPNPKLSIIAVATGNRLLLVNPKVGDKVLVKKTDDEADEQEKGVRVVITHFKPIRQVTWHGRGD--YLATVMPEGANRIHQLSKRRSQIPF----------SKSKGLIQFVLFHPVKPCFFVAT-QHNIRIYDLVKQE------LVKKLLTNSKWISGMSIHPKGDNLLVST----YDKKMLWFDLDLS-TKPYQTMRLHRNAVRSVAFHLRYPFASGSDDQAVIVSHGMVYNDLLQKLQTHEFGVLDVNWHPV 767
54 -51.900[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  11  3.AIINQRVEQGESSMGG--AKPALLHRITGHVARINDVILLSKDEGVWTASDDRSVRLYLKRDNDQFWPS---------------------------------------------------IHHFMPVAPTSLYYSEETYKLLVGLINGNVYEFSVAD-------DFNSMTESRKWTCHAGPISGLGFALSSELIFSCSRDKSIVWHCSENSNKM---------GSYLLENSCTAMVIDLPF-VFVGDHGGHVTVLRIVDNQPNL--------------VSKLSAHTNAITSLTWDGNKK--VLYSGSSDHLIIMWDIGGGRGEA---------YELNGHNGKVTTLCAAPAAKRLFSADEHGKLMCWDMNCKRVETPEWKTSDCCRTCGSAVCGSCCDNWTTYPPMGY----ETKIRICNDCNANLTPLAIPHEIHTGITAMHLQETLGLVTSGQNRVIMIWDVRSVCSAPS................. 412
55 -51.500[Z] KOG0313 Microtubule binding protein YTM1 (contains WD40 repeats)  ali follow..  16  34..............................................................................SNIINKLLKDKNEFHKHVEFLIKGQFLRMPLDKVEKCTAPQPEQCMFHDDWISSIKGAEEW--ILTGSYDKTSRIWSLE------------GKSIMTIVGHTDVVKDVAWVKKDSLLLSASMDQTILLWEWNVER--NKVKALHCCRGHAGSVDSIAVDGSGT-KFCSGSWDKMLKIWSTVPTDEEDEMEESTNRPRKKQKTETLSGHMEAVSSVLWSDAEE---ICSASWDHTIRVWDVGSGSLKSTL-----------TGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSL---SLTSHTGWVTSVKWSPTHEQQLISGS---LDNIVKLWDT-RSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTS.................... 419
56 -51.400[S] KOG4328 WD40 protein  ali follow..  15  168.....................................................................................VKKEEPEDDSFSDYVNKEFSIPVKPELDLLTLEPQNVARVVPGRIFVVQFLPNVKMVAAGDKLGNVGFWNLDCGNE------EDNDGIYLFTPHSAPVSSIVFQQNSSRVISSSYDGLIRLMDVEKSVFDLVY-------STDEAIFSLSQRPNDEQSLYFGQDYGVFNVWDLRAGKSV----------------FHWELHERRINSIDFNPQNPH-VMATSSTDGTACLWDLRSMGAKKPKT------LSTVNHSRAVHSAYFSPSGLSLATTSLDNYIGVLSGANFEN--TCMIYHNNTSRWISKFKAVWGWDDSYIYVGN----LSKKIDVINPKLKRTVMELHNPLQRAIPCRIHCHPYGTLAGSTAGGQVYVWTTK........................ 516
57 -51.200[S] KOG0281 Beta-TrCP (transducin repeats containing)/Slimb proteins  ali follow..  16  148...........................................................................SESRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRRIQCRSENSKGVCLQYDDEKIISGLRDNSIKIWDKT-----------SLECLKVLTGHTGSVLCLQY--DERVIVTGSSDSTVRVWDVNTGEVLNTLI------HHNEAVLHLRFSNGL---MVTCSKDRSIAVWDMASAT-------------DITLRRVLVGHRAAVNVVDFDDK----YIVSASGDRTIKVWSTSTCEFVR----------TLNGHKRGIACLQY--RDRLVVSGSSDNTIRLWDIECGA------CLRVLEGHEELVRCIRF--DNKRIVSGA----YDGKIKVWDLQAASTLCLRTLVEHSGRVFRLQFD-EFQIISSSHDDTILIWDFLNVPPSAQN-ETRSPSRTYTYISR. 508
58 -51.200[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  13  126.RQINVSTDDTEIKSNGPAERRRRLKELLAGLGENAINKRQYEDEERKQQQREQDQATWYHEGPDSLRIARLWL----------ADYSLPRAKDRLVRAREALEVPSAARAGRMVELAPLCSQVGDTRPVSSAAFSEDSSLLLTSSWSGLCKLWSVP-----------DCELKQTLRGHASYVGGVALRPGVKAMASGGHDGAVKLWGFNNEESIADIT------GHPHRVSKVAFHPSGR-FLATACYDSSWRLWDLEQKTEVL----------------HQEGHAKPVHCLSYHSDGS--VLVTGGLDAFGRVWDLRTGRCIM----------FLEGHLGAVFGVDFSPNGFHIATGSQDNTCKIWDLRRRQP-------YTIPAHTNLISDVKYQQEGSFLVTCS----YDSTTKIWSNKTW--QPLKTLQGHDNKVISVDIAPNSQIATTSFDRTFKLWSPDS....................... 553
59 -50.300[S] KOG0283 WD40 repeat-containing protein  ali follow..  10  235.SVMSNARVGAFFLIKNLDTGKEFIVNEYDEDGMWNRLSDLQTGKQLTLEEFEKCVGYSPVVKE------------LMRRENVNRINYEPLMDLRKFNSYLSKSVRLSKRRGAALLKNIKGVVADKDVSDGSTDSPKKGKDHKHGKANEWVKVRPTGKSYK----ELSALHMCQEIQAHEGAVWTIKFSQDAHYLASGGADRVIHVWEVQECELMSMNEGSLSLKGHLDAILDLSWSKSQL--LLSSSMDKTVRLWDIETKTCL-----------------KLFAHNDYVTCIQFSPVDEN-YFLSGSLDAKIRIWSIQDRHVV-----------EWSDLHEMVTAACYTPDGQGALIGSHKGICRAYDTEDCKLSQTNQISNKKSQAKRKITSFQFSPVNPSEVLVTS---ADSRIRILDGSEV--IHKFKGFRNTCSQLSASYSQDGKIICASEDSQVYLWKNDFHRTRSTLTTQSHE.......... 726
60 -50.200[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  14  1.................MDSGMRATCTVPEHFLPRKLSKQNLDRFIPNRSAKDFDFANYALTQGSKRNLDEVQLAVVMNQNRTRILAFRNKPKSLLSTNHSDSPHQNPKPVKPRRYIPQNSPGLRDDFSLNLLDWGSANVLAIAL--GDTVYLWDASSG---------STSELVTIDEDKGPVTSINWTQDGLDLAVGLDNSEVQLWDCVSNRQVRTLR-------GGHESRVGSLAWDNH-ILTTGGMDGKIVNNDVRIRSSIVE---------------TYLGHTEEVCGLKWSESGN--KQASGGNDNVVHIWDRSLASSKQ----TRQWLHRFEEHTAAVRALAWCPFQASLLATGGDGKIKFWNTHTGAC--------NSVETGSQVCSLLWSQSERELLSSHG--FTQNQLTLWKYPSM--SKMAELNGHTSRVLFMAQSPNGCVASAAGDENLRLWNVFGEPPKT--TKKAASKKYPELFSHV 440
61 -50.000[R] KOG1310 WD40 repeat protein  ali follow..  13  2...................................................................................DNLSFHDGNIFNLLHTRSQDPSHEVDQRMQFHSSSQEQELEGHQGCVNALAWNSNGSLLISGSDDLRINIWNYSSRKLLHSID----------TGHTANIFCTKFVPEDELVVSGAGDAEVRLFNTSRLSGRAEDDNAILYQCHTRRVKKLAVEPGNPNVVWSASEDGTLRQHDFRESTSCPPAGTAHQECRSVRALADPPKQTLSLKSCDISATRPH-LLLVGGSDAFARLYDRRMLPPLASSRKRMPPPSERGRTNLHLTHVTFSPNGEEVLLSYSGEHVYLMNVNNGTGIMKRRYVGHCNVGTDIKQASFLGQRGEYIASGS----DDGRWFIWEKQTG--RLMKVLVGDESVLNCIQCHPFDSVATSGIDNTIKIWSPTASVPSIV................. 697
62 -49.700[I] KOG0301 Phospholipase A2-activating protein (contains WD40 repeats)  ali follow..  12  1..MADDGLGDVPMETESMPQ-YTISHVIEAHKSDTKALAVTQGGC-LISGGRDETVKFWAKKGKQ--------------------------------------------------YTKTHAFEQPKGITVNSIAYAEDGWRLFVGRRDGTIAVFGPS-----------QAEPYAIFNEHKQNVCCLHINEKATHMLSGSWDSNVIIWPITELN--SSSFTTIVCPGHTLSVWALASFPDLPNTYLSASADKTIRMWFGDT------------------TLSVFKGHTDVVRALVVLSSSH---FLSAGNDGHIIHWDVASASILRKFATQA-----------HEFIYSMTLSDSHILTTGEDGTLEFWAIDGGKDGNLAVSEAVIQLPTTNTWDAKVLLNSDIAVAGS-----DGRIYIMTTDKNRKADDDILDAFDAEVVAKLTAKTERMQEEHETVTIKVDIDDRPTQLNKYKKGTDPGLCAQEFLSE 391
63 -48.800[R] KOG1188 WD40 repeat protein  ali follow..  14  31.................................................................................................................................TSKTVQAGKENLVAVLCSNGSIRIYDKE-----------RLNVLREFSGYPGLLNGVRFANSCDSVYSACTDGTVKCWDARVAR---EKPVQLFKGYPSNIFISFDINCNDHIICAGTDDDALLVFWDARMNSQNLS-------TTKDSLGAYSETHSDDVTQVRFHPSNPN-MVVSGSSDGLVNVFDINIDNEEDAL-------VTTCNSISSVSCIGWSGKGKQIYCMTHDEGFYWWDLNHLDTQDVREVVNMKEDALDYLIGGLYHEKTDTLHVIGG--TNKGRIHLMNCSMSGLTHVTSLGGHAATVRSFCWNVQDDLLTGGEDAQLLLWKPGAIEKTFTK-KESMKIASSVHQRVR 374
64 -48.500[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  12  1.................MASNQQPPSNLQTYGVPIYAVDWILEEAVRSKITKDQDDDDDDGSSSS------------------SYIVLSGGGGEGRSGIPNVILICRVDLHTNSLSEQPIGRRVIGTDLPYRMAIHPRQGGLICAL-PNSCRLFDWE--NIIEDDNEEESEKVVKELKDVGQQLSLSFNQDGTVLATGAEDGTLRVFEWPSMKTLLNES------KTHASVKSLTFSESGKFLVSLG--APLCRVWDVNASAAIASLS---------------KEKDEMFASCRFSVDNSGYVAANTQRGGSIITWDTTSWRRRSS---------KLIKRNNSISAFNVSADGKLLAVGTLEGDVLIIDSTKMQ-----TNQIVKKAHLGLVTALTFSPDSRCLVSVSF----DSRARLTVIKQK-GEKRRVYLWVAALLFVLVYVVLYYMVAMGII................................. 382
65 -48.400[T] COG5170 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  1..MDDIEDSLDQWKFAQCFGDKGDVED-ITEADIISAVEFDHTGDYLATGDKGGRVVLFERNHS-------------------KKGCEYKFFTEFQSHEPEFDYLKS----------------LEIEEKINKIRWCKRTNHFLLSTNDKTIKLWKLYEKNLKVVAENNLSDSFHSANAHAYHINSISVNSDAETYISAD-DLRINLWNLSISDHSFNIIKPENMEELTEVITSAEFHPINCNHLMYSSSKGNIKLLDLRQSALCDNPCKLFEDQEDQDSKSFFSEIISSISDVKFSQNGR---YILSRDYLTLKIWDVNMEKPLHDVLRSKLCDLYENDCIFDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLPGDRGQIVLQADKAAFRARKSAANNVPKLNAVKNNDWRSQPQA---AMGSASVGLDPDNLDYNKKILHASWHPFEDSVAIAATNNLFVFS.......................... 461
66 -48.300[R] KOG0646 WD40 repeat protein  ali follow..  14  2....................................................................................................EITVIASSSIDEDLKTGTEQLQFKPCASPAHGLTAVGEKFLLSARNTSGSIFYWSWTKPQ------------AEVKSYPVEPIKALAANNEGTYLVGGGISGDIYLWEVATGKLLKKWH------GHYRSVTCLVFSGDDS-LLVSGSQDGSIRVWSLIRLFDDFQRQQ-----GNTLYEHNFNEHTMSVTDIVIDYGGCNAVIISSSEDRTCKVWSLSRGKLLKNI-----------IFPSVINALALDPGGCVFYAGARDSKIYIGAINATSEYGTQVL-GSVSEKGKAITCLAYCADGNLLISGS----EDGVVCVWDPKSL--RHVRTLIHAKGSRKGPVNNIQ-KTIVANSNKTQVSWKSRGALIPPPL----EKYERPVEDTMD 356
67 -48.200[S] KOG0294 WD40 repeat-containing protein  ali follow..  15  2........................................................................................................................................PPEMEIIEATNEELLLGFKLIKSPTDGFTDSVKFELKQTFADSSYARSITSLAVQWPWVASGGTDGRIFVYDMRTRKQSQIIL------SHAGRVNTLKFTPDLS-LLLSGSDDGHMIATRVGSWTKEYDWQKAHA--------------GQAVTHVSCHPSSK--LALSLGGDQVLNTWNLVNGCVAHKTNLK-----NKATLDFQTGCLSWSKQGDHFTLSG-PLVLEIWGIENAHV--------RRIEMPSKPICITWL-DGNECLTGL----DNGNIAWISLKDEDDTPPTFILAHEVRVKAIAYLNE-FLATVSIAGQIKVWKIDMETRKLEEIARSFCRPTDLGLLD. 314
68 -47.600[R] COG2319 FOG: WD40 repeat  ali follow..  10  97..................TISLGRHSSLSRNLVNKTKNASETYQQLLEYAEVERDDNVFTYAKLQKSDMTQKCPTMVASEKDNKGKLNEKKNRSPENLLPFRILDAPE---------------LRDDFYTSLLSWSPKGDLAIGLA--ENIYLWSKELGP------------TRVLEESIYDVSSVAYSYNGDILAVGRVDGTLQFWQDNERVPRI-------SIHHPGDIGVLAWKPVETNRLLVGKGNGNIFVYDIIWSESTSK---------AVLVATITNAHDEQVCGLTWNHDGSQ--FASGGNDNRVCLFKGSDLRQPL----------YVWQQNAAVKALSFCPWQRSLLATGHDKHIRFYNCFNGKK--------DELYCGAQITSIHWSPKYREFSVGYSLETVQHRFAVYSWPQLECLVSVLPSVPDIRCVHSVLTSQLNIIIASSNETIKFFDLSEESSWHNSRTWHGIFDSQILEMLE 524
69 -47.500[R] KOG2444 WD40 repeat protein  ali follow..  10  4............................................................................................................................EFDNPPLCMKSNKDGSRLVVGFVDGSIRFYDTQQHEEE--------FQEIWKFQTKSSIRGVDLDEHKKRVYAVTKNRSLCVFDIDTGKRVRCI-----LKCHRSVPTAICTLPPKSQQLATADESGEVKTWNLDPEVASEN-----------ANIRKWQEQDEDINDLKVDVKSN---LLATSSDGTLGAYDLRKAKLKMRSELMHSEL------------YSVCGTNRSVYVGGEDGYVEVFNLNEYGNLLERVESG----FEMGVNGIVELRSGLLGLTSQ----GSNRMRLLNVQPSKRLGYADEKSDDDGIDAITISTDKSFTMISMSCTIKKWDMG--PIIDEIPILRAQDAKSKKMRKT 329
70 -47.300[DK] KOG0973 Histone transcription regulator HIRA, WD repeat superfamily  ali follow..  13  2..............................................................................................................................................................................TFVGHDTSILAIDCHPSGKKFITCTSNGLVVVWNAEKKASNENVPKLLFQVESQSQSNSCRWSPDGK-RFAFGSDDSSVSVWEYVGLINSMGITGGAQNVERYKECCVLRGHSMEVLTVEWSPNGK--YLASGSIDYRIIIYNARKLPDR---------ITVLNDIQLPVKGLSWDPIGKYLASLEGDKKLRFWATDSWQCVKSVTEPFESNIEETMLTRLDWSPDGKYLMTPAAVRSGKPLIKLIQRQT---KSDQFLAGHHKGTTCVRAMPR--AAVGSRDKSISIWVFPGTLKPLFVIN-NIFNHTVMDFAWC 328
71 -47.300[R] KOG2919 Guanine nucleotide-binding protein  ali follow..  36..................LRSGRPKNAVESPHAGVPMETSLAAEEEANGDEEEESVRVVDIEDTLEL---------------TSNGNEAKPEDQELAIAPVLQYFQGALVELGRRCWTSS---TEAQHYTKGCYWSPDGTCLLVPVHLDGMHVIEMPSDDTVQPARSLTKLQSEVHVPEGGTVYDCVWYPETCLWLATRQHEPIHMWDAFDGSLRCSYSGYDAV-DEVMAAISLAFSHDGEQIY--AGYKRCIKIFDTSRPGRFC----------------DDYPVKFAISCIAQTTAHPH-TLTCGNWHGYIQHFDLRCSHKQGPL-------FTLGGHKGGITQLRYGEFGNLFSGARKCDKILQWDMRNYKQ-PLVELQRHVDTNQR--IQFDLASDSNWLASGD----TRGFVNVWDLKKY--GDPSVLPLHSDCCNGVALNPAMPLATSSGENAVVMWWCGQTG..................... 487
72 -47.000[R] KOG0322 G-protein beta subunit-like protein GNB1L, contains WD repeats  ali follow..  13  16.............................................................................................................................DMGAVNSLCFQESDR-LLAGTIKGSVFLWDLQ-----------TNRSALHFEVGSDPITSLHHTPDR--LVTQEKGGTITMFSIGGSSYVKERSPGNHLGFCRSALHTNTSKTNEQ-LLFYPCEESSIGVLHVTDAAAPTQILVPDDPQ---------LPKLGSVTCFKPFECASQLFLLAGYESGHFLTWDISSSVILD-----------VMELAQDATSVDYDPVTNRGIVGGPTDKLISFSYQRSSMQ--MQLGSELCIKNPGVNGVRIRPDQKVFASAG-----DGRIRIFSWKSL--RPLAVLTQHNGGVMDLAFSSQQVMAAAGMDGQISLWDLYN....................... 323
73 -46.600[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  15  7....................................................................................................................SAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNS------------LKGEFLHGGAVLDCCFHDDFSGFSVGA-DYKVRRIVFNVGKEDILGTHDKAVFSILFFYTLCLFCDVTG-QVITGSWDKTVKCWDPRGASGPERT--------------QVGTYLQPERVYSMSLVGH--RLVVATAGRHVNIYDLRNM--------SQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEAAQAKKYAEAGRDIVYPVNSIAFHPIYGTFATGGC----DGFVNIWDGNNK--KRLYQYSKYPTSISALSFSRDGQLAVASSYTAIFVRSVNEIEVKPKPKVYPNP.......... 352
74 -46.200[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  13  2....................................................................................................................................SFFNRSNTTSALGTSTAMANEKDLAND-------------IVINSPAEDSISDIAFSPQQDFMFSASSDGKVRIWDVQNGVPQGR-----AQHESSSPVLCTRWSNDGT-KVASGGCDNALKLYDIASGQTQ-----------------QIGMHSAPIKVLRFVQPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPER-----------VYSMDNKQSLLVVATAERHIAIINLANPT------TIFKATTSPLKWQTRCVACYNEADGYAIGS----VEGRCSIRYIDDGNRAPGSNGQSLVYPVNSIAFHPLYGFVTAGGDGTFNFWDKNQRHRLKGY-PTLQASIPVCSFNRN 322
75 -46.000[BL] KOG1009 Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats)  ali follow..  14  7........................................................................................................................EIAWHNKEPVYSLDFQHGTARLASAGVDTNVRIWKVEKGPD----GKAIVEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWKVNDNKEPEQITVVKTLRGHLEDVYDICWATDGN-LMASASVDNTAIIWDVSKGQKI----------------SIFNEHKSYVQGVTWDPLGQ--YVATLSCDRVLRVYSIQKKRVAFNVSKMLSGIGHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTTYVFSRKNLKRPLPCPGKATLAVRCCPYRLVFAVAS-----EDSVLLYDTQQS-FPFGYVSNIHYHTLSDISWSSDGALAISSTDGYCSFVTFEKDELGIPLKEKPVLNM........ 392

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhao Y, Hong DH, Pawlyk B, Yue G, Adamian M, Grynberg M, Godzik A., Li T. The retinitis pigmentosa GTPase regulator (RPGR)- interacting protein: subserving RPGR function and participating in disk morphogenesis. Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3965-70. Epub 2003 Mar 21.