current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420
# Score Template Links and tools%idFirst MRDEILDPSNLVKNREILYRLMISQLMYDGLEKFAMELSMLVKADQCAPSERLLHVMIAGMQTLSDKDKTNSDDVLPGIDLEFEPEASALAPEPHSYETAYVTSHKQACRAGAFSCDGSLVATGSVDASIKILDVERMLAKSAPEDIEPGREQQGHPVIRTLYDHTDEVSYLEFHPKEHILASASRDGTVKLFDIAKPSVKKAHKVFTDCEPVLCLSFHPTGDYVAIGTEHNVLRVYDVATTQCFVSAIPSQQHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRCINTIAEAHGGAAICSLEFTRNGKYLLSSGMDSLVYLWELCTSRPIQTYTGAGTTGKQEHQTEAVFNHTEDYVLFPDEATTSLCSWNSRNGCRLTLNSLGHNGPVRYITHSPNGPAFLTCSDDFRARFWYRRANNQLast
1 -95.500[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali  100  1MRDEILDPSNLVKNREILYRLMISQLMYDGLEKFAMELSMLVKADQCAPSERLLHVMIAGMQTLSDKDKTNSDDVLPGIDLEFEPEASALAPEPHSYETAYVTSHKQACRAGAFSCDGSLVATGSVDASIKILDVERMLAKSAPEDIEPGREQQGHPVIRTLYDHTDEVSYLEFHPKEHILASASRDGTVKLFDIAKPSVKKAHKVFTDCEPVLCLSFHPTGDYVAIGTEHNVLRVYDVATTQCFVSAIPSQQHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRCINTIAEAHGGAAICSLEFTRNGKYLLSSGMDSLVYLWELCTSRPIQTYTGAGTTGKQEHQTEAVFNHTEDYVLFPDEATTSLCSWNSRNGCRLTLNSLGHNGPVRYITHSPNGPAFLTCSDDFRARFWYRRANNQ 424
2 -69.800[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  10  361.LRDVDELPSLQPSVGSPSRPSSSRLHEINRADEVEALTFPPSSGKSFIMGADEALESE----------LGPGELAGLTVANEADSLTYDIANNKDALRKTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKKSTSLD-------VEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNIVLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWNTTEVAPALSVFDIKELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLESNNSSCQINRVISHPTLSISITAHEDRHIKFYDNNTGKLIHSMVA------HLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQE-FTAHEESIHDVAFHPSKCYIASAGADALAKVF....... 779
3 -68.000[R] KOG0286 G-protein beta subunit  ali follow..  16  1............................................................MGEMEQLRQEAEQLKKQIADARKACADVTLAELVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTT------------------NKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREVKVSRELSAHTGYLSCCRFLDDNN-IVTSSGDTTCALWDIETGQQKTVF---VGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESD--INAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHES----IICGITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVG-ILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN...... 340
4 -67.800[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  13  370.APFGMVPHAGMNGELTSPGAAYASLMSPQMSAAAAAAAVVAYGRSPMVGFDPPPHMRV---PTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALINTLNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHP-------------GNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQF---QGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQH---DFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQ-------LHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASI--FQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEV..... 768
5 -67.100[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  14  14.EDENELGGSGILVPVDISTNELQILLLGSSDDPVPISFFTTEGAEIVDSIRKSLEAVFRVRPVTRCSASIPGHGEPVISAQFSPDGRGLASGSGDQTMRTCKSHKSWVLCIAWSPDATKIASACKNGEICIWNAKTGE-----------------QIGKTLKRHKQWITSLAWQPTCRLLASCGKDGNIFIWDTVQGTVVRC--LSGHTASVTCLRWGGEGL-IYSGSQDRTVKMWRADDGVMCRNM---TGHAHWINTLALNTDYALRTSCFEPSKRCIKPDTVEECQKVAQTRYHMQLVNQVVFSPDTRYIASASFDKSVKLWCGRTGKYLASLRG------HVGPVYQVAWSADSRLLVSGSADSTLKVFELKTKSLYY-DLPGHGDEVFTVDWSPEGTKVVSGGKDKVLKLWR...... 472
6 -66.700[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  12  155.SDSRLLAIGCRDSSTKIVAINYTKYNLSGHTDAIVACFFEANSLHLNTISRNGQLCLWECSL--APSDLEDAERPKIAPPQRKKEKKAVSDNESEDDVENKEQRDVQLTAANYNTRTKVLVVAFSSGAFYLYELPDVNMIHSLSISDYPIEWQSEQYIMKQQGHSSEMTCIAYSSDGQFIATGGEDSKVKLWNTQSSFC--FVTFSEHTSGVTGIQFSRNKKFLVSSSLDGTVRAFDVNRYRNFRTF--TSPNPAQFSCVAVDYSGELVVAGGQDFDIFLWSVKTGKLLEIISGHEG--PVVSIAFSPTSSTLVSGSWDKTVKIWNCLESNSEHETID------AVSDVTNVTFSPSGEEIAVATLSGNITIFDIKSAGQVTARKNAQANYFSTIEYSADGECILAAGKSANICIYHVREAI. 660
7 -66.300[S] KOG0295 WD40 repeat-containing protein  ali follow..  18  16.........................AEYMQNNGYSESFSVFLKESSLSENDIKPLGGILEKKW-TTVLRLQRKVNDLESKLQESQREINHGAPTRDKRQAKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYETG------------------QLERTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLWDFGQTY-DCLKSLKGHEHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTF---RGHNDWVRMIRISNDGTLFASASLDQTVTVWSFATKSAKLVLRDHEH--AVECVEWAPDTAYLFSGSRDRSIKAWNINTGDVLFTLLA------HENWVRGLAFHPKGKYLISVADDKTLRVWELSAQRCMK-AIEAHEHFVSTVAFHQTSPFVITGSVDMSCKVWECR.... 404
8 -66.300[A] KOG0285 Pleiotropic regulator 1  ali follow..  19  30.PVHGQFPQPDPESKRIRLCHKIQHNSEKTAPLKALALPGPKGSKELRKSATEKALVVG--PTLPPRDLNNTGNPGKSTAILPAPGSFSERNHAPWKNYRVLQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATG------------------VLKLTLTGHIGQVRGLAVSNRHTYMFSAGDDKQVKCWDLEQNKVIR--SYHGHLHGVYCLALHPTLDVVLTGGRDSVCRVWDIRTKMQIFVL----PHDSDVFSVLARPTDPQVITGSHDSTIKFWDLRYGKSMATITNHKKT--VRAMALHPKENDFVSASADNIKKFSLPKGEFCHNMLSL------QRDIINAVAVNEDGV-MVTGGDKGGLWFWDWKSGHNFQRASLESEAGIYAACYDQTGSRLVTCEGDKTIKMWKEDEDAT 460
9 -66.100[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  15  117.QLGGRLASGSKDTDIIVWDVINESYRLKGHKDAITQALFLREKNLLVTSGKDTMVKWWDLDT-QHCFKTMVGHRTEVWGLVLLSEEKRLITGASDSELRVMREGRDRVVNLAVDKTGRILACHGTDSVLELFCILSKKEIQKKMDKKMKKAQPVRTSRITIGGHRSDVRTLSFSSDNIAVLSAAKTGKLQLYDLASGNLLE--TIDAHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKDENSTTRTLQLDEDVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLKFFLSLYGHK--LPVICMDISHDGALIATGSADRNVKIWGLDFGDCHKSLFA------HDDSVMYLQFVPKSHLFFTAGKDHKIKQWDADKFEHI-QTLEGHHQEIWCLAVSPSGDYVVSSSHDKSLRLWERTREP. 708
10 -65.900[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  16  5.............................................................RPNNSVILAQEAKRSKNDLMAYTNRDKALLESGVRRTIMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYE-----------------DCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQ--RQRRFKGHGNFVNSVQGSRRGQLLCSGSDDRTIKIWDARKKHAAHTL----ESPFQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSD--TITGMSLSPEGDFILTNAMDNTLRVWDVRGERCVKVFQGH--QHNFEKNLLRCAWSPGSDKITSGSADRHVYIWDVNTRRIL-YKLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGEIDE... 347
11 -65.700[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  13  207ITGQSFERGDAQLQPVKLQQMPMDKEKIVEMDLEEEDMMHQNDPNNQSPKLLKEFRKLH-EPNAEDAPSRDYIPLPPHKGVDILSEVEAVKDWSPSVCMYTFHHTNNNMNCAEFSPDSTMIACGFQESYIRLWSIKADKKSLPKST-----SVEDSDGSVRLLSHSGPVYGTTFSPDNKYLLSCSEDASARLWSVDTKT--ALVAYKGHTGPVWDVAFGPFGHYFATASHDQTAQLWSCDHIYPLRVF---AGHLSDVDCVTFHPNSAYVLTGSSDKTCRLWDVHRGHSVRVFNGHTQ--PVTAVAIAPDGHTMASADSEGLIHLWDIGTGRRIKTMRG------HRGNIYSLSFSRESTVLVSGGSDCTVRAWDVFKTNYNNVALYTKQTPIFNVSFTRRNLCLAISVS.............. 643
12 -65.200[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  13  33.PKGKNFLYTN-GNSVIIRNIENPAIVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKEHLLKEFQPIAGPIKDISWSPDNQRIVAVGEGREVGEISGQSKSINSADFRPARPFIVTGSEDNTIAVFEGPPF------------------KFKMTKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEFGSPAHKGGVYALAWKPDSTQLLTCSGDKTCRLWTVESRELVSELRVVKGHNKPITVLGLSDDRSTIYTGSHDGVVTNWNSGSGTNDRITG---TGHGNQINGIAAWGDFVYTCGIDDSLRQFSVEGNSYTDYVVKLNFSLPIKYEASSIAVNADTSDVAVGGDDQKLHIYTLKGGVLEPKVELDHLGAVTDVSYSPDLKYLVACDAHRKVVLYSVEEYK. 522
13 -65.000[S] KOG0282 mRNA splicing factor  ali follow..  13  175.TEKRKKFKENDASNIDGFLGPWAKYVEKDVAKPSEEEQKELDEITAKRQKKGKQEEEK--PGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTKQIHVWSGHTKGVSAVRLFPLGHLLLSCSMDCKIKLWEVYG-----------------ERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISR---FTNRKVPYCVKFNPDEDLFVAGMSDKKIVQWDIRSGEIVQEY---DRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHS-MPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFK--HMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSR-FKAHDKVCIGAVWHPETSKVITCGWDGLIKLWD...... 579
14 -64.900[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  10  1......MSSCVNTSQTGPKKKISFIIHEYSNRSAVSALQYDAQNGRLFTGGSDTIIRTWSVPHPVQYQGSLEQHTDWVNDMILCGHGKILISASNDTTVKVIRTHKDYVSCLAYAPIVEKAVSASFDHNIFVYDINA-----------------NFKTVNNLIGCKDSIYSLATTPNLSLVLGAGTEKCIRLFDPRTNE--KIMKLRGHTDNVRALVVNDDGTRALSAGSDATIRLWDIGQQRCIATC---IAHEEGVWTLQVDSSFTTVYSAGKDKMVVKTPLYDFTKSQLLFKEE--APVKKLLLSEKDNSLWVGTWKSDIKRWSIRPSAQLSIGGD------EDGPSTSNANHSVSASSSPPVTFKYIRVKDQKGQQSTPELVIPGAPAIKKHAMLSDKRHVLTRDSDGNVALYDVLAARK 425
15 -63.900[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  13  158FGKHEKLVVGYIEGQLNLYNIMRGANTWKSHNSHITALLQVPDSRVVVALSRDQTMSIHETETQE--TLRVLPLYESIEGGAIGHNGNLFTVGETAKLVRKKRIASSNLDHLAYDVVSNRFLAISAEQNLIILDFENLKIARQIVGFHDEINTKTLDCQLIRGHTESVLSVVSPTWDTSLLASCSKDNSIIFWRLVTSTLVPVAAATGHANTVTALAISNTGRFLASVSTDCTIKLWGLGVSTKLKESSTMVAHGKDVNCVDISESDALIATGGMDKLVKLWQVDTHKIAGTLSGHRRG--VGDVKFAKNSHKLASCSGDMTIKIWNISEKSCLQTISG------HSCAVFRVIFARNDSQLISADSAGIIKIWTIKTADCEC-SIDAHTDKIWSLSKNHNESEFVTAGTDGRIVVWKDVTEEK 641
16 -63.000[R] KOG0645 WD40 repeat protein  ali follow..  17  1......................................................................................................SGHTGRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNLVHVIDG-----------------FHTRSIRRVAWRPIERVLAVASFDSVVSINEKIDDDWECTAALEGHENEVKCIAWSCNGNYLATCSRDKSVWIWEATEDDEFDCLAVLQEHTQDVKVVTWHPTEDLLVSGSYDNSICFWRDDGDDWALTCQLQGHTNTVWALAFSPNGNTLASADNDGNVFLWIKISSNEDVATIDSTLPHIHKGAVYTISWMNDAT-LCSAGGDGKIVVYQREKHDAYEQDHAHGVYEINSLEYLRDDR-LLSGGDDGECRVWSFK.... 322
17 -62.700[T] KOG0279 G protein beta subunit-like protein  ali follow..  16  2............................................................................................AEGLVLKGTMCAHTDMVTAIATPVDNSVIVTSSRDKSIILWKLTKE-------------DKSYGVAQRRMTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGESTR--RFVGHTKDVLSVAFSTDNRQIVSASRDRTIKLWNTLGECK-YTISEADGHKEWVSCVRFSPNTLVIVSASWDKTVKVWNLQNCKLRNTLAGHSG--YLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSI-------IHSLCFSPNRYWLCAAT-ENSIRIWDLESKSVVEIGNKTKVIYCTSLNWSADGNTLFSGYTDGVIRVWGIGR... 325
18 -62.700[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  15  2..DDNTAPKKNSEKKARVFDLQAMFEEPTHVPQSVSVSSKSESGVSSSAVSDDEDDFMPDLPPGFQ---MQQSEAGPSSSRAEGPEDSDDSDFDETEAISIISHGTQAISALRVEPPGVRFASGGLDYYVKLFDFQKM-------------DMSMRYDKELLPAESHVINSLAFSPNGETLVVASGEAIIRLLDRAGKQWSELNITKGHTATVNCVEFNPLNKEFISCSDDGSLRLWNLDDHKVITKTKGANGKRVSPQVCTFSPDGKWIAAGCDDGSVQAWKYGSQYVNVNYLVRKANGSITSIAFSPDSKRLLSRGFDDTLKMWSLDNPKEPLLVK---TGLENAFKSTDCGFSPRAEVVFTGTSPGTLQFFDPMTFDLVY-KIDYPGISCHRIQWHPRLNQIIAGLSDGTIHVYYDQTMSQ 452
19 -62.400[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali follow..  15  105.QQQASAAATEASAMAKAATMTPAAISQQEATVNGEENGAHEINNHSKPMEIDGDVEIP-----PNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTEN-------------------GNLASTLGQHKGPIFALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQ--QFPFHSAPALDVDWQNNMT-FASCSTDMCIHVCRLGCDHPVKTF---QGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSK--EIYTIKWSPTGPMLASASFDSTVRLWDVEQGVCTHTLMK------HQEPVYSVAFSPDGKYLASGSFDKYVHIWNTQSGSLVHSY--QGTGGIFEVCWNARGDKVGASASDGSVCVLDL..... 522
20 -61.900[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  12  2....NMDIGKALSDVGGLRDITSRALPPTPDSSPAAPSKKHKLYDFLESRGKIETPRKRIVFEAQLCKELLIRQLGGSRSHPFSTKTSRHVGGRLNRPSECLMMLNQLPFCLGFANNESLLAVCTETGALELFDSRFYDRQNEEN-------QPSARRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQTSKVFDLSTQQCITRLGDGYHSHSVKQVNFCNDSPNLVSCSRDGSIIFWDMRTHGRIRKAHENSGRDCSITSATWLPQSTVISSCSANSALKLWDLRTVHTVRPLPAATRDFGVTNVCTSPDGERIYAASRDSIIYEYSSRHLNSGFCKTYKDPRLRISSFYVKLACSPDGATLACGGKTSGVVVFDTTRNSSSAMLTGGHTKDVTAVDWSSEGQ-LASISDDGSVRVWNSSLHGS 470
21 -61.500[R] KOG1539 WD repeat protein  ali follow..  13  156.TYLNKVLVGSQEGPLQLWNINTKKMQFKGWGSSVTSCVSSPALDVVAIGCADGKIHVHNIKLDEEIVTFEHASRGAVTALSFSTDGRPLLASGGSFGVISIDAHDSSIISLNFLANEPVLMSASADNSLKMWIFDT--------------NDGDPRLLRFRSGHSAPPLCIRFYSNGRHILSAGQDRAFRLFSVIQEQQSREVSRNHLLLAILACAISACGNFAVVGTAGGWIERFNLQSGISRGSYKRRYAHDGEVIGVACDSTNTLMISAGYHGDLKVWDFKKRELKSQW---DVGCSLVKIVYHRVNGLLATVADDFVIRLYDVVTLKMVREFRG------HTDRITDLCFSEDGKWVISSSMDGSLRIWDVILAKQIDGV--HVDVPITALSLSPNMDVLATAHSDQNVYLWVNQS... 651
22 -61.500[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  16  3........................................DQQQLILATGGYDHTIKVWQAHTGNCIKTMRFVETSQVNALDRTPDKTRLAACGYQCPVINFDGVQKNVTRLGFQEDGNWMFTAGEDHHVRIWDMIA-----------------APPHCSRIFDCEAPVNAACLHPNQVEIAMGSQNGSVFLWDVKSERHERI--VPEVDASIQDVAISPDGRYLAAANNKGNCYIWSLTSQDQKMSNRKIPAHSRYILRCKFSPDSRLLLTTSGDGTVCIWKTDDFSKWRELCIE--NYWVWDAAFSADSKWLFTASSDGIARLWKLQTKSSIRDYTG------HTKAITALSFKDEIPVKSTNISDVQSSAKPPTQ-------RDNPPGTNNLAFFETVGRVAMNPYMGNTTTELN...... 362
23 -61.500[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  13  2.................................................................................................KPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNG------------------ERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLAL---LKTNSAVRTCGFDFGGNIIMFSTDKQMVSFFDLRDPSQIDNYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEH--SRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTF-------RTERPVNSAALSPNYDHVVLGGGQEAARFFHLAFEEEFGR-VKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQY. 318
24 -61.400[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  11  5.SEDNNLMEKVLPPVEQVLTWTLIQIQESDVELETKVKKYLRGEGANLETLKDKKLKTQ-LASREKLYGKSAKAAAKIEKWLLPAEAGYLETEGLEKTWRVIVLPDFGPYKLDFTASGRHMLAGGRKGHLALLDMMNMS-------------------LIKEIQVRETVRDVAFLHNDQFFAAAQKKYAYIYGRDGT-----ELHCLKERGPVARLRFLKNHFLLASVNMSGQLHYQDVTHGGMVASI---RTGKGRTDVMEVNPYNSVVGLGHSGGTVTMWKPTSQAPLVQMQCHPG--PVSSVAFHPNGHLMATSGKERKIKIWDLRKFEEVQTI--------HSFHAKTLSFSQKGLLAAGTGSF--VQILGDSSGGSSHNYSMVKGYQIEKVMFRPYEDVIGIGHSMGWSSILIPGSGE. 413
25 -61.100[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  17  10..........................KLAQRSERVKSVDLHPTEPWILASLYSGTLCIWNYQT-QVMAKSFEVTELPVRSAKFVARKQWVVAGADDMYIRVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEK-----------------GWACTQIFEGHSHYVMQVTFNPKDNTFASASLDRTIKIWNLGSPDPN--FTLDAHQKGVNCVDYFTGGDYLITGSDDHTAKVWDYQTKSCVQTL---EGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLE--RVWAIGYIKSSRRVVIGYDEGTIMVKLGREIPVA-------SMDNTGKIIWAKHNEIQTANIKSIGADYEVTDGERLPLS--VKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNR 387
26 -61.100[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  13  1...............MSATELPTKEAILKGHEGAVLAARFNGDGNYALTCGKDRTIRLWNPHR--------------------------------GILIKTYKSHGREVRDVHVTSDNAKFCSCGGDRQVYYWDVSTG------------------RVIRKFRGHDGEVNAVKFNDSSSVVVSAGFDRSLRVWDCRSHSVEPV--QIIDTFLDTVMSVVLTKTEIIGGSVDGTVRTFDMRIGREMSDN-----LGQPVNCISISNDGNCVLAGCLDSTLRLLDRTTGELLQVYKGHISKSFKTDCCLTNSDAHVIGGSEDGLVFFWDLVDAKVLSKFRAHDL-------VNSIDVDFYLRKFFVAGDKRELPPEGRLYVDFFGRWYNSCLEKMKKQQILTSIDFVIYVSNSPFFFYYRL..... 343
27 -60.900[S] KOG0293 WD40 repeat-containing protein  ali follow..  14  159LRNEMAPLRINTKRVHELASSLISPSSFISHTTSTPGKESVNSRSKVLEELQTLLPASVIIPEKRLECLVENSLHIQRDSCVFHNTLDSDLSLYSDHQAQILESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGHIS---------------LKHTLVGHHKPVIAILWSPDDRQVLTCGAEEVIRRWDVDSGDCVH--MYEKGGISPISCGWYPDGQGIIAGMTDRSICMWDLDGREKECWK---GQRTQKVSDIAMTDDGKWLVSVCKDSVISLFDREATVERLI----EEEDMITSFSLSNDNKYILVNLLNQEIRLWNIEGDPKISRYKGHK---RSRFIIRSCFGGYKQAFIASGSEDSQVYIWHRSTGKLIVE-LPGHAGAVNCVSWSPTNLMLASASDDGTIRIWGLDRIN. 565
28 -60.800[BK] KOG1063 RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily  ali follow..  13  242.PNSIMLVSSSQDKVIRIWKLVLVGDVLIGHEDWVYSVEWQPPVISILSASMDKTMMIWRPEKKTVCVGELSHCALGFYGGHWSPNSLSILAHGYGGAFHLPSGHFAAVTDVTWARTGEYLLSVSQDQTTRVFSAWKNDEGNEAEDEH------HELARPQVHGHDINCVAMVQGKGNHRFVSGAEEKVVRVFEAPLSFLKESHKLYGHGNELFSLCSDHKGNLVASSCKAQSIWLWEVGTWKAVGRL---QSHSLTVTHLEFSYDDTLLLSVSRDRHFSVFSIQRTKLMAKVEAH--KRIIWACSWNPFGHQFATSSRDKTVKIWSVENDARIKQIL---VLPPFGSSVTAVAWTGKSGCVAVGMESGLIELSNVKIIELRLEPFMCHVSAVNRLAWRPTEKWLTSCGDDNCVRVFNFK.... 839
29 -60.700[S] KOG1407 WD40 repeat protein  ali follow..  19  10...............................................................................................SLHSREYQGHKKKVHSVAWNSNGTKLASGSVDQTARIWNIEP--------------HGHSKAKDLELKGHTDSVDQLCWDPKHSLVATASGDKSVRLWDARSGKCTQQ---VELSGENINITYKPDGTHVAVGNRDDELTILDVRKFKPLHR----RKFNYEVNEIAWNMPGDFFFLTTGLGTVEVLSYPSLKPLDTLTAHTAG--CYCIAIDPKGRYFAVGSADSLVSLWDISDMLCLRTFTK------LEWPVRTISFNYSGEYIASASEDLFIDIANVQTGRTVHQI--PCRAAMNSVEWNPKYNLLAYAGDDKNPKYNTDEGVFR 308
30 -60.600[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  18  2....................................................................................................SLCGHTSPVDSVAFNSEEVLVLAGASSGVIKLWDLEES------------------KMVRAFTGHRSNCSAVEFHPFGEFLASGSSDTNLRVWDTRKKGC--IQTYKGHTRGISTIEFSPDGRWVVSGGLDNVVKVWDLTAGKLLHEF---KCHEGPIRSLDFHPLEFLLATGSADRTVKFWDLETFELIGTTRPEATG--VRAIAFHPDGQTLFCGLDDG-LKVYSWEPVICRDGVDMGWST--------GDFCINEGKFIGCSYYRNSVGIWVSDISELESVSPDYETREIKNIYVDSTGGNLNVAQNPGSLKATLPLESGK 325
31 -60.600[R] KOG0288 WD40 repeat protein TipD  ali follow..  14  117..QEELEEKTKTVDVLIAENLEIRSQEMTSRVQKAETENKMLIDRWMLQKMQDAERL---NEANDLYEEMLAKLKANGLETLARQQVDGIVRRNEDGTDHFIHAHEGGCGSIVFEYNSGTLFTGGQDRAVKMWDTNSG------------------TLIKSLYGSLGNILDMAVTHDNKSVIAATSSNNLFVWDVSSGRV--RHTLTGHTDKVCAVDVSKFSRHVVSAAYDRTIKLWDLHKGYCTNTV----LFTSNCNAICLSIDGLTVFSGHMDGNLRLWDIQTGKLLSEVAGHSS--AVTSVSLSRNGNRILTSGRDNVHNVFDTRTLEICGTLRASG--NRLASNWSRSCISPDDDYVAAGSADGSVHVWSLSKGNIVS-ILKEQTSPILCCSWSGIGKPLASADKNGYVCTWT...... 515
32 -60.400[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  19  11.............................................................................................RSFKVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCEKG------------------TQSRTVNSKKYGVDLIHFTHANNIHSSTKVDDTIRYLSLHDNKYLR--YFPGHTKKVISLCISPVEDTFLSGSLDKTLRLWDLRSPNCQGLM-----HLSGRPIAAYDPEGLIFAAGVNSESIKLYDLRSFDKGPFVT-QEKECDWTGLKFSRDGKTILISTNGSVIRLVDAFHGTPLQTFTGYP---NNKGIPIEASFSPDSQFIFSGSTDGRVHIWNADTGNKVSVLNGDHPGPVQCVQFNPKYMMLASACTNMAFWLPTSEEG.. 316
33 -60.300[R] KOG0289 mRNA splicing factor  ali follow..  16  105.HALYQHDAACRVIARLTKEVTAARATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKL--QDKATVLTTERKKRGKTVPEEQVASHVGLHSASIPGILALDLCPDTNKILTGGADKNVVVFDKSS------------------EQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQV--VRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKV-TDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGH--SGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQ-----LDNNFEVKSLIFDQSGTYLALGGTDVQI--YICKQWTEIL-HFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL..... 504
34 -60.200[R] KOG2096 WD40 repeat protein  ali follow..  13  2....................................DSVLVVGIASVILGALIAVLFFGSYFR-KRTSEVQSMAKAEPQDPIRNPKSNHPAPKKNHPKLNTLKGHGDAVTGLCFSSDGKSLATACADGVIRVFKLDDASSKSFNRWEFTLQCFLKFRFLRINLPAGGHPTAVAFADDASSIVVGKLPLPSIKWDHHHIH--EKRSVLTISGATATYGTADGSVVIASCSEGTDIVLWHGKTGRNLGHV---DTNQLKNHMAAVSPNGRFLAAAAFTADVKVWEIVYQKRVMQLKGHKSA--VTWLCFSPNSEQIITASKDGSIRVWNINVRYHLDEDPKTCDSGGNPLHYDRLSLCPEGKILAASH-GSTLQWLCAETGNVLDTAEKAHEGDITCISWAPKAMVLGTSGDDKKVKLWEAPKSQ. 452
35 -60.100[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  17  9..........................ELYIAENEVEEVKLMDQGVTEDEAEQEQNDTMNNMVM-DMSVQGFFEHKDSVFSVSINPVHSNLCASGTGEQICQLTGHKDSIVAIDWSFDGTYIATGGMDSQVRLWKSSTGFE------------------FITAFETVDEIVWLSWHPKGLFLAAGCNDGSIWMWSLPSGKVVQV--MYGHTAPVNAGKFIPPGKRLATVDDSGTLIVWNPATGAPECRMSSNEETAAGWTSFDCNAEGNVLFLGGSSGKVKVVNINSSHILASLEAQTES--VEAIALCTALPICACASVDGTVALYDSASLKFRKSL-------PHEQAVIDCKFLPNTPYLLTACADCVIRKWDVRSGQLLG-EYTGHQEPILCMAITPDGKRVVTGSDDTELLVFDCEH... 399
36 -59.800[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  14  239.NGGTNLCADSNDHVLSVWDWQKEEKDVKCSNEAVFAADFHPTDTNIIVTCGEITSLLLDTRRKLPLIRSRTRKAKVVLCVTFSENGDTITGDSSGNSYAVQGAHEGGISPLCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIPEQFGPIRLSGDFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPV---WDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVH---TDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAHIYGGHSSHVTNVDFLCEDSHLISGGKDTSIMQWRV..... 716
37 -59.200[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  11  2...AAIINQRVEQGESSMGGAKPALLRITGHVARINDVILLSKDEGVWTASDDRSVRLYLKRDNDQFWPSIHFMPVAPTSLYYSEETYKLLVGLINGNVRKWTCHAGPISGLGFALSSELIFSCSRDKSIVWHCSENS---------------------NKMGSYLLENSCTAMVIDLPFVFVGDHGGHVTVLRIVDNQPNLVSKLSAHTNAITSLTWDGNKKVLYSGSSDHLIIMWDIGGGR--GEAYELNGHNGKVTTLCAAPAAKRLFSADEHGKLMCWDMNCKRVETPEWKTSDCCQKCNQPFFWNLQAMWQRKVVGLRQHHCRTCGSAV-----------------CGSCCDNWTTYPPMGYETKIRICNDCNARMKDNIPHEIHTGITAMHLQETLGLLVTSGQNRVIMIWDVRSVC. 408
38 -58.700[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  17  123.KRARQINVSTDDTEIKSNLRQLNEKELLAGLGENAINKRQYEDEERKQQQREQDQATWYHEGPDSLRIADYSLPRAKDRLVRAREALEVPSAARAGRMVSQVGDTRPVSSAAFSEDSSLLLTSSWSGLCKLWSVPDC------------------ELKQTLRGHASYVGGVALRPGVKAMASGGHDGAVKLWGFNNEE--SIADITGHPHRVSKVAFHPSGRFLATACYDSSWRLWDLEQKTEVLHQ---EGHAKPVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGRCIMFLEGHLG--AVFGVDFSPNGFHIATGSQDNTCKIWDLRRRQPVYTIPA------HTNLISDVKYQQEGSFLVTCSYDSTTKIWSNKTWQPLK-TLQGHDNKVISVDIAPNSQYIATTSFDRTFKLWSPDS... 553
39 -57.500[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  18  20.PSTSSMQNSQPRIMNNHHHPHNRF----QREHVMPDVMGDGPGRRLRKNVANVRVDYVSTVLNHCENRLWQYGKQRILQQPDILYQQYAVPADSTPDVTAMNKVKCPVYSVCWSPEGKRLITGCQTGEFTLWNGTAF------------------NFETILQAHDSAIRALKWASNEQWLLSADQGGYVKYWQPNMNNAHMF--SAHKDEAIRGLAFAPTDVKFATASDDGTARVWDFARYTEERVL---RGHGAEVRCIDWHPTKGLIATGSRDTPVKIWDPKSGSCLATLQEHKS--SVMAVEFNKNGNWLLTGGRDHLVKMYDIRMMKEMRTYRA------HKKEVISLAWHPIHELFVSGGGDGSIVYWMVDGEKEIGLLEHAHDQAIWSMKWHPLGHILATGSNDNNTKFWARNRPGD 423
40 -57.000[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  13  1..................................................................................................MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQ-----------------VKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFEAENDWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVSTLKT------EFLPLLSVSFVSENSVVAAGH-DCCPMLFIYDDRGCLTALETLHQNSITQVSIKQDCRKFCTTGIDGAMTIWDFKTLES 362
41 -56.600[T] KOG4378 Nuclear protein COP1  ali follow..  16  1............................................................................................................MMSNLVEPSWRLLAASG-GDTVKLFDVSAD--------------SGDPCVLSYTPSPGCAVNSVKWNHTNLVVASTGEDKKISLWRKNGQSLGTVDGGDSAEECLSAISFSKKGSYICSGGTGQIVKIWDLQRKLCIKKL---KGHTSTITGVMYNCKDEHLASVSVGGDLIVHNLASGARATELKDPNGQHVLRLLDYSRSSRLLVTAGDDGTVHLWDTTGRSPKMSW-----LKQHSAPTAGVCFSPSNKIIASVGMDKKLYTYDSGSRRSSS--CIAYEAPFSSLAFGDNGYILVAGTSNGRVVFYDIRGKPQ 304
42 -56.300[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  14  352..........................YLFDAKETKEWLKLKDEPHKRKLHFMPQKFKSL--REVPAYSRYLRERFLRCLDLYLCPRAKRVKLNIDAEYLIVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCIRTI-------------------ETDEVVRCVAWCPNPKSIIAVATGNRLLLVNPKVGDKKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGANRSALIHQLSKRRSQIPFSKSKGLIQFVLFHPVKPCFFVAT-QHNIRIYDLVKQELVKKLLTN--SKWISGMSIHPKGDNLLVSTYDKKMLWFDLDSTKPYQTMRL------HRNAVRSVAFHLRYPLFASGSDDQAVIVSHGMVYNDLLKKLQTHEFGVLDVNWHPVQPWVFSTGADSTIRLYT...... 784
43 -56.300[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  13  30.PALHPFEVPREYNATKLERVFAKPFSLDGHRDGVNCLAKHPEKLATVLSGACDGEVRIWNLTQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQR------------------TNPICSMTWGFDSISSVKFNPIETLLGSCASDRNIVLYDMRQATPLKK---VILDMRTNTICWNPMEAIFTAANEDYNLYTFDMRALD--TPVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYHTKRMQH-VICVKWTSDSKYIMCGSDEMNIRLWKANASEKLGVLTSREAKDYNQKLKEKFQHYPHIKRIARHR-HLPKSIYSQIQEQRI-MKEARRRKEVNRIKHSKPGSVPLVSEKKKHV-VAVVK.... 445
44 -56.300[R] KOG2394 WD40 protein DMR-N9  ali follow..  11  34.PEGKYKLHYEKTHSSGLLHYAHGKIAQLKERAAPSTPTGTSSGYSASSGFRSATARLLGTGNGSRALSAASNSNTSMTNTNFDGKGTYLVNSQEKDPVKSIHFSNSNPMCHAFAKDGHDLLIGLNSGDVYTVSLRQQLQDVSKKLVGALHYNKDG----SVNNRQDRCTSISWVPSTFPAIRDPTQFSVDKAKYSKSN--PVARWHICQGSINSIAFSNDGAHLATVGRDGYLRIFDFLTQKLVCGG---KSYYGALLCCSWSMDGKYILTGGEDDLVQVWSMEDRKVVAWGEGHN--SWVSGVAFDSNWSRFGSVGQDTQLLLWDLEMDEIVVPLRRAPAHRVHTEPLSGLMFTQES--VVTACREGHIKIWTRPSESETQSSEANPTTALLSTSFTKDNKASLSSKIISGSTFKQ...... 556
45 -55.300[R] KOG2055 WD40 repeat protein  ali follow..  12  117.SRLRKLRQYEDEDMVNGLQYARRLRT--------QFERVYPVPEWAKKQDVTEEEDEFNALS-EKSVIPKSLKSLFKSSVSYINQSSKLLAPGTINDANFQAPSHSGIRCMSIHPYFPLLLTCGFDRTLRIYQLDG----------------KVNPLVTSLHLRSSALQTALFHPDGKRVIAAGRRKYMYIWDLESAQVQKVSRMENFQPSMERFHVDPTGKYIALEGRSGHINLLHALTGQFATSF----KIEGVLSDVLFTSDGSEMLVLSYGAEVWHFNVEQRSVVRRWQV-QDGVSTTHFCLDPSNKYLAIGSKSGIVNIYDLQTSNADAAPKPVTTLDNITFSINSMSFSQDSQVLAIASKKDTLRLVHVPSFSVFRNTSATPLGRVTCLAFGKGGE-LCVGNEAGRVGLWKLAHYD. 519
46 -55.000[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  73.GQNDVFAVSTSDGKINILSRNGKVEMVDAHNGAALCARWNSDGTGLLSSGEDGFVKMWSR--SGMLRSVLAQFATAVYCVAWDSTSSNVLYCNADHCYIKWKAHDGIILCCDWNPTSDLIVTGGEDLKFKVWDGF-------------------GQILFNSSVHDYPITSISWNTDGTLFAVGSHN-ILRLCDKSG---WSHSLEKMNAGSVMALSWSPDGTQLAVGTAAGLVFHAHIIDKRLTKNWNTPTMIEYNERTVNIIVQCEKIFLVSDGMTITIFTY-EGRKLINLNPPGALLDERKIDLANDTLVVRDRADNKVLHFFDPTTGKAQGDGN------KHEHDIVELTVNQCGRNVAFRDQIGAVHIAMVKTFGVSQR-MVKIGSLVEQLVFNDVTNMLCGIS-EGKIAVWPLPNV.. 535
47 -54.900[A] KOG0299 U3 snoRNP-associated protein (contains WD40 repeats)  ali follow..  10  58.EENEDTYETAAEKRLRLAREYLDEVK-EDGGFDAKEVDRELLASRLKEDVLEKKGQMYLDYTSK------------------------INPDVKIETAQLRGRHMRPLVGVVAYENF--VYSADKSGLIQKWEALQEKDTENRENDDHEIPIKFSRSRRGENDHVKEITCLAISNDGRWIVTGGLDHRIVIRDSVTLE--PQHCWKHHRDAVMGLAMRRGTNEMFSCSADRSIKVWSLDQMSYIETL---FGHQDVIFGVDALARERCVSVGGRDRTSRLWKIVEESQLVFRSGGTYMEGSVDCVAMIDEDHFVTGSDNGVIALWSVQRKKPLFTYPLAHTIPPQPRWITSLAAIPYSNLFASGSWDGNIRLWKIAEGLRSFEPLTSVYGCINSLSLSLQGKVFAACGRETRVGRWKTLRGIP 500
48 -54.600[S] KOG0283 WD40 repeat-containing protein  ali follow..  11  232.ALTSVMSNARVGAFFLIKNLDTGK-RINYEPLMDLRKFNSYLSKSVRLSKRRGAALLKNIKGAHSMSLRVADKDVSDGSTDSPKKGKDHKHGKANEWVKVIQAHEGAVWTIKFSQDAHYLASGGADRVIHVWEVQE------------------CELMSMNEGSLTPIHPSLCDSSGNEITVVEKKKKGKGSSGRRHNHKPVCSLKGHLDAILDLSWSKSQL-LLSSSMDKTVRLWDIETKTCLK----LFAHNDYVTCIQFSPDENYFLSGSLDAKIRIWSIQDRHVVE----SDLHEMVTAACYTPDGQGALIGSHKGICRAYDTEDCKLSQTNQ-SNKKSQAKRKITSFQFSPVNSEVLVTSADSRIRILDGSEVIHK-FKGFRNTCSQLSASYSQDGKYIICASEDSQVYLWKNDFHR. 715
49 -54.400[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  16  2...........................................................................................SAVCGGAARMLRTPGRHGYAAEFSPLPGRLACATAQGTLLILDPDE-----------------AGLRLFRSFDWNDGLFDVTWSENNEVLITCSGDGSLQLWDTAKAA-GPLQVYKEHAQEVYSVDWSQTRGLVVSGSWDQTVKLWDPTVGKSLCTF---RGHESIIYSTIWSPIPGCFASASGDQTLRIWDVKAAGVRIVIPAHQAE--ILSCDWCKNENLLVTGAVDCSLRGWDLRNRQPVFELLG------HTYAIRRVKFSPHASVLASCSYDFTVRFWNFSKPDSLLETVEHHTEFTCGLDFSLQSPQVADCSWDETIKIYDPACLTI 321
50 -54.200[R] KOG4227 WD40 repeat protein  ali follow..  13  2.................................................................KRRAGLGGSMRSVVGFLSQRGLHGDPLLTQDFQRKDLLGHFGCVNAIEFSNNGQWLVSGGDDRRVLLWHMEQAI-------------HSRVKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETLD---VFAHEDAVYGLSVSPVNNIFASSSDDGRVLIWDIRESPH-GEPFCLANYPSAFHSVMFNPEPRLLATANSKEGVGLWDIRKPQSSLLRYGGNLSQSAMSVRFNSNGTQLLALRRRLPPVLYDIHSRLPVFQFD-NQGYFNSCTMKSCCFAGDRDQYILSGSDDFNLYMWRIPADPEAGMVLKGHRSIVNQVRFNPHTYMICSSGVEKIIKIWSPYKQPG 367
51 -53.600[R] KOG1334 WD40 repeat protein  ali follow..  17  270..................................................................................................QYLLGSHAGSVSTIHFNQRGTRLASSGDDLRVIVWDWVR-----------------QKPVLNFESGHDINVIQAKFFPNDSTLAMCGHDGQVRVAELINASYCETKRVAKHRGPAHELALEPDSYKFLTSGEDAVVFTIDLRQDRPKVVVTRENDKKVGLYTISMNPANYQFAVGGHDQFVRIYDQRRIDKKENNG-CDFPTNITCVVYSHDGTELLASYNDEDIYLFNSSLSDGAQYVKRYKGHRNNDTIKCVNFYGPRSEFVVSGSDCGHVFFWEKSSSQIIQFMEGDRGDIVNCLEPHPYLPVLATSGLDQHVRIWTPTAKT. 595
52 -53.500[S] KOG0281 Beta-TrCP (transducin repeats containing)/Slimb proteins  ali follow..  15  125..............................SEGMLWKKLIERMVRTDPLWKG-------LSESRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDGRHNLQRIQCRSENSKGVCLQYDDEKIISGLRDNSIKIWDKTSL------------------ECLKVLTGHTGSVLCLQY--DERVIVTGSSDSTVRVWDVNTGEVLN--TLIHHNEAVLHLRFSNGL--MVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDF--DDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRG--IACLQY--RDRLVVSGSSDNTIRLWDIECGACLRVLEG------HEELVRCIRF--DNKRIVSGAYDGKIKVWDLQAALLCLRTLVEHSGRVFRLQF--DEFQIISSSHDDTILIWDFLNVP. 489
53 -53.300[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  15  1..............................................................................MAQPYLPAEKF---SRKQETILLDEDEPAVVSSVRISPKKPYHVATTSSVRLTLYDTVV------------------CEPLNLFSRFKKGVCSIDFRHDGRLLAIGGDEGKVRIFDVEKTTGSSLRVMQASQSTVKSVHFSPRGDTVFSMADDGKIKQYRVADTAYGVNIIEIQAHEDAIRCGAVSSNDHIVLTGGYDHKVRLWDIRSKEKSLEL---DCEHPVESVLFLPGEQLIATAA-GPIVKIWDTTTGRQLTALQA------HYKTVTSLRLATNSTCLLSAGIDRRVNAFRTTNYSLINSW--SMPSPVLDIDVSRDDQTMAIGMGNLLALYRRAEIKKE 321
54 -52.500[U] KOG1332 Vesicle coat complex COPII, subunit SEC13  ali follow..  17  7...................................................................................................TVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNG----------------GQILIADLRGHEGPVWQVAWAHPGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVKRFASGGCDNLIKLWKEEEDGQWKEEQKLEASDWVRDVAWAPSTSTIASCSQDGRVFIWTCDDAS--SNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGVCISDVNKGQGSVASVTEGQQNE..................... 321
55 -52.000[R] KOG1273 WD40 repeat protein  ali follow..  10  2..............NAPIIDPLQGDIEEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDFET-RGIAKEIRDN-----------------------------DCSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTILQQTPLQARSSPSLCLACPLSSAPMIVDFDIDCTTLLPVSVPEMPDVLAPPQRS---KCPESNPPFSPAAACFNKCGDLVYIGNSKGEILIVDYKSVRVLALVS--ASGAAPVKNIVFSRNGQYLLTNSHDRTIRIYENLLPTLFREFQDSVTKMHWKAPCFSGDGEWVVGGSGEHKIYIWD-RAGHLVKILEG------PKEALIDLAWHPVHPIIVSVSLAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKVLDVNEDEE 394
56 -51.700[R] KOG0646 WD40 repeat protein  ali follow..  14  2..EITVIASSSIDEGIGSWDLKTGTLQFKPCASPAHGLTAVGESSQLSARNTSGSIFYWSWTKP---------------------------------QAEVKSYPVEPIKALAANNEGTYLVGGGISGDIYLWEVATG------------------KLLKKWHGHYRSVTCLVFSGDDSLLVSGSQDGSIRVWSLIRGNTLYEHNFNEHTMSVTDIVIDYGGCVIISSSEDRTCKVWSLSRGKLLKNI----IFPSVINALALDPGGCVFYAGARDSKIYIGAINATSEYGT---SEKGKAITCLAYCADGNLLISGSEDGVVCVWDPKSLRHVRTLIHA-----KGSRKGPVNNIQIVRKTIVANSNKTQVSWKSRGALIPPPL----EKYERPVEDTMDGIVTVDPPPFSDVPVYSSFLSAD 379
57 -51.700[T] KOG1354 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  10  2........AGAGGGNDIQWCFSQAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENIQSHSRGEYNVYSTFQSHEPEFDYLKSL----------EIEEKINKIRWLPQKNQFLLSTNDKTIKLWKISERDKRRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSAD-DLRINLWHLEITDRIKPANMEELTEVITAAEFHPNSNTFVYSSSKGTIRLCDMRASALCDRHSFFSEIISSISDVKFSHSGRYMMTRD-YLSVKIWDLNMNRPVETYQVHEY-FDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEAS------RENNKPRTVLKPRKVCASGKRKKDEISVDSL-----------DFNKKILHTAWHPKENIIAVATTNN-LYIFQDKVN.. 447
58 -51.600[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  16  2............................................................................................ASNQQPPSNLQTYGVPIYAVDWILEEAVRSKITKDQDDDDDDGSSSSSYIVLSGVDLHTNSLSEQPIGRRVIGTDLPYRMAIHPRQGGLICAL-PNSCRLFDWENEESEKVVKELKDVGQQLSLSFNQDGTVLATGAEDGTLRVFEWPSMKTLLNE---SKTHASVKSLTFSESGKFLVSLG-APLCRVWDVNASAAIASLSKEK-DEMFASCRFSVDNSVAANTQRGGSIITWDTTSWRRRSS-----KLIKRNNSISAFNVSADGKLLAVGTLEGDVLIIDSTKMQTNQIVKKAHLGLVTALTFSPDSRCLVSVSFDSRARLTVIKQKGE 352
59 -51.600[R] KOG2919 Guanine nucleotide-binding protein  ali follow..  10  17.GDLSLPKLSVTLSAEEILKLRSGRPKVESPHAGVPMETSLAAEEEANGDEEEESVRVVDIEDTLELTSNGNEAKPEDQELAIAPVLQYFQGALVELGRRCWTEAQHYTKGCYWSPDGTCLLVPVHLDGMHVIEMPSDLYSADTVQPARSLTKLQ---SEVHVPEGGTVYDCVWYPETCLWLATRQHEPIHMWDAFDGSLRCSYDAVDEVMAAISLAFSHDGEQIYAGY-KRCIKIFDTSRPG---RFCDDYPVKFAISCIAQTTAHPTLTCGNWHGYIQHFDLRCSHKQGPLFTLGGKGGITQLRYGEFGNLFSGARKCDKILQWDMRYKQPLVELQRHVDTNQR-----QFDLASDSNWLASGDTRGFVNVWDLKKYGDPSV-LPLHSDCCNGVALNPAMPILATSSYENAVVMWWCGQT.. 486
60 -51.400[R] KOG2321 WD40 repeat protein  ali follow..  10  5..........................VQNPNNVRVYTVSGEGVTQRLPNWISKRKLKKDYALSHRIELLQDFEYPEASNRIKCTRDGKYAMATGEMSLKFERHTDAENVQFEILSDDWTKSVHLQTDRTVDFHSQGGIHYSTR---------------------IPKYGRDLKYHYPNCDLYLAAAGDEVYRLNLEQGRFLNSAQIDSPTGGVNVIDINPMHQLLAFGTDAGSVEFWDPRDRSRVGILTPYSDNSRSVTALKYRNDGLNVAIGLSDGATLLYDLRSSSPYMSKDQGY-SMPIKSLHWMDDGTARVLSADSKIIKIWEKDTGKPFSSI-------EPTVELNDVCPIEGTGLILTANEGSPMHAFYIPSLNPAPRWCSFLDNITEEMEENPDDYKFVTKKELLNLGLDHLVGTG. 405
61 -51.200[Z] KOG0313 Microtubule binding protein YTM1 (contains WD40 repeats)  ali follow..  16  17VDDVPFSIPAASE-IADLSNIINKLLKDKNEFHKHVEFDFLIKGQFLRMP-------------LDKHMEVENISSEEVVEIEY--------EKCTAPQPEQCMFHDDWISSIKGAEEW--ILTGSYDKTSRIWSLE-------------------GKSIMTIVGHTDVVKDVAWVKKDSLLLSASMDQTILLWEWNVEKVKALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEIVTLSGHMEAVSSVLWSDAEE-ICSASWDHTIRVWDVGSGSLKSTL---TGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSL---SLTSHTGWVTSVKWSPTHQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGL-LLSGGADNKLYSYRYSPTTS 419
62 -51.100[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  15  51.NLDEVTSASRKAYMTQLAVVMNQNRILAFRNKPKSLLSTNHSDSPHQNPKPVKPRRYIPQNSERVLDAPGLRDDFSLNLLDWGSANVLAIASGSTSELVTIDEDKGPVTSINWTQDGLDLAVGLDNSEVQLWDCVSNRQVRTLRG-------------------GHESRVGSLAWDNHILTTGGMDGKIVNNDVRIRS-SIVETYLGHTEEVCGLKWSESGNKQASGGNDNVVHIWDRSLASSKQTLHRFEEHTAAVRALAWCPFQASLLAGVGDGKIKFWNTHTGACLNSVETG---SQVCSLLWSQSERELLSGFTQNQLTLWKYPSMSKMAELNG------HTSRVLFMAQSPNGCTVASAAGDENLRLWNVFGEPPKT--TKKAASKKYPELFSHVNSL.................... 443
63 -51.000[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  11  1.........................................................................................MTTVTPSAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLKGEF-------------------LHGGAVLDCCFHDDFSGFSVGA-DYKVRRIVFNVGKEDILYFDFSILFFYTLCLFCDVTGQVITGSWDKTVKCWDPRGASGPERT-QVGTYLQPERVYSMSLVGHRLVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEAFKCHRKSEAGRDIVYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRLYQ-YSKYPTSISALSFSRDGQLLAVASSYTAIFVRSVNEIE. 341
64 -50.900[YU] KOG2445 Nuclear pore complex component (sc Seh1)  ali follow..  15  2..................................................................................................QPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDK--------------DTSNWELSDSWRAHDSSIVAIDWASPGRIIASASYDKTVKLWEEDPDQENKLCTLNDSKGSLYSVKFAPAGLKLACLGNDGILRLYDALEPSDLRSSIPPANHLQSDFCLSWCPSRFEKLAVSALEQAIIYKDGKLHVAAKLPGHKS--LIRSISWAPSYQLIATGCKDGRIRIFKITEKLSPLASEE------SLTNSNMFDNSADVDMDAQGRSDSNTEEKAELQSNELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNE 338
65 -50.600[S] KOG4328 WD40 protein  ali follow..  13  98.KQSPRLLAPIPFESAYEGYGSYTQLTLLGIESKSCR-GKLVKGEIGVVKDENESPMVRTRSSSRVSKVSVKKEEPEDDSFSDYVNKEFSIPVKPEKIENVARVVPGRIFVVQFLPNVKMVAAGDKLGNVGFWNLDCG-------------NEEDNDGIYLFTPHSAPVSSIVFQQNSSRVISSSYDGLIRLMDVEKS---VFDLVYSTDEAIFSLSQRPNDQSLYFGQDYGVFNVWDLRAGKSVFHW---ELHERRINSIDFNPQNPVMATSSTDGTACLWDLRSMGAKKTLSTVNHSRAVHSAYFSPSGLSLATTSLDNYIGVLSGANFENTCMIYHNNT--SRWISKFKAVWGWDDSYIYVGNLSKKIDVINPKLKRTVMEL-PLQRAIPCRIHCHPNVGTLAGSTAGGQVYVWTTK.... 516
66 -50.100[DK] KOG0973 Histone transcription regulator HIRA, WD repeat superfamily  ali follow..  16  2....................................................................................................TFVGHDTSILAIDCHPSGKKFITCGSNGLVVVWNAEPVLDKKKASN-------ENVPKLLFQVESQSQSNSCRWSPDGKRFAFGSDDSSVSVWEYVGLINKECCVLRGHSMEVLTVEWSPNGKYLASGSIDYRIIIYNARKLPDRITV--LNDIQLPVKGLSWDPIGKYLASLEGDKKLRFWATDSWQCVKSVTENIEETMLTRLDWSPDGKYLMTPAAVRLIKLIQRQTWKSDQFLAG------HHKGTTCVRAMPQLTCAAVGSRDKSISIWVFPGTLK-PLFVINNIFNHTVMDFAWCGRNLLACSQDGTVKVIHLSESV. 350
67 -49.700[R] KOG4497 Uncharacterized conserved protein WDR8, contains WD repeats  ali follow..  10  18.PDGKYLASCV-QYRLVVRDVNTLQILLYTCLDQIQHIEWSADSLFILCAMYKRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTETKSVSYIKYPKACLQGITFTRDGRYMALAERRDCVSIFVCSDW------------------QLLRHFDTDTQDLTGIEWAPNGCVLAVWDTCLEYKILLYSDGRLLSTYSAYEWSLGIKSVAWSPSSQFLAVGSYDGKVRILNHVTWKMITEFEAEKSPQLGLGCLSFPPPRAGAGPLPSSESSVPVSLQTLKPVTDRANPKMG--IGMLAFSPDSYFLATRNDNNAVWVWDIQKLRLFAVLE-------QLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQ-VPGEGDFAVLSLCWHLSGDSMALLSKDHFCLCFLETEAVV 449
68 -49.700[BL] KOG1009 Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats)  ali follow..  18  5.................................................................................................TCEIAWHNKEPVYSLDFQHGTARLASAGVDTNVRIWKVEKGP-----------DGKAIVEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWKVNDNKETVVKTLRGHLEDVYDICWATDGNLMASASVDNTAIIWDVSKGQKISIF---NEHKSYVQGVTWDPLGQYVATLSCDRVLRVYSIQKKRVAFNVSKMLSKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTKRPIAHLPCPGELRPVVETGVELMSLPYRLVFAVASED-SVLLYDTQQSFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCSFVTFEKDE. 379
69 -49.600[R] COG2319 FOG: WD40 repeat  ali follow..  12  122..QQLLEYALEVERDDNVFTYAKLQKS--DMTQKCPTMVASEKDNKGKLNEKKNRSPENLLPF-RILDAPELRDDFYTSLLSWSPKGDLAIGSKELGPTRVLEESIYDVSSVAYSYNGDILAVGRVDGTLQFWQDNERV-------------------PRISIHHPGDIGVLAWKPETNRLLVGKGNGNIFVYDIISKAVLVATITNAHDEQVCGLTWNHDGSQFASGGNDNRVCLFKGSDLRQPLYV---WQQNAAVKALSFCPWQRSLLAGSHDKHIRFYNCFNGKKIDEL---YCGAQITSIHWSPKYREFSVTTVQHRFAVYSWPQLECLVSVLPSV----PDIRCVHSVLTSQTDSIIIASSNETIKFFDLSEESSWHNSLTWHGIFDSQILEMLEG---IDGKIDSHLR......... 535
70 -49.300[R] KOG1310 WD40 repeat protein  ali follow..  13  3..........................NLSFHDGNIFNLLHTRSQDPSHEVDQRMQFHS-SLVRRLSQEQELEGHQGCVNALAWNSNGSLLISGSDDLRINIWTGHTANIFCTKFVPEDELVVSGAGDAEVRLFNTSRLSGRAE--------DDNAIIPSALYQCHTRRVKKLAVEPNPNVVWSASEDGTLRQHDFRESTSCPLADPPKQTLSLKSCDISARPHLLLVGGSDAFARLYDRRMLPPLASLSERGRTNLHLTHVTFSPNGEEVLLSYSGEHVYLMNVNNGTGIMQYTPRVGDDKPMENTVDNASSGTASSSQNDRTSYQPEGAIDMKRRYVGH--CNVGTDIKQASFLGQRGEYIASGSDDGRWFIWEKQTGR-LMKVLVGDESVLNCIQCHPFDSVVATSGIDNTIKIWSPTASVP 694
71 -49.100[KL] KOG4283 Transcription-coupled repair protein CSA, contains WD40 domain  ali follow..  17  4....................................................................AIKDRETGRIRSNSFANRFKSILSLQLSNRKDFVSPHRGSVNSLQVDLEGRYLLSGAADGSAAVFDVQRATDYEASGLIAKHKCIFTVDK-QHENGHKYAISSAIWYPDTGLFITGSFDHYLKVWDTNTAQAVVDFKMPGKVYRTAMSSMAMSHTLIAAGTEDVQVRLCDIASGAFSHTL---SGHRDGVMSVEWSTSSEVLYTGGCDGAIRFWDIRRAGCFRVLDQS-----QTQLGFRPPILKRTAVGSKVCS..................................................................................................... 254
72 -48.800[I] KOG0301 Phospholipase A2-activating protein (contains WD40 repeats)  ali follow..  12  1........................................................................................MADDGLGDVPMEVIEAHKSDTKALAVTQGGC-LISGGRDETVKFWAKKGKQYTKT---------------HAFEQPKGITVNSIAYAEDGWRLFVGRRDGTIAVFGPSQAEPYAI--FNEHKQNVCCLHINEKATHMLSGSWDSNVIIWPITELNS-FTTIVCPGHTLSVWALASFPDLNTYLSASADKTIRMWF--GDTTLSVFKGHTD--VVRALVVLSSSH-FLSAGNDGHIIHWDVASASILRKFATQAH-------EFIYSMTLSDSHILTTGEDGTLEFWAIDGGKVSEAVIQLPTTNTWDAKVLLNSD-IAVAGSDGRIYIMTTDKNRK 326
73 -48.800[R] KOG0322 G-protein beta subunit-like protein GNB1L, contains WD repeats  ali follow..  11  1..........................................................................................MAVLPPDPVFSLRSPMGAVNSLCFQESDR-LLAGTIKGSVFLWDLQT------------------NRSALHFEVGSDPITSLHHTPDR--LVTQEKGGTITMFSIGGSSYVKERSIPGNRSALHTNTSKTNEQLLFYPCEESSIGVLHVTDAAAPTQILVPDDPQLPCFKPFECASQLFLLAGYESGHFLTWDISSSVILDVM---ELAQDATSVDYDPVTNRGIVGGPTDKLISFSYQRSS--MQMQLGSELCIKNPGVNGVRIRPDQKVFASAGWDGRIRIFSWKSLRPLAVLTQHKNGGVMDLAFSSQAPIMAAAGMDGQISLWDLYN... 323
74 -48.500[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  11  2................................................................................SFFNRSNTTSALGTSTAMANINSPAEDSISDIAFSPQQDFMFSASSDGKVRIWDVQNGV-----------------PQGRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQ---TQQIGMHSAPIKVLRFPSNTECIVTGSWDKTIKYWDMRQPQPVSTV----MMPERVYSMDNKQSLLVVATAERHIAIINLANPTTIFKATTSPLK--WQTRCVACYNEADGYAIGSVEGRCSIRYIDDGMQKKS-APGSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQRHRLKG-YPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNRPDY 345
75 -48.400[T] COG5170 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  11  1.....MDDIEDSLDQWKFAQCFGDKGDVETEADIISAVEFDHTGDYLATGDKGGRVVLFERNHS----KKGCEYKFFTEFQSHEPEFDYLKS----------LEIEEKINKIRWCKRTNHFLLSTNDKTIKLWKLYEKNLKVVAENNLSDSFIAAYPRRVYANAHAYHINSISVNSDAETYISAD-DLRINLWNLSISDHIKPENMEELTEVITSAEFHPNCNHLMYSSSKGNIKLLDLRQSAL-DSKSFFSEIISSISDVKFSQNGRYILSRD-YLTLKIWDVNMKAPVKTIPLHDVLRDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLPGDRGQIVLQADKAAFRARKSAANNVPKLNAVKNNDWRSQPQAAMGSASLDPDNLDYNKKILHASWHPFEDSVAIAATNN-LFVFS...... 461

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhao Y, Hong DH, Pawlyk B, Yue G, Adamian M, Grynberg M, Godzik A., Li T. The retinitis pigmentosa GTPase regulator (RPGR)- interacting protein: subserving RPGR function and participating in disk morphogenesis. Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3965-70. Epub 2003 Mar 21.