current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [R] KOG0395 Ras-related GTPase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQLast
1 -99.000[R] KOG0395 Ras-related GTPase  ali  100  1MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ 266
2 -69.000[R] KOG0394 Ras-related GTPase  ali follow..  25  1...........MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGDFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQAS-----PSDPENFPFVLIGNKVDVDDNSRVVSEKKAKAWCASKGNIPYFETSAKVGTNVEEAFQCIAKDALKSGEEEELYLPDTIDVGTSNQQRSTGC................................................ 204
3 -68.700[R] KOG0079 GTP-binding protein H-ray, small G protein superfamily  ali follow..  26  2..........AGTRDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSENYITTIGDFKIRTMDINGQRVKLQIWDTAGQERFRTITSTYYRGTHGVVVVYDVTNGESFGNVKRWLQEIENNC----------DSVQKVLVGNKCEENE-RRVVLESDARNY-AQSMNISFFETSAKEDKNVEPMFTCITSLVLTAKLANPQSASKDQSRTGGVSLKDNSGSTNQKKKCKCG..................................... 209
4 -68.100[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  24  1...........MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYAS---------ENVNKLLVGNKCDL-TSQKVVSTETAKAF-ADELGIPFLETSAKNATNVEEAFMAMTAAIKTRMASQPAGGSKPPTVQIRGQPVN-------QQSGCCSS.................................... 202
5 -67.900[R] KOG0080 GTPase Rab18, small G protein superfamily  ali follow..  20  1...........MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCT--------RNDIVNMLVGNKIDKEN--REVDRNEGLKF-ARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGAC----GGYCSVL................................... 206
6 -67.600[TU] KOG0078 GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins  ali follow..  23  2...........STKSYDYLIKLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQHAS---------ENVYKILIGNKCDC-EDQRQVSFEQGQAL-ADELGVKFLEASAKTNVNVDEAFFTLAREIKKQKIDAENEFSNQANNV--------DLGNDRTVKRCC...................................... 200
7 -67.300[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  23  3.SRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQAS---------PNIVIALSGNKADLAN-KRAVDFQEAQSY-ADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQP------TRNQCCSN.................................... 215
8 -66.800[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  25  2...........SMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGGFMIKTVEINGEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYAS---------NKVITVLVGNKIDLAE-RREVSQQRAEEF-SEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLPGEG--------KSISYLTCCN..................................... 201
9 -66.600[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  21  5.TDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSW---------DNAQVLLVGNKCDM-EDERVVSSERGRQL-ADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC....................................... 220
10 -66.400[U] KOG0086 GTPase Rab4, small G protein superfamily  ali follow..  20  1...........MAETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLAS---------PNIVVILCGNKKDL-DPEREVTFLEASRF-AQENELMFLETSALTGENVEEAFLKCARTILNKIDSGERMGSGIQYGDASLRQLRQPRSAQAVAPQPCGC.................................... 213
11 -66.100[U] KOG0081 GTPase Rab27, small G protein superfamily  ali follow..  25  2...........SDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGDFREKRVVYRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHA--------YCENPDIVLCGNKSDL-EDQRVVKEEEAIAL-AEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC.................................... 221
12 -66.000[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  25  2........LETNVDQKSFKFKIVLLGEGCVGKSSLVLRFVENKFSCKHLSTIQSFQNKTVNVEDCQADLHIWDTAGQEKYHALGPIYYRGSNGVLLVFDITDRKSFEKVKNWVLEIKTCLG---------NTAEILIVGNKIDLEE-ERQVTRQDAEAY-AESEGALYMETSAQDNVGISDAFESLTAKMIEHSRTRSTEPPSTNRSIRLIDNDE-----AERSKKCC...................................... 206
13 -65.900[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  24  2...........ASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRNERA---------GDVIIVLVGNKTDLVE-KRQVSIEEGDSK-GREYGVMFIETSAKAGFNIKPLFRKIAAALPGMESYSNTKNEDMV---DVNLKPTSNSSQGDQQGGACSC.................................... 207
14 -65.400[U] KOG0097 GTPase Rab14, small G protein superfamily  ali follow..  18  1........MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTN---------PNTVIILIGNKADL-EAQRDVTYEEAKQF-AEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPRLTSEPQPQREGCGC.................................... 215
15 -65.200[U] KOG0087 GTPase Rab11/YPT3, small G protein superfamily  ali follow..  20  2..........CQEDEYDYLFKTVLIGDSGVGKSNLLMRFTRNEFNIESKSTIGEFATRNIVLDNKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREHAD---------SNIVIMLVGNKTDLLH-LRAVSTEEAQAF-AAENNLSFIETSAMDASNVEEAFQTVLTEIFRIVSNRSLEAGDDGVHPTAGQTLNNDLNKKKSSSQCC...................................... 214
16 -65.100[T] KOG4252 GTP-binding protein  ali follow..  22  2...........LEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRGSFEAVSSWREKVVAEVG----------DIPTVLVQNKIDLLD-DSCIKNEEAEAL-AKRLRLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPN----------KQRTNKNRNPFSSCSI. 236
17 -64.900[U] KOG0098 GTPase Rab2, small G protein superfamily  ali follow..  19  1.............MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGEFGARMVTIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSN---------SNMVIMLIGNKSDL-EARREVKREEGEAF-AREHGLVFMETSAKTAANVEEAFIDTAKEIYRKIQEGVFDINNEANGIKLGPQHSPSSGGLGGGSGCC...................................... 214
18 -63.800[R] KOG0091 GTPase Rab39, small G protein superfamily  ali follow..  19  2...........VEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGDFFARLIEMDGTQIKLQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHI--------EPHRPVFALVGCKLDLINGHREVTTEEAQKF-AKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKSGFSRPNLVVAEPEKSSCC...................................... 218
19 -63.400[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  21  2........SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVC----------ENIPIVLCGNKVDVKERKVKAKTIT----FHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLE-FVASPALAPPEVQVDEQLMQQYQQEMEQATALPLP................................. 212
20 -57.300[R] KOG1673 Ras GTPases  ali follow..  16  84.PTVSGRRFGSSSDSDLVSLKISLLGDCQTGKTTFVVKYVGDEN-QSFLEMTGNLMDKTFYVQGVTISFSIWDVGGDERSKDHIPIACKDAVAILFMFDLTSRSTLNSVFGWYSQARKWN----------KTAIPILIGTKFDDPPNLQWTIVTQARAY-AKVMNASLFFSSATHNINVNKIFKFILARL............................................................................ 266
21 -56.100[R] KOG0083 GTPase Rab26/Rab37, small G protein superfamily  ali follow..  25  454....SSSKAPEEEDEFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYLSTVGDFRNKVVVVDGTRVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQ---------EDVVIVLIGNKADCSGSERQVKREDGERL-GREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGK---------FNVHDFVRDNTKARSVCAQC................................... 663
22 -52.200[R] KOG0393 Ras-related small GTPase, Rho type  ali follow..  21  2.................QAIKCVVVGDGAVGKTCLLLSYTTNAFPGEYILTVFDTYSTNVMVDGRPINLSLWDTAGQDDYDQFRHLSFPQTDVFLVCFALNNPASFENVAKWYPEVSHHC----------PNTPIILVGTKADLREDLQPVSHTQGYVMAKEIKAVKYLECSALTQIGLKQVFDEAIRTGLTPPQTPQTRAKKSN............................................................. 191
23 -41.600[R] COG2229 Predicted GTPase  ali follow..  11  2.................RENKIIFTGPVGVGKTTAIAAISDEALVQTDASASDMTLNTTVAMDDEDTKVHLYGTPGQERFNFMWEILSQGSMGLVLLLDNARTNPLKDLEFFLHSFRGLL----------EKAPVVVGITKMDIRSQPGI--DVYHKYLAKHNLNVPVFEIDARKEDDVKQLVSAMLFSIDPGLE....................................................................... 177
24 -34.400[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  15  8............SSGSPKPIRIVVVGEKGSGKSSLIMAAARNTFHP-NIPSLLPYTNLPSEFFPDRIPATVIDTSSRPEDKGKVVKEVRQADAIVLTFAFDRPETLDRLSKWLPLFRQLE----------VRVPIIVAGYEVDNKEAYNHFSIEQITSALMKQY--TSIQWSAQRLDQAKDVLYYAQKAVIDPVGPVFDQENN............................................................... 190
25 -32.000[T] KOG3886 GTP-binding protein  ali follow..  14  23.LGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDLGATILDVEHSHVRFLGN-LVLNLWDCGGQDTFMSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAIL-------QNSPDAKIFCLVHKMDLVQEDQRKEREEDLRRLSRPLECSCFRTSIWDE-TLYKAWSSIVYQLIPNVQQ...................................................................... 247
26 -31.200[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  18  18................KEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVG----NMRKITRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLD--------KPQLAGIPVLVLGNKRDLPGALDETGLIERMNLSSQDREICCYSISCKEKDNIDITLQWLIQHSKSQSR....................................................................... 186
27 -29.100[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  14  15................KEQYSILILGLDNAGKTTFLETLKKEY-LEKIQPTVG-QNVATIPVDSKQI-LKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVM--------DEEIEGVPILMLANKQDRQDRMEVQDIKEVFNKIASARDSRVLPISALTGEGVKDAIEWMIVRLERNKKSRPPIYK................................................................ 198
28 -28.900[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  19  15................DQEVRILLLGLDNAGKTTLLKQLASEDISHI-TPTQG-FNIKSVQSQG--FKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLE--------EEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK....................................................................... 182
29 -28.400[S] KOG4273 Uncharacterized conserved protein  ali follow..  13  2................ESRPGVLVVGSSGVGKRTLLSRLLSVEFEDSSESSSQEVHGWTINTKYYTADVSVCISHICDEYSLPNLPNSHPLVALVMVFDLSELSTLVALQDWVSHTDINSFDI-----------LLCIGNKVDRVP-HHLAHDEYRRRLLSDIDDFGISETEGSSLLGSEDASLDIRGACLE.......................................................................... 176
30 -28.300[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  17  19................NKEMRILMLGLDAAGKTTILYKLKLNQSVVT-IPTVG-FNVETVTYKN--IKFNVWDVGGQDKIRPLWRHYFTGTKGLIFVVDSADSNRISEARQELHRIIS--------DREMRDCLLLVLANKQDLPGALSPAQITDVLQLDKKDRLWNVQPTCALTGDGLLEGLAWLSQNAKLK......................................................................... 184
31 -28.100[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  20  15................SREMRILILGLDGAGKTTILYRLQVGEVVTT-IPTIG-FNVEQVTYKN--LKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLR--------EEELAGAILVVLANKQDMDGCMTVAEVHHALGLENKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSRK........................................................................ 181
32 -27.900[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  21  14................ERELRLLMLGLDNAGKTTILKKFNGEDIDTI-SPTLG-FNIKTLEHRG--FKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLV--------EERLAGATLLIFANKQDLPGALSSNAIREALELDSRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFT...................................................................... 182
33 -27.900[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  17  15................KKEMRILMVGLDAAGKTTILYKLKLGEIVTT-IPTIG----NVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLN--------EDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK......................................................................... 180
34 -27.800[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  19  16................NKELRILILGLDGAGKTTILYRLQIGEVVTT-KPTIG-FNVETLSYKN--LKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQ--------EEELQDAALLVFANKQDQPGALSASEVSKELNLVEKDRSWSIVASSAIKGEGITEGLDWLIDVIKEEQ........................................................................ 182
35 -27.500[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  18  18................QKEAKILFLGLDNAGKTTLLHMLKDERLV-QHQPTQH-PTSEELSIGK--IKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALLS--------DEALATVPFLILGNKIDIPYAASEDELRYHLGLTNGVRPLEVFMCSIVRKMGYGEGFKWLSQYIN........................................................................... 193
36 -24.100[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  14  57....................TVLLSGLSGSGKTVLFYQLRDGSSHQGAVTSMEVLHNENNTKKGKVKPVHLIDVPGHSRLISKLEEYLPRAAA--VVFVVDALEFLPNIRAASEYLYDI---LTNASVIKNKTPVLLCCNKTDKVTAHTKEFIRKQ-SFSHCHNKVTVAEASGLTG-ETDQVQEFIREHVK........................................................................... 259
37 -21.100[R] COG3596 Predicted GTPase  ali follow..  15  40....................VIGIMGKTGAGKSSLCNALFAGEPVSDVAACTRDPLRFRLQIGE--HFMTIVDLPGDTEYAALYREQLPRLDLILWLIKADDRALATD-EHFYRQVIG----------EAYRHKMLFVISQSDKAEPTSGGNILSTEQKQNISRKIPVCAVSVRLQWGLRVMAERMIKCL............................................................................ 216
38 -20.900[E] COG4917 Ethanolamine utilization protein  ali follow..  14  3....................RIAFVGSVGAGKTTLFNALQGNYTLARKTQAVE--------------DKGDIDTPGHPRWYHALITTLQDVDMLIYVHGANDPESRLP---------------AGLLDIGVSKRQIAVISKTDMPDADVAATRKLLLETGFEE---PMFELNSHDPQSVQQLVDYLASLTKQEEAGEKTHHSE............................................................... 159
39 -20.200[R] COG1084 Predicted GTPase  ali follow..  15  164....................TVVIAGFPNVGKSTLLRTLTGAE-VADYPFTTKGIQIGHLERKWK--RIQVIDTPGNNIELQAMVALENIADVIMFIFDASETCGYTLESQY---------SLYLGIRSVFDIPVVTVFNKMDLAENVKYLEEYINM---------DPLKVSAFEGRGVSKIIKKLEGLYEKETREAHD................................................................... 334
40 -20.000[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  12  56............PFSTEVKPRILLMGLRRSGKSSIQKVVFHKMSPNELESTNK-ICREDVSNSSF-VNFQIWDFPGQIDFFDPTEMIFRGTGALIFVIDSQDDYM--------EALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIENDDLADAGLEKIHLSFYLTSIYDH-SIFEAFSKVVQKL............................................................................ 237
41 -18.600[R] KOG2486 Predicted GTPase  ali follow..  12  118.ADYVKSSVKTEDCPADGLPEFALVGRSNVGKSSLLNSLVRRKRLALTSKK----KTQCINHFRINDKWYLVDLPGKQDWNKFTKDYFLNRSTLSVFLLVDASIPVKPIDLEYASWLGQNQ-----------VPMTLIFTKCDKRKKKKNGGKKPEANIKEFQDLIQGIMTSSVTNQGRDEILLHMAQLRNYWLKH...................................................................... 318
42 -16.500[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  15  171.....................VLICGYPNVGKSSFMNKVTRAD-VQPYAFTTKSLFVGHTDYKYL--RYQVIDTPGRNIIEMCSITALAHLRAAVLFFLDISGSCGYTIAQQAALFHSIKSLFMNK-------PLVIVCNKTDLMPMEEEMKSEAMKTAMGASEEQVLLKMSTLTDEGVMSVKNAACERLLDQRVEAKMKSKKIN............................................................. 364
43 -16.100[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  12  2................KRPLIIGVGGPVGAGKTMLIERLTRYLSTKGYSMAANDIYTEEMCDKHPDLQLLFLESGGDNLSATFSPD---LVDFSIYIIDVAQ----EKIPRKGGQGMIKSD--------------LFIINKVDLAPYVGANVEVMKADTLKSRGNKDFFVTNLKTDEGLKSVADWIEKRLQLALLEE..................................................................... 206
44 -16.100[J] KOG1191 Mitochondrial GTPase  ali follow..  16  354...................LQIAIVGRPNVGKSSLLNAWSKSEIVTEVAGTTRDVVEANVTVRG--VPITLLDTAGIRETNDIVEKAAKVADVIIMAVSAVTEEDTELLRKIQSDKVGVSFYDLFGGLLYLKQPMILVMNKIDCAPPGSCDQLED--QRKKEEVFHKSVFTSAVTGQGIEELEDAILEIL............................................................................ 533
45 -15.800[M] COG0481 Membrane GTPase LepA  ali follow..  18  2................KNIRNFSIIAHIDHGKSTLSDRLIQREMEAQVLDSMDLERERGITIDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAIEM-------------NLEVVPILNKIDLPAADPERVAEEIEDIVGID-AMEAVRCSAKTGVGIEDVLEEIVHKI............................................................................ 180
46 -15.700[R] COG0218 Predicted GTPase  ali follow..  15  27....................EIALAGRSNVGKSSFINTMLNRKNLARTSGKPG--KTQLLNFFNIDDKMRFVDVPGREKWGCMIEEYLTTRENLRAVVSLVDLRH-----------PSADDVQMYEFLKYYEIPVIIVATKADIPRGKWNKHESAIKKKLNFDPSDDFILFSSVSKAGMDEAWDAILEKL............................................................................ 195
47 -15.000[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  12  325....RNGLEQHFLFELKSIADLGLIGLPNAGKSTILNKISNAK-IGHWQFTTLSPTIGTVSLGFGQDVFTVADIPGASLDKGMGLEFLRRSNGWVFVLDLSNKNPLNDLQLLIEEVGTLEKVKTK--------NILIVCNKVDIDAEKSESFAYLQVEKFSKSQEWDCVPISALREKT........................................................................................ 499
48 -15.000[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  14  25.AGDPTKLVNLSEFTPDKIRNFGIVAHVDHGKSTLADRLLEGAVPPGQKQMLDKVKAQTAALRHRGYLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAANQGVQAQTIANFWLAFEK-------------NIQIIPVINKIDLPGADIKSVETQLKNLFEFN-PEECLHISAKSGLNVDKVLEAIIDRV............................................................................ 211
49 -14.900[R] COG0486 Predicted GTPase  ali follow..  20  228...................MKVVIAGRPNAGKSSLLNALAGREIVTDIAGTTRDVLREHIHIDG--MPLHIIDTAGLREATDEVEREIEQADRILLMLDSTEADNQDLEKVRSE-----------LTKLPSNIPVTIVRNKADLSGENEGIVEQNGYTV---------ITLSAKTQQGIALLREHLKQSM............................................................................ 387
50 -14.500[R] COG1160 Predicted GTPases  ali follow..  15  5....................VVALVGRPNVGKSTLFNRLTRTRLVADFPGLTRDRKYGHAHIAGYDFI--VIDTGGEEKMAEQSLLAIDEADIVLFLVDA------------RAGLTAADIGIANYLRQRQNKITVVVANKTDGIDADSHCAEFYQLGLGE-------EQIAASQGRGVTQLMEQVLAPFAEKMENADENDRT............................................................... 177
51 -14.100[J] KOG0469 Elongation factor 2  ali follow..  17  1MVNFTVDEIRALMDRKRNIRNMSVIAHVDHGKSTLTDSLVSKA-ETRFTDTRKDEQERCITIKYNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAE-------------RIKPVLFMNKMDRALLELQLGAEELFQTFQR........................................................................................................ 192
52 -14.000[J] KOG0468 U5 snRNP-specific protein  ali follow..  18  123..........DLMDTPPLIRNVALVGHLHHGKTTFVDCLIRQT-QLRYTDTLFTEQERGCSIKQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQE-------------RQAITVCINKIDRLILELKLPPQDAYF............................................................................................................ 278
53 -13.400[P] COG0370 Fe2+ transport system protein B  ali follow..  15  2.................SQNTYCILGNPNTGKTSLFNALTGSYEYVGNWSTVE---KKVGTLRSK--TGKLIDLPGIYDLNPISRDETVVTRFLLCMLNIVDSSQIERNLNLTVQLLEY------------GAPVVMGLNMIDVAAGR-HLNIQN----LAKKLRIPILPVVARSGKGTEDILSTLSEKHVAPAI....................................................................... 166
54 -13.100[R] KOG0410 Predicted GTP binding protein  ali follow..  16  294...RKHRKQYRSRRVAIPVPVVSLVGYTNAGKSTLLNQLTGANVENRLFATLDPTTRRVQMQNGKEFLLT--DTVG-AAFRATLEE-IAESSLLVHVVDISHPLAEQQIEAVEKVMSEL---------DVSSIPKLVVWNKVDRVDDPQKVKLEAEETGDT-------ICISALTGEGLDDFCNAVHEKLKDS......................................................................... 475
55 -12.800[R] COG1159 GTPase  ali follow..  19  11.....................IAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGPYQAIYVDTPGMEEKRAINRLMNKAADVELVIFVVEGTRWTPDDEMVLNKLRDG------------KAPVILAVNKVDNVQEKVDL-LPHLQFLASQMNFLDIVPISAETGMNVDTIAGIVRKHL............................................................................ 173
56 -12.800[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  21  183.....................VTIMGHVDHGKTTLLDKFRKTQVAAVETGGITQHIGAFLVSLPSGEKITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADD------MKQTVESIQHAKDA---------QVPIILAVNKCDKAEAEKVKKELLAYDVVCEDYGVQAVPVSALTGDNLMALAEATVALAE........................................................................... 343
57 -12.600[R] COG2262 GTPases  ali follow..  16  182...EKQREQGRQSRIKADVPTVSLVGYTNAGKSTLFNRITEARVADQLFATLDPTLRRIDVADVGETVLA--DTVG-AAFKATLQE-TRQATLLLHVIDAADVRVQENIEAVNTVLEEI---------DAHEIPTLLVMNKIDM------LEDFEPRIDRDEENKPIRVWLSAQTGAGIPQLFQALTERL............................................................................ 361
58 -12.600[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  20  95.....................ILLVGQYSTGKTTFIRYLLESDFPGIREPTTDRFIDEEGSIPGNALSVTIVDTPGGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFKRCIEALAGNE----------DKIRIVL--NKSDMVDHQQLMR.................................................................................................................. 265
59 -12.500[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  13  23LDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISTVRFKNELERNISCPRPECYRSCGSSMPDEFVDCPGHDILMATMLNGAAVMDAALLLIAGNEPQTSEHL-----AAIEIMKLKH----------ILILQNKIDLVKERQKEQYEQILAFVQGT-GAPIIPISAQLKYNIEVVCEYIVKKIPVPPRD...................................................................... 249
60 -12.200[J] COG4108 Peptide chain release factor RF-3  ali follow..  11  1....MLMSTTPYFGEVSKRRTFAIISHPDAGKTTITEKVLLFG-RGSNQHAKSDWKERGISVTTSVMLVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDAAKGVEDRTRKLM-------------EVTRLRDTPIVTFMNKLDREIRDPMELMDEVENELKIA-------SPITWPIGCGKEFKGVYHIHRDE......................................................................... 191
61 -12.200[R] COG0536 Predicted GTPase  ali follow..  16  142.....LIGEPGEAHDLILELKSMLVGFPSAGKSSLISVMSAAK------PKIGDYPFTTLQVNVGHETFTMADVPGASEGKGLGLDFLRHIE--VLVHVVDGRDPISDIEALEAELAAYQSALDEDTGDLSQRPRLVVLNKADVPEAEELA--EFLKEDIEKQFGWPVFIISAVARKGLDPLKYKLLEIVQDARKKRPKEKAESV............................................................. 355
62 -12.100[R] KOG1533 Predicted GTPase  ali follow..  15  16.VYATSEKGENLGSTHWTMYGVLVIGAPGAGKSTFCAGLTDPFLTINLDPANDTMYAPDVNIT-EMITVNIIDCPGQLELWKVIRFLEKSGVRLCALHLADSLYCSDPSKFISVALSTLATMVT-------EMPQVNCLSKADLFSEDGTYDNEAICGVISDFDLVSFVPLAVENKESMMKVIQMV................................................................................ 277
63 -12.000[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  17  3................ENLRNIAIIAHVDHGKTTLVDKLLKERVMDSND-TI---LAKNTAIKWNGYNINIVDTPGHADFGGEVERVMSMVDSVLLVVDAQD--------------PMPQTRFVTQKAFKAGLRPIVVVNKIDRPGARPDWVIDQIFDLFDN........................................................................................................ 150
64 -11.600[J] COG3276 Selenocysteine-specific translation elongation factor  ali follow..  12  1......................MIIVTSG-GKTALLKALT--------TAHLPEEKKRGMTID-ENKVLGFIDVPGHEKFLSNMLAGLGGVHYAMLIVAADEVQTKEHL-----AILRQLQFHEI----------IVVITKADRTNSAQESLIQTIKQDYSFLRNANYFVTSAETGQGISELRHYLANLAELADTQKP----RYAIDRVFSVKGAGTVVTGTAFSGTVKVNDEIYLSTGQKIRIKAIHAQNTSSEQGIAGQRLALN 235
65 -11.200[K] KOG1534 Putative transcription factor FET5  ali follow..  15  4...................VAAFVCGVASSGKSTFCGALMSSCHLVNLDPAAENF-RDLISIDDVMEELDIFDMPGQIELPALIRHLQVTLNFRPCAVYLLESQFLVDRTKFFAGVLSAMSAMVM------EVPHINLLSKMDLLKDNNNITNRCIVQLIDDFNMVNFLPLESGNEESVSRVLSYIDDATQWYEDQEPKDPDRFEADDLEDDE..................................................... 276
66 -11.100[L] KOG1532 GTPase XAB1, interacts with DNA repair protein XPA  ali follow..  18  23LDKLRVSAASSSSNFKKKPIIIIVVGMAGSGKTSFLHRLVC-----PFGANIDDEVVSVIEKRADQLDYVLVDTPGQIEIFTWSASAFASTFPTVVTYVVDTPRSSSPITFMSNMLYACSILYK-------RLPLVLAFNKTDVADHKATLANSLSLSLYEFYRNIRSVGVSAISGAGMDGFFKAI................................................................................ 280
67 -11.100[J] KOG0458 Elongation factor 1 alpha  ali follow..  17  150.KPKKPHDISAFVKSALPHLSFVVLGHVDAGKSTLMGRLLKSSFKFAW-DQTNEERERGVTVS-HRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTESGFDLDGQTKEHMLLASSLGIHN--------LIIAMNKMDNVDWSQQRFEEIKSKLLPFEDNINWVPISGFSGEGVYK..................................................................................... 361
68 -11.100[J] KOG0465 Mitochondrial elongation factor  ali follow..  53.DEIKQKLTPDDIGRCNKLRNIGISAHIDSGKTTFTERVLYYTKRIKAIHEVRGRDNVGAKMDGKNYHFNLIDTPGHIDFTIEVERALRVLDGAVLVVCAVSGVQSQTVTVDRQ-------------MRRYNVPRVTFINKMDRMGSDPFRAIEQLNSKLKIP-------AAVQIPIGSESSLSGVVDLINRV......................................................................... 249
69 -11.100[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  17  20...........IAQQHKSLLRFLTCGSVDDGKSTLIGRLLGEKLDLALLDGLQAEREQGITID-EKRKFIIADTPGHEQYTRNMATGASTCELAILLID-ARKGVLDQTRR-HSFISTLLGIKH----------LVVAINKMDLVDYSEETFTRIREDYLT-NLDIRFVPLSALEGDNVAS..................................................................................... 215
70 -10.900[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  17  73................RRHMKVAFFGRTSSGKSSVINAMLWDKVLPGIGHITTDGDKAYLMTEGSDEKLVLVDSPGTTELDSWIDKFCLDADVFVLVANSESTLMNTE-KHFFHKVNEWLSKPN----------IFILNNRWDASASEPEYMEDVRRQHMEREAQNRIFFVSAKEVLS........................................................................................ 290
71 -10.600[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  17  5....................SEINIGLVG-GKTTLT-----KALSGVWTDTHSEETKRGISIRELLRKVSFVDAPGHETLMATMLSGAALMDGAILVIAANEPQTKEHLMAL--DVIGVKD-------------VIVVQNKIDIVSKERLESYREIKEFVKGTCDAPIIPVSAQQGANIDILIETIEERIKTPKRD...................................................................... 203
72 -10.400[J] KOG0052 Translation elongation factor EF-1 alpha/Tu  ali follow..  15  3..............KEKVHINIVVIGHVDSGKSTTTGHLIKGSFKYAW-DKLKAERERGITID-AKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTEAGISKNGQTREHALLAQTLGVKQ--------LIVACNKMDSTEPPTEITNEVSGFIKKNPKAVPFVPISGFNGDNMLE..................................................................................... 203
73 -10.400[J] KOG0459 Polypeptide release factor 3  ali follow..  17  95............EANKKRHLNVVFIGHVDAGKSTIGGQILRESWYMAY-DTNEEERLKGKTVE-ESTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKETGYERGGQTREHVQLAKTLGVSK--------LIVVVNKMDDDEIEQKMVPFLKASGYNTKKDVVFLPISGLMGKNMDQ..................................................................................... 298
74 -10.300[J] COG0532 Translation initiation factor 2 (IF-2; GTPase)  ali follow..  23  448.....................VTIMGHVDHGKTTLLDRFRESRVTEGEAGGITQ-HIGAYQIKANGKKITFLDTPGHEAFTSMRARGASVTDITILVVAADD------MPQTIEAINHSKAA---------GVPIIVAINKIDKPGAQRVTQELTEHGVFPVAWDSEFVEISAKFNQNLDELLDTVLLVAE........................................................................... 609
75 -10.300[J] COG0480 Translation elongation factors (GTPases)  ali follow..  12  2..........ARINPLEKVRNIGIAAHIDAGKTTTTERILFYSGIIHKIGEVHEITAAAISTSWKDYQINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQ-------------ADRYKVPRIAFINKMDRTGANFYRVHEQMRDRLRAN-------IAIQLPIGSENDFKGIVDLVRKR......................................................................... 182

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.