current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [R] KOG0645 WD40 repeat protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst SGHTGRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNLVHVIDGFHTRSIRRVAWRPIERPVLAVASFDSVVSINEKIDDDWECTAALEGHENEVKCIAWSCNGNYLATCSRDKSVWIWEATEDDEFDCLAVLQEHTQDVKVVTWHPTEDLLVSGSYDNSICFWRDDGDDWALTCQLQGHTNTVWALAFSPNGNTLASADNDGNVFLWIKISSNEDVATIDSTNILRPALQEEWKQQTSLPHIHKGAVYTISWMNDATLCSAGGDGKIVVYQREKHDEALWHVAYEQDHAHGVYEINSLEYLRDDRLLSGGDDGECRVWSFKLast
1 -101.000[R] KOG0645 WD40 repeat protein  ali  100  1SGHTGRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNLVHVIDGFHTRSIRRVAWRPIERPVLAVASFDSVVSINEKIDDDWECTAALEGHENEVKCIAWSCNGNYLATCSRDKSVWIWEATEDDEFDCLAVLQEHTQDVKVVTWHPTEDLLVSGSYDNSICFWRDDGDDWALTCQLQGHTNTVWALAFSPNGNTLASADNDGNVFLWIKISSNEDVATIDSTNILRPALQEEWKQQTSLPHIHKGAVYTISWMNDATLCSAGGDGKIVVYQREKHDEALWHVAYEQDHAHGVYEINSLEYLRDDRLLSGGDDGECRVWSFK 322
2 -69.400[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  13  460RSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKKSTSAHKGPVLCVVMSSNGE-QCYSGGTDGLIQGWNTTNPNSVLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWNTTEVAP-SVFNDIKELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQ-SNVDTTANSSCQINRVISHPTLSISITAHEDRHIKFYDNNTGK----------------------LIHSMVAHLEAVTSLAVDPNGLLMSGSHDCSIRLWNLESKTCIQ---EFTAHRKKFEESIHDVAFHPSKCIASAGADALAKVF... 779
3 -67.500[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  17  5QFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHEKEHNGHITGIDWAPKSD-RIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFEAENDWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSV----------------------QVSTLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFIYDDRGRATTEDRNTALETLHQNSITQVSIYEVDKFCTTGIDGAMTIWDFK 358
4 -67.000[U] KOG1332 Vesicle coat complex COPII, subunit SEC13  ali follow..  22  10TSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADRGHEGPVWQVAWAHPMGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVKRFASGGCDNLIKLWKEEEGQWKEEQKLEAHSDWVRDVAWAPSTSTIASCSQDGRVFIWTCDDA------------------SSNTWSPKLLHKFNDVVWHVSWSITANLAVSGGDNKVTLWKESVDGQ-----VCISDVNKGQGSVASVTEGQQNE................ 321
5 -66.800[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  18  52EGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGS-HIFTCSTDKTLAFWDI--ATGQRQRRFKGHGNFVNSVQGSRRGQQLCSGSDDRTIKIWDARKKHAAHTL----ESPFQVTAVCFGDTGEQVISGGIDNEVKIW--DIRKQAVLHHLRGHSDTITGMSLSPEGDFILTNAMDNTLRVWDVRP------------------YAPGERCVKVFQGHQHNLLRCAWSPGSDITSGSADRHVYIWDVNTRR-------ILYKLPGHNGSVNAVDFSPKEPILSGSSDKTLYLGEID 346
6 -66.400[R] KOG0286 G-protein beta subunit  ali follow..  19  52RGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPL-RSSWVMTCAYAPSGN-FVACGGLDNMCSIYNLKSREVKVSRELSAHTGYLSCCRFLDDNN-IVTSSGDTTCALWDIETG---QQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLW--DVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHE--------------------SIICGITSVAFSLSGRLFAGYDDFNCNVWDSMKSER-------VGILSGHDNRVSCLGVTADGMVATGSWDSFLKIWN.. 340
7 -65.500[S] KOG1407 WD40 repeat protein  ali follow..  20  17QGHKKKVHSVAWNSNGTKLASGSVDQTARIWNIEPHGHSKAKDKGHTDSVDQLCWDPKHSDLVATASGDKSVRLWDARSGK---CTQQVELSGENINITYKPDGTHVAVGNRDDELTILDVRKFK----PLHRRKFNYEVNEIAWNMPGDFFFLTTGLGTVEVLSYP--SLKPLDTLTAHTAGCYCIAIDPKGRYFAVGSADSLVSLWDISDM----------------------LCLRTFTKLEWPVRTISFNYSGEIASASEDLFIDIANVQTGRTVHQ---------PCRAAMNSVEWNPKYNLAYAGDDKNPKYNTDE 304
8 -65.200[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali follow..  22  176RGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLPSNKDVTSLDWNSDGT-LLAMGSYDGFARIWTE---NGNLASTLGQHKGPIFALKWNKKGNYVLSAGVDKTTIIWDAHTG---EAKQQFPFHSAPALDVDWQNNMT-FASCSTDMCIHVCRLG--CDHPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDA----------------------CVHDLQAHSKEIYTIKWSPTGPLASASFDSTVRLWDVEQGV-------CTHTLMKHQEPVYSVAFSPDGKLASGSFDKYVHIWNTQ 482
9 -65.100[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  14  7QGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMG-HTGAVWCVDADWDTK-HVLTGSADNSCRLWDCETGK---QLALLKTNSAVRTCGFDFGGNIIMFSTDKQMVSFFDLRDPDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQY--SAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTF-----------------------RTERPVNSAALSPNYDVVLGGGQEAMDVTTTSTRIGKLAFEEEFGRVKGHFGPINSVAFHPDGKYSSGGEDGYVRIHYFD 315
10 -64.700[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  15  13RTPGRHGYAAEFSPLPGRLACATAQGTLLILDPDEAGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGDGSLQLWDTAKAA-GPLQVYKEHAQEVYSVDWSQTRGLVVSGSWDQTVKLWDPTVG---KSLCTFRGHESIIYSTIWSPIPGCFASASGDQTLRIW--DVKAAGVRIVIPAHQAEILSCDWCKNENLLVTGAVDCSLRGWDLRNVRQ---------------------PVFELLGHTYAIRRVKFSPFHVLASCSYDFTVRFWNFSKPDSLL------ETVEHHTEFTCGLDFSLQSQVADCSWDETIKIYDPA 317
11 -64.300[T] KOG0279 G protein beta subunit-like protein  ali follow..  20  12CAHTDMVTAIATPVDNSVIVTSSRDKSIILWKLTKGVAQRRMTG-HSHFVQDVVLSSDGQ-FALSGSWDGELRLWDL--ATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKLWNTLGECK-YTISEADGHKEWVSCVRFSPNTLVIVSASWDKTVKVWNLQ--NCKLRNTLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG-----------------------SIIHSLCFSPNRYWLCAATENSIRIWDLESKSAEKTDGSTGIGNKTKVIYCTSLNWSADGNLFSGYTDGVIRVWGIG 324
12 -64.200[S] KOG0295 WD40 repeat-containing protein  ali follow..  19  61RKVNDLESKLQESQREINHGAPTRDKRQAADWIPRPPETQKLTG-HRLPITRVIFHPLWT-IMASCSEDATIKVWDY--ETGQLERTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLWDFGQ--TYDCLKSLKGHEHTVSSVTFLPTGDFVLSASRDHTIKQW--DISTGYCVYTFRGHNDWVRMIRISNDGTLFASASLDQTVTVWSFATKSAKLVLRDHEHAVECVEWAPTGDVLFTLLAHENWVRGLAFHPKGKLISVADDKTLRVWELSAQR-------CMKAIEAHEHFVSTVAFHQTSPVITGSVDMSCKVWECR 404
13 -63.800[A] KOG0285 Pleiotropic regulator 1  ali follow..  21  165QGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATGVLKLTLTG-HIGQVRGLAVSNRHT-YMFSAGDDKQVKCWDL--EQNKVIRSYHGHLHGVYCLALHPTLDVVLTGGRDSVCRVWDIRTKMQIFVL----PHDSDVFSVLARPTDPQVITGSHDSTIKFW--DLRYGKSMATITNHKKTVRAMALHPKENDFVSASADNIKKFSLPKG----------------------EFCHNMLSLQRDIINAVAVNEDGVMVTGGDKGGLWFWDWKSGHNQRAETIVQPGSLESEAGIYAACYDQTGSLVTCEGDKTIKMWKED 456
14 -63.300[S] KOG0282 mRNA splicing factor  ali follow..  15  285SGHTKGVSAVRLFPLGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGT-QFLSAAYDRYLKLWDT--ETGQCISRFTNRKV-PYCVKFNPDEDLFVAGMSDKKIVQWDIRSG---EIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPV-DFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKG-----------------HMVAGYACQVDFSPDMSVISGDGNGKLNIWDWKTTK-------LYSRFKAHDKVCIGAVWHPHEKVITCGWDGLIKLWD.. 579
15 -63.300[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  14  444RGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCIRTI--ETDEVVRCVAWCPNPKLSIIAVATGNRLLLVNPKVGQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGANRSALIHQLSKRRSQIPFSKSKGLIQFVLFHPVKPCFFVAT-QHNIRIYDLV--KQELVKKLLTNSKWISGMSIHPKGDNLLVSTYDKKMLWFDLDLST---------------------KPYQTMRLHRNAVRSVAFHLRYLFASGSDDQAVIVSHGMVYNDLLQLIVPLKKLQTHEKRVLDVNWHPVQPVFSTGADSTIRLYT.. 784
16 -63.300[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  20  321HHTNNNMNCAEFSPDSTMIACGFQESYIRLWSIKADKKSLPKSTSHSGPVYGTTFSPDNK-YLLSCSEDASARLWSV--DTKTALVAYKGHTGPVWDVAFGPFGHYFATASHDQTAQLWSC---DHIYPLRVFAGHLSDVDCVTFHPNSAYVLTGSSDKTCRLWDVH--RGHSVRVFNGHTQPVTAVAIAPDGHTMASADSEGLIHLWDIGTGR----------------------RIKTMRGHRGNIYSLSFSRESTLVSGGSDCTVRAWDVFKTNYNSTSPDQMVALYTKQTPIFNVSFTRRNLCLAIS........... 641
17 -63.000[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  17  103TSHKQACRAGAFSCDGSLVATGSVDASIKILDVERMLAKSAPEDDHTDEVSYLEFHPKEH-ILASASRDGTVKLFDIAKPSVKKAHKVFTDCEPVLCLSFHPTGDYVAIGTEHNVLRVYDVATTQCFVSAIPSQQHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRCINTIAEAHGGAAICSLEFTRNGKYLLSSGMDSLVYLWELCTSRPIQTYTGAG----------------TTGKQEHQTEAVFNHTEDYLFPDEATTSLCSWNSRNGC------RLTLNSLGHNGPVRYITHSPNGPFLTCSDDFRARFWYRR 420
18 -62.900[BK] KOG1063 RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily  ali follow..  19  220KGHTDWIRSLDFSLPLHMLVSSSQDKVIRIWKLVLVGSVESVLIGHEDWVYSVEWQPPVIDSILSASMDKTMMIWRPEKKTGVCVGELSHCALGFYGGHWSPNSLSILAHGYGGAFHLWRNVSSSNWQMQKVPSGHFAAVTDVTWARTGEYLLSVSQDQTTRVFSAWKNDELARPQVHGHDINCVAMVQGKGNHRFVSGAEEKVVRVFEAPLSPESHKLYGHGNELFSLCSDHKGNLVASLQSHSLTVTHLEFSYDDTLLSVSRDRHFSVFSIQRTDNGEVSHKLMAKVEAHKRIIWACSWNPFGHFATSSRDKTVKIWSVE 726
19 -62.700[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  16  26YSNRSAVSALQYDAQNGRLFTGGSDTIIRTWSVPHHKDAFSARGQHTDWVNDMILCGHGK-ILISASNDTTVKVWNIERNKHGFIDCIRTHKDYVSCLAYAPIVEKAVSASFDHNIFVYDINANF--KTVNNLIGCKDSIYSLATTPNLSLVLGAGTEKCIRLF--DPRTNEKIMKLRGHTDNVRALVVNDDGTRALSAGSDATIRLWDIGQQR----------------------CIATCIAHEEGVWTLQVDSSFTVYSAGKDKMVVKTPLYDFTK-------SQLLFKEEAPVKKLLLSEKDNLWVGTWKSDIKRWSIR 336
20 -62.600[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  19  102PGHGEPVISAQFSPDGRGLASGSGDQTMRIWDIELELPLHTCKS-HKSWVLCIAWSPDAT-KIASACKNGEICIWNAKTGE-QIGKTLKRHKQWITSLAWQPTCRLLASCGKDGNIFIWDTVQG---TVVRCLSGHTASVTCLRWGGEGL-IYSGSQDRTVKMW--RADDGVMCRNMTGHAHWINTLALNTDYALRTSCFEPSKRCIKPDTVEECQKVAQTRYEAALEIAGKETKQSINRMTGHMQLVNQVVFSPDTRIASASFDKSVKLWCGRTGK-------YLASLRGHVGPVYQVAWSADSRLVSGSADSTLKVFELK 432
21 -62.500[S] KOG0293 WD40 repeat-containing protein  ali follow..  16  271ESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGHISLKHVGHHKPVIAILWSPDDR-QVLTCGAEEVIRRWDV--DSGDCVHMYEKGGISPISCGWYPDGQGIIAGMTDRSICMWDLDGR---EKECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLFDREATV----ERLIEEEDMITSFSLSNDNKYILVNLLNQEIRLWNIEGDP---------------------KIVSRYKGHKRSIRSCFGGYKQAIASGSEDSQVYIWHRSTGK-------LIVELPGHAGAVNCVSWSPTNLLASASDDGTIRIWGLD 562
22 -62.300[R] KOG2096 WD40 repeat protein  ali follow..  13  83KGHGDAVTGLCFSSDGKSLATACADGVIRVFKLDDASSKSFINLPAGGHPTAVAFADDASSIVVACHHMSGSSLYMYGEDHIHEKRSVLTISGATATYGTADGSVVIASCSEGTDIVLWHGKTG---RNLGHVDTNQLKNHMAAVSPNGRFLAAAAFTADVKVWEIVYQEVSRVMQLKGHKSAVTWLCFSPNSEQIITASKDGSIRVWNINVRYHLDE--------DPKTLKVFPIPLCDSGGNPLHYDRLSLCPEGKILAASHGSTLQWLCAETGN------VLDTAEKAHEGDITCISWAPKAILGTSGDDKKVKLWEAP 449
23 -62.200[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  16  11TRHTEMVCGVGWIGTEA-ILSAADDHVFLLTNTATNESQQILNMPETFFPTSLHIFPRSNDVFAVSTSDGKINILS---RNGKVENMVDAHNGAALCARWNSDGTGLLSSGEDGFVKMWSR----SGMLRSVLAQFATAVYCVAWDSTSSNVLYCNADHCYIKSLKMQVA---PIKWKAHDGIILCCDWNPTSDLIVTGGEDLKFKVWDGF-----------------------GQILFNSSVHDYPITSISWNTDGTLFAVGSHNILRLCDKSGWSHSL--------EKMNAGSVMALSWSPDGQLAVGTAAGLVFHAHI. 296
24 -62.100[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  13  20RENTDKINAIDFAPNGEHLISCSEDDQIVIYDCEKGTQSRTVNS-KKYGVDLIHFTHANNTAISSTKVDDTIRYLSL--HDNKYLRYFPGHTKKVISLCISPVEDTFLSGSLDKTLRLWDLRSPNCQGLM-----HLSGRPIAAYDPEGLIFAAGVNSESIKLYDLRSFD-VTFKLNQEKECDWTGLKFSRDGKTILISTNGSVIRLVDAFHGTPLQTFTGYPN-------------------NKGIPIEASFSPDSQIFSGSTDGRVHIWNADTGN------KVSVLNGDHPGPVQCVQFNPKYMLASACTNMAFWLPTSE 314
25 -61.500[A] KOG0299 U3 snoRNP-associated protein (contains WD40 repeats)  ali follow..  13  138GRHMRPLVGVVAYENF--VYSADKSGLIQKWEALQEKDTENRENDHVKEITCLAISNDGR-WIVTGGLDHRIVIRDS--VTLEPQHCWKHHRDAVMGLAMRRGTNEMFSCSADRSIKVWSL---DQMSYIETLFGHQDVIFGVDALARERCVSVGGRDRTSRLWKIVEESGTSMKATAGYMEGSVDCVAMIDEDHFVTGSDNGVIALWSVQRKKPLFTYPLAHGLDPILAPGETSPDPVTIPPQPRWITSLAAIPYSLFASGSWDGNIRLWKIAEGLRSFEPLT-IATPLSVYGCINSLSLSLQGKFAACGRETRVGRWKTL 496
26 -61.200[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  18  28TGHVARINDVILLSKDEGVWTASDDRSVRLYLKRDNDQFWPSIHFMPVAPTSLYYSEETY-KLLVGLINGNVYEFSVADDSMTESRKWTCHAGPISGLGFALSSELIFSCSRDKSIVWHCSENSNQPNLVSKLSAHTNAITSLTWDGNKKVLYSGSSDHLIIMWDIGGGR-GEAYELNGHNGKVTTLCAAPAAKRLFSADEHGKLMCWDMNCKRVETPEWKTSDCCQKCNQPKVVGLRQHHCRTCGSAVCGSCCDNWTYPPMGYETKIRICNDCNDNPQNFNLTPLAIPHEIHTGITAMHLQETLLLVTSGQNRVIMIWDVR 405
27 -61.000[YU] KOG2445 Nuclear pore complex component (sc Seh1)  ali follow..  16  6SGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDNWELSDSWRA-HDSSIVAIDWASPEGRIIASASYDKTVKLWEEDPDQWNKLCTLNDSKGSLYSVKFAPAGLKLACLGNDGILRLYDALEPSDLRLSIPPANHLQSDFCLSWCPSRPEKLAVSALEQAIIYQRKDGKLHVAAKLPGHKSLIRSISWAPSYQLIATGCKDGRIRIFKITEKLS----------------------PLASEESLTNSNMFDNSADVDDAQGRSDSNTEEKAELQSNLQVELLS---EHDDHNGEVWSVSWNLTGTLSSAGDDGKVRLWKAT 334
28 -60.900[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  15  15KGHEGAVLAARFNGDGNYALTCGKDRTIRLWNPHRGILIKTYKS-HGREVRDVHVTSDNAK-FCSCGGDRQVYYWDV--STGRVIRKFRGHDGEVNAVKFNDSSSVVVSAGFDRSLRVWDCRSH---SVEPVQIIDTFLDTVMSVVLTKTEIIGGSVDGTVRTFDMRIGR----EMSDNLGQPVNCISISNDGNCVLAGCLDSTLRLLDRTTGE----------------------LLQVYKGHISKKTDCCLTNSDAVIGGSEDGLVFFWDLVDAK-------VLSKFRAH-DLVNSIDVDFYLRFFVAGDKRELPPEGRL 301
29 -60.900[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  17  12AQRSERVKSVDLHPTEPWILASLYSGTLCIWNYQTQVMAKSFEV-TELPVRSAKFVARKQ-WVVAGADDMYIRVYNY--NTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWA--CTQIFEGHSHYVMQVTFNPKDNTFASASLDRTIKIWNLG--SPDPNFTLDAHQKGVNCVDYFTGGDYLITGSDDHTAKVWDYQTKS----------------------CVQTLEGHTHNVSAVCFHPELIIITGSEDGTVRIWHATTYR-------LENTLNYGLERVWAIGYIKSSRVVIGYDEGTIMVKLGR 301
30 -60.600[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  18  58FEHKDSVFSVSINPVHNLCASGGGDDLGYIWDITTGEQICQLTG-HKDSIVAIDWSFDGT-YIATGGMDSQVRLWKS--STGFEFITAFETVDEIVWLSWHPKGLFLAAGCNDGSIWMWSLPSG---KVVQVMYGHTAPVNAGKFIPPGKRLATVDDSGTLIVWNPATDDHRFDPGNEETAAGWTSFDCNAEGNVLFLGGSSGKVKVVNINSSHILASLEAQTESVEAIALCTALPICACASPHEQAVIDCKFLPNTPLLTACADCVIRKWDVRSGQ-------LLGEYTGHQEPILCMAITPDGKVVTGSDDTELLVFDCE 398
31 -60.600[I] KOG0301 Phospholipase A2-activating protein (contains WD40 repeats)  ali follow..  17  26EAHKSDTKALAVTQGGC-LISGGRDETVKFWAKKGKQYTKTHAQPKGITVNSIAYAEADGWRLFVGRRDGTIAVFGP--SQAEPYAIFNEHKQNVCCLHINEKATHMLSGSWDSNVIIWPITENSSSFTTIVCPGHTLSVWALASFPDLNTYLSASADKTIRMWFGD----TTLSVFKGHTDVVRALVVLSSSH-FLSAGNDGHIIHWDVASAS----------------------ILRKFATQAHEFIYSMTLSDSHILTTGEDGTLEFWAIDGGKDGNLAIVSEAVIQLPTTNTWDAKVLLNSDIAVAGSDGRIYIMTTD 322
32 -60.400[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  14  305EQRDVQLTAANYNTRTKVLVVAFSSGAFYLYELPDVNMIHSLSI-SDYPISAALFNCTGDWVALASREIGQLLVWEWQSE--QYIMKQQGHSSEMTCIAYSSDGQFIATGGEDSKVKLWNTQSS---FCFVTFSEHTSGVTGIQFSRNKKFLVSSSLDGTVRAFDVNRYR-NFRTFTSPNPAQFSCVAVDYSGELVVAGGQDFDIFLWSVKTGKLLEIISGHEGPVVSIAFSPESNSEHETIDAVSDVTNVTFSPSGEIAVATLSGNITIFDIKSAGQVLETDIITARKNAQANYFSTIEYSADGEILAAGKSANICIYHVR 657
33 -60.200[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  17  412GGHRSDVRTLSFSSDNIAVLSAAAD-SIKIWNRSTLQCIRTM---TCEYALCSFFVPGDR-QVVIGTKTGKLQLYDLA--SGNLLETIDAHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKDENSTTRTLQLDEDVLCVSYSPNQKLLAVSLLDCTVKIFYVD--TLKFFLSLYGHKLPVICMDISHDGALIATGSADRNVKIWGLDFGD----------------------CHKSLFAHDDSVMYLQFVPKSHFFTAGKDHKIKQWDADKFEH-------IQTLEGHHQEIWCLAVSPSGDVVSSSHDKSLRLWERT 705
34 -59.400[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  20  273RIASSNLDHLAYDVVSNRFLAISAEQNLIILDFENLKIARQIVGFHDEIYSCCLLGKDESHMLASCSKDNSIIFWRLVTSTLVPVAAATGHANTVTALAISNTGRFLASVSTDCTIKLWGLGVSPKLTCSSTMVAHGKDVNCVDISESDALIATGGMDKLVKLWQVDTHK-GIAGTLSGHRRGVGDVKFAKNSHKLASCSGDMTIKIWNISEKS----------------------CLQTISGHSCAVFRVIFARNDSLISADSAGIIKIWTIKTAD-------CECSIDAHTDKIWSLSKNHNESFVTAGTDGRIVVWK.. 635
35 -59.300[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  14  124MMLNQLPFCLGFANNESLLAVCTETGALELFDSRFYDRQNEENQAHNNAIFSVNFSKDDS-LLATSSGDQTSKVFDLSTQQ-GRRGVDGYHSHSVKQVNFCNDSPNLVSCSRDGSIIFWDMRTHGRIRKAHENSGRDCSITSATWLPQSTVISSCSANSALKLWDLRTAATTPELTTSKRDFGVTNVCTSPDGERIYAASRDSIIYEYSSRHLNSGFC----------------KTYKDPRLRISSFYVKLACSPDGATLACGGTSGVVVFDTTRNCSSS-----AMLTGGHTKDVTAVDWSSEGQLASISDDGSVRVWNSS 466
36 -59.200[Z] KOG0313 Microtubule binding protein YTM1 (contains WD40 repeats)  ali follow..  21  98MFHDDWISSIKGAEEW--ILTGSYDKTSRIWSL-EGKSIMTIVG-HTDVVKDVAWVKKDSLLLLSASMDQTILLWEWNVEKVKALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDTRTPIVTLSGHMEAVSSVLWSDAEE-ICSASWDHTIRVWDVGSGS---LKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDG-------------------SLVSLSLTSHTGWVTSVKWSPTHQLISGSLDNIVKLWDTRSCKAPL------YDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYS 415
37 -59.100[R] KOG2394 WD40 protein DMR-N9  ali follow..  14  174HFSNSNPMCHAFAKDGHDLLIGLNSGDVYTVSLRQQLQDVSKK-NRQDRCTSISWVPGGDGAFVVAHADGNLYNKDGATSKSNPVARWHICQGSINSIAFSNDGAHLATVGRDGYLRIFDFLTQ---KLVCGGKSYYGALLCCSWSMDGKYILTGGEDDLVQVWSME--DRKVVAWGEGHNSWVSGVAFDSNWSRFGSVGQDTQLLLWDLEMDEIVVPLRRAPGGSPTYSTGSSASPIIAHRVHTEPLSGLMFTQES-VVTACREGHIKIWTRPSESET----QTNSSEANPTTALLSTSFTKDNKSLSSKIISGSTFKQ.. 556
38 -58.800[R] KOG0289 mRNA splicing factor  ali follow..  19  218SASIPGILALDLCPDTNKILTGGADKNVVVFDKSSEQILATLKG-HTKKVTSVVFHPSQD-LVFSASPDATIRIWSV--PNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTD-ETSGCSLTCAQFHPDGLIFGTGTMDSQIKIW--DLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQ---------------------LDNNFEVKSLIFDQSGTLALGGTDVQIYICKQWT---------EILHFTEHSGLTTGVAFGHHAKIASTGMDRSLKFYSL. 504
39 -58.700[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  15  17TKLDLQRVPRNYDPALHPFEVPREYNATKLERVFAKPFLASLDG-HRDGVNCLAKHPEKLATVLSGACDGEVRIWNLTQR--NCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIW--DEQRTNPICSMTWGFDSISSVKFNPIETLLGSCASDRNIVLYDMRQEAFIFTAANEDYNLYTFDMRALDTPVMVHMDHVSAVLDVDYSPTGKFVSASFDKSIRIFPVDKSRSREVY------HTKRMQHVICVKWTSDSKIMCGSDEMNIRLWKAN 355
40 -58.700[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  12  61TEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKEHLLKNEQPIAGPIKDISWSPDNQ-RIVAVGEGRERFGHVFMSETGTSVGEISGQSKSINSADFRPARPFIVTGSEDNTIAVFEG---PPFKFKMTKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEFGSPAHKGGVYALAWKPDSTQLLTCSGDKTCRLWTVESREDNLITVSLSGVITYLNVADPSKPLRVVKGHNKPITVLGLSDDRSIYTGSHDGVVTNWNSGSGT--------NDRITGTGHGNQINGIAAWGDVYTCGIDDSLRQFSVE 396
41 -58.700[R] KOG1334 WD40 repeat protein  ali follow..  13  274GSHAGSVSTIHFNQRGTRLASSGDDLRVIVWDWVRQKPVLNFESGHDINVIQAKFFPNGDSTLAMCGHDGQVRVAELINAS-ENTKRVAKHRGPAHELALEPDSYKFLTSGEDAVVFTIDLRQDRPASVVTRENDKKVGLYTISMNPANIQFAVGGHDQFVRIYDQRRID-PHHLVYCDFPTNITCVVYSHDGTELLASYNDEDIYLFNSSLSDGAQYVKRYKG-----------------RNNDTIKCVNFYGPRSEVVSGSDCGHVFFWEKSSSQ------IIQFMEGDRGDIVNCLEPHPYLVLATSGLDQHVRIWT.. 590
42 -58.200[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  14  126VLPDFGPYKLDFTASGRHMLAGGRKGHLALLDMMNMSLIKEI--QVRETVRDVAFLHNDQ-FFAAAQKKYAYIYGRDGTE-----LHCLKERGPVARLRFLKNHFLLASVNMSGQLHYQDVTHG---GMVASIRTGKGRTDVMEVNPYNSVVGLGHSGGTVTMW--KPTSQAPLVQMQCHPGPVSSVAFHPNGHLMATSGKERKIKIWDLRKFEE------------------------VQTIHSFHAKTLSFSQKGLLAAGT-GSFVQILGDSSGGSSHNYTRYMNHSMVKGYQIEKVMFRPYEDIGIGHSMGWSSILIPG 410
43 -58.000[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  16  4CGHTSPVDSVAFNSEEVLVLAGASSGVIKLWDLEESKMVRAFTG-HRSNCSAVEFHPFGE-FLASGSSDTNLRVWDT--RKKGCIQTYKGHTRGISTIEFSPDGRWVVSGGLDNVVKVWDLTAG---KLLHEFKCHEGPIRSLDFHPLEFLLATGSADRTVKFWDLE--TFELIGTTRPEATGVRAIAFHPDGQTLFCGLDDG-LKVYSWEPVI----------------------CRDGVDMGWSTL-GDFCINEGKIGCSYYRNSVGIWVSDISE-MGSGPRGSVSPDYETREIKNIYVDSTGGLNVAQNPGSLKATLPL 321
44 -58.000[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  16  77DGVQKNVTRLGFQEDGNWMFTAGEDHHVRIWDMIAAPPHCSRIFDCEAPVNAACLHPNQV-EIAMGSQNGSVFLWDV--KSERHERIVPEVDASIQDVAISPDGRYLAAANNKGNCYIWSLTSQDTLRPNRKIPAHSRYILRCKFSPDSRLLLTTSGDGTVCIWKTD--DFSKWRELCIENYWVWDAAFSADSKWLFTASSDGIARLWKLQTKS----------------------SIRDYTGHTKAITALSFKDEIPKSTNISDVQSSAKPPTQ-------------RDNPPGTNNLAFFETVGRAMNPYMGNTTTELN.. 362
45 -57.800[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  16  481LNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQNRDNYIRSCKLLPDGC-TLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQ---TLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGR---QLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPD-----------------------KYQLHLHESCVLSLKFAYCGKFVSTGKDNLLNAWRTPYGASIF--------QSKESSSVLSCDISVDDKIVTGSGDKKATVYEV. 768
46 -57.400[S] KOG0281 Beta-TrCP (transducin repeats containing)/Slimb proteins  ali follow..  21  203SENSKGV--YCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTG-HTGSVLCLQYD---ERVIVTGSSDSTVRVWDV--NTGEVLNTLIHHNEAVLHLRFSNGL--MVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDF--DDKYIVSASGDRTIKVW--STSTCEFVRTLNGHKRGIACLQY--RDRLVVSGSSDNTIRLWDIECGA----------------------CLRVLEGHEELVRCIRFDNK-RIVSGAYDGKIKVWDLQAALDAPASTLCLRTLVEHSGRVFRLQFD-EFQIISSSHDDTILIWDFL 486
47 -57.300[R] KOG4227 WD40 repeat protein  ali follow..  13  8GGSMRSVVGFLSQRGLHGDPLLTQDFQRRRLRGCRNLYKKDLLG-HFGCVNAIEFSNNGGQWLVSGGDDRRVLLWHMEQSRVKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSE----TLDVFAHEDAVYGLSVSPVNNIFASSSDDGRVLIWDIRESPHGEPFCLANYPSAFHSVMFNPEPRLLATANSKEGVGLWDIRKPQSSLLRNLSLQSAMSVRFNSNGTQLLALYFNSCTMKSCCFAGDRDILSGSDDFNLYMWRIPADPEARVVNGAFMVLKGHRSIVNQVRFNPHTMICSSGVEKIIKIWS.. 361
48 -57.200[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  20  258VGDTRPVSSAAFSEDSSLLLTSSWSGLCKLWSVPDCELKQTLRG-HASYVGGVALRPGVKAAMASGGHDGAVKLWGF--NNEESIADITGHPHRVSKVAFHPSGRFLATACYDSSWRLWDLEQKTE---VLHQEGHAKPVHCLSYHSDGSVLVTGGLDAFGRVW--DLRTGRCIMFLEGHLGAVFGVDFSPNGFHIATGSQDNTCKIWDLRRRQ----------------------PVYTIPAHTNLISDVKYQQECFLVTCSYDSTTKIWSNKTWQP-------LKTLQGHDNKVISVDIAPNSQIATTSFDRTFKLWSPD 552
49 -56.700[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  14  120SHGTQAISALRVEPPGVRFASGGLDYYVKLFDFQKMDMSKELLPAESHVINSLAFSPNGE-TLVVASGEAIIRLLDRAGKQ-IDLNITKGHTATVNCVEFNPLNKEFISCSDDGSLRLWNLDDHKKVIKTKGANGKRVSPQVCTFSPDGKWIAAGCDDGSVQAWKYGSQY-VNYLVRKAHNGSITSIAFSPDSKRLLSRGFDDTLKMWSLDNPKEPL-------------------LVKTGLENAFKSTDCGFSPRAEVVFTGTPGTLQFFDPMTFDL-------VYKIDYPGISCHRIQWHPRLQIIAGLSDGTIHVYYDQ 448
50 -56.700[S] KOG0283 WD40 repeat-containing protein  ali follow..  14  401QAHEGAVWTIKFSQDAHYLASGGADRVIHVWEVQECELMSMNEG-SLTPIHPSLCDSSGNE-ITVVEKKKKGKGSSGRRHSDKPVCSLKGHLDAILDLSWSKSQL-LLSSSMDKTVRLWDIETKT----CLKLFAHNDYVTCIQFSPDENYFLSGSLDAKIRIWSIQDRH---VVEWSDLHEMVTAACYTPDGQGALIGSHKGICRAYDTEDCKLSQTNQIDVQS-------------NKKSQAKRKITSFQFSPVNEVLVTSADSRIRILDGSEVIHKF-------KGFRNTCSQLSASYSQDGKIICASEDSQVYLWKND 712
51 -56.500[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  13  359GAHEGGISPLCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIPGHTDELWGLAIHASKP-QFLTCGHDKHATLWDAVGHR---PVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETK---DLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNG-TRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVGSDGTDINAVCRAHEKKLSTGDDFGKVHLFSYPCSQFR----APSHIYGGHSSHVTNVDFLCEDSISTGGKDTSIMQWRV. 716
52 -56.400[T] KOG4378 Nuclear protein COP1  ali follow..  17  1......MMSNLVEPSWRLLAASGGD-TVKLFDVSADSGDPCVLSSPGCAVNSVKWNHTNL-VVASTGEDKKISLWRKNGQSLGTVDGGDSAEECLSAISFSKKGSYICSGGTGQIVKIWDLQRK---LCIKKLKGHTSTITGVMYNCKDEHLASVSVGGDLIVHNLASGARATEGQVVQFVHVLRLLDYSRSSRLLVTAGDDGTVHLWDTTGRS---------------------PKMSWLKQHSAPTAGVCFSPSNEIASVGMDKKLYTYDSGSRR--------SSSCIAYEAPFSSLAFGDNGYLVAGTSNGRVVFYDIR 300
53 -56.200[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  14  23EDEPAVVSSVRISPKKPYHVATTSSVRLTLYDTVVCEPLNLFSR-FKKGVCSIDFRHDGR-LLAIGGDEGKVRIFDVEKSSKVALRVMQASQSTVKSVHFSPRGDTVFSMADDGKIKQYRVADTANAVPIIEIQAHEDAIRCGAVSSNDHIVLTGGYDHKVRLWDIRSKE---KSLELDCEHPVESVLFLPGEQLIATAA-GPIVKIWDTTTGR----------------------QLTALQAHYKTVTSLRLATNSTLLSAGIDRRVNAFRTTNYS--------LINSWSMPSPVLDIDVSRDDQMAIGMGNLLALYRRAE 317
54 -56.200[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  13  14NPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLKGEF--LHGGAVLDCCFHDDFSGF--SVGADYKVRRIVFNVGKEDILGFDFSILFFYTLCLFCDVTGQVITGSWDKTVKCWDPRGASGPERT-QVGTYLQPERVYSMSLVGHRLVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEAAQAKK---------YAFKCHRKSEAGRDIVYPVNSIAFHPIYTFATGGCDGFVNIWDGNNKKR-------LYQYSKYPTSISALSFSRDGQLAVASSYTAIFVRSVN 338
55 -55.900[R] KOG0288 WD40 repeat protein TipD  ali follow..  16  228HAHEGGCGSIVFEYNSGTLFTGGQDRAVKMWDTNSGTLIKSLYG-SLGNILDMAVTHDNK-SVIAATSSNNLFVWDV--SSGRVRHTLTGHTDKVCAVDVSKFSRHVVSAAYDRTIKLWDLHKGYCTNTV----LFTSNCNAICLSIDGLTVFSGHMDGNLRLW--DIQTGKLLSEVAGHSSAVTSVSLSRNGNRILTSGRDNVHNVFDTRTLEICGTLRASGNRL------------------ASNWSRSCISPDDDVAAGSADGSVHVWSLSKGN-------IVSILKEQTSPILCCSWSGIGKLASADKNGYVCTWT.. 515
56 -54.900[DK] KOG0973 Histone transcription regulator HIRA, WD repeat superfamily  ali follow..  19  4VGHDTGILAIDCHPSGKKFITCTSNGLVVVWNAEPVLDKKKASNESQSQSNSCRWSPDGK-RFAFGSDDSSVSVWEYVGERYKECCVLRGHSMEVLTVEWSPNGKYLASGSIDYRIIIYNARKLPD--RITVLNDIQLPVKGLSWDPIGKYLASLEGDKKLRFWATDSWQ-TEPFESNIEETMLTRLDWSPDGKYLMTPAAVRLIKLIQRQT-----------------------KSDQFLAGHHKGTTCVRAMPR-CAAVGSRDKSISIWVFPGTLKPLF-------VINNIFNHTVMDFAWCGRLLACSQDGTVKVIHLS 347
57 -54.800[S] KOG4328 WD40 protein  ali follow..  13  211RVVPGRIFVVQFLPNVKMVAAGDKLGNVGFWNLDCGNEEDYLFTPHSAPVSSIVFQQNSLSRVISSSYDGLIRLMDVEKSV---FDLVYSTDEAIFSLSQRPNDQSLYFGQDYGVFNVWDLRAGKS---VFHWELHERRINSIDFNPQNPVMATSSTDGTACLWDLRSAKKPKTLSTVNHSRAVHSAYFSPSGLSLATTSLDNYIGVLSGANFENTCMIYHNN------------------TSRWISKFKAVWGWDDSIYVGNLSKKIDVINPKLKR-----TVMELHNPLQRAIPCRIHCHPYGTLAGSTAGGQVYVWTTK 516
58 -54.700[T] KOG1354 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  12  25VAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSLEIEEKINKIRWLPQKNAQFLLSTNDKTIKLWKISEEASPRRIFANAHTYHINSISINSDYETYLSAD-DLRINLWHLEITDRSFNIANMEELTEVITAAEFHPNSNTFVYSSSKGTIRLCDMRASAPSNRSFFSEIISSISDVKFSHSGRYMMTRD-YLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYE------NDCIFDKFECCWNGSDSVMTGSYNNFFRMFDRNTKRDITLEASRENNKPDFNKKILHTAWHPKENIIAVATTNNLYIFQDK 445
59 -54.700[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  22  130NKVKCPVYSVCWSPEGKRLITGCQTGEFTLWNGTAFNFETILQA-HDSAIRALKWASNEQ-WLLSADQGGYVKYWQPNMN--NAHMFSAHKDEAIRGLAFAPTDVKFATASDDGTARVWDF---ARYTEERVLRGHGAEVRCIDWHPTKGLIATGSRDTPVKIW--DPKSGSCLATLQEHKSSVMAVEFNKNGNWLLTGGRDHLVKMYDIRMMKE----------------------MRTYRAHKKEVISLAWHPIHEFVSGGGDGSIVYWMVDGEKEI------GLLEHAHDQAIWSMKWHPLGHLATGSNDNNTKFWARN 419
60 -54.600[BL] KOG1009 Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats)  ali follow..  16  10WHNKEPVYSLDFQHGTARLASAGVDTNVRIWKVEKGEFLSNLAR-HTKAVNVVRFSPTGE-ILASGGDDAVILLWKVNDENWTVVKTLRGHLEDVYDICWATDGNLMASASVDNTAIIWDV---SKGQKISIFNEHKSYVQGVTWDPLGQYVATLSCDRVLRVYSIQKARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNT-------------TYVFSRKNLKRPIAHLPCPGKATLAVRCCPYRLVFAVASEDSVLLYDTQQSFPFGYV------SNIHYHTLSDISWSSDGALAISSTDGYCSFVTFE 376
61 -54.300[R] KOG2055 WD40 repeat protein  ali follow..  13  214APSHSGIRCMSIHPYFPLLLTCGFDRTLRIYQLDVNPLVTSLHL-RSSALQTALFHPDGKR-VIAAGRRKYMYIWDLESAQVQKVSRMENFQPSMERFHVDPTGKYIALEGRSGHINLLHALTGQFATSF----KIEGVLSDVLFTSDGSEMLVLSYGAEVWHFNVEQRS-VVRRWQVQDGVSTTHFCLDPSNKYLAIGSKSGIVNIYDLQTSNADAA----------------PKPVTTLDNITFSINSMSFSQDSQVASRGKKDTLRLVHVPSFS----VFRNWPTSATPLGRVTCLAFGKGGELCVGNEAGRVGLWKLA 516
62 -54.200[R] KOG0646 WD40 repeat protein  ali follow..  17  2..............EITVIASSSIDEGIGSWDLKTGTEQLQFKP-CASPAHGLTAVGEKSSQLSARNTSGSIFYWSWTKPQ---AEVKSYPVEPIKALAANNEGTYLVGGGISGDIYLWEVATG---KLLKKWHGHYRSVTCLVFSGDDSLLVSGSQDGSIRVWSLQQGNTLYEHNFNEHTMSVTDIVIDYGGCVIISSSEDRTCKVWSLSRGKLLKNI-----------------------IFPSVINALALDPGGCFYAGARDSKIYIGAINATSEY--GTQVLGSVSEKGKAITCLAYCADGNLISGSEDGVVCVWDPK 293
63 -53.600[R] KOG1273 WD40 repeat protein  ali follow..  12  20YLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDFETRGIAKEIRDDCSAAITSVSWSKYGH-RLLVSAADKSLTLWDVSTGE-PSLCLACPLSSAPMIVDFDIDCTTLLPVSVPEMPDVLAPPQRS----KCPESNPPFSPAAACFNKCGDLVYIGNSKGEILIVDYKSVR-VLALVSASGAAPVKNIVFSRNGQYLLTNSHDRTIRIYENLLPAKNKMKTVGSKCLTLFREFQD-------SVTKMHWKAPCFSGDGEWVVGGSEHKIYIWDRAG--------HLVKILEGPKEALIDLAWHPVHIIVSVSLAGLVYIWAKD 347
64 -53.600[R] KOG1539 WD repeat protein  ali follow..  16  185KGWGSSVTSCVSSPALDVVAIGCADGKIHVHNIKLDEEIVTFEHASRGAVTALSFSTDGRPLLASGGSFGVISIWNLNKKR-LQSVIRDAHDSSIISLNFLANEPVLMSASADNSLKMWIFDTNDDPRLLRFRSGHSAPPLCIRFYSNGRHILSAGQDRAFRLFSVIQEQKGVFVSRNHLLLAILACAISACGNFAVVGTAGGWIERFNLQSGISRGSYFDMSE--------------KRRYAHDGEVIGVACDSTNTMISAGYHGDLKVWDFKKRELKVVTLKMVREFRGHTDRITDLCFSEDGKVISSSMDGSLRIWDVI 608
65 -53.200[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  12  80AFRNKPKSLLSTNHSDSPHQNPKPVKPRRYIPQNSERVLDAPGLRDDFSLNLLDWGSAN---VLAIALGDTVYLWDASSGSTSELVTIDEDKGPVTSINWTQDGLDLAVGLDNSEVQLWDCVSNRRSSIVETYLGHTEEVCGLKWSESGNKQASGGNDNVVHIWDRSLQTRQWLHRFEEHTAAVRALAWCPFQASLLATGGDGKIKFWNTHTGACLNSVETGS-----------------------QVCSLLWSQSERSSHGFTQNQLTLWKYPSMSK-------MAELNGHTSRVLFMAQSPNGCVASAAGDENLRLWNVF 418
66 -53.200[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  13  2.........SFFNRSNTTSALGTSTAMANEKDLANDI---VINSPAEDSISDIAFSPQQDFMFSASSWDGKVRIWDVQNGV-PQGRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQ----TQQIGMHSAPIKVLRFPSNTECIVTGSWDKTIKYWDMRQPTTIFKATTSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDGMQKKSGFSFK-----RQTNPNRAPGSNGQSLVYPVNSIAFHPLYTFVTAGGDGTFNFWDKNQRHR-------LKGYPTLQASIPVCSFNRNGSFAYALSYDWHQGHMGN 341
67 -52.900[R] KOG1188 WD40 repeat protein  ali follow..  14  27..LGIDTSKTVQAGKENLVAVLCSNGSIRIYDKERLNVLREFSG-YPGLLNGVRFANSCD-SVYSACTDGTVKCWDARVAREKPVQLFKGYPSNFISFDINCNDHIICAGTEDALLVFWDARMNSKDSLGAYSETHSDDVTQVRFHPSNNMVVSGSSDGLVNVFDINIDN-DALVTTCNSISSVSCIGWSGKGKQIYCMTHDEGFYWWDLNHLDTDEPVTRLN-------IQDVREVVNMKEDALDYLIGGLYHEKTHVIGGTNKGRIHLMNCSMSGLT----HVTSLQGGHAATVRSFCWNVQDDLLTGGEDAQLLLWKPG 351
68 -52.800[T] COG5170 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  13  26ITEADIISAVEFDHTGDYLATGDKGGRVVLFERNHSKKGCEYKFEIEEKINKIRWCKRTNAHFLLSTNDKTIKLWKLYEKN-PRRVYANAHAYHINSISVNSDAETYISAD-DLRINLWNLSISDH-IKPENMEELTEVITSAEFHPNCNHLMYSSSKGNIKLLDLRQSDQDSKSFFSEIISSISDVKFSQNGRYILSRD-YLTLKIWDVNMEKAPVKTIPLHDVLRSKLCDLYE------NDCIFDKFECTFSGDDKVLSGSYSNNFGIYPTDSSLPGDRGQIVLQDNLDYNKKILHASWHPFEDSVAIAATNNLFVFS.. 461
69 -52.600[S] KOG0294 WD40 repeat-containing protein  ali follow..  13  2.............PPEMEIIEATNEELLLGFKLIKSPTDGFTDSSYARSITSLA----QWPWVASGGTDGRIFVYDM--RTRKQSQIILSHAGRVNTLKFTPDLSLLLSGSDDGHMIATRVGSWT--KEYDWQKAHAGQVTHVSCHPSSKLALSLGGDQVLNTWNLVNGCVAHKTNLKTLDFQTGCLSWSKQGDHFTLSG-PLVLEIWGIENAHVMRRI-----------------------EMPSKPICITWLDGNECLTGLDNGNIAWISLKDEDDTP-----PTFILAHEVRVKAIAYLNE-FLATVSIAGQIKVWKID 289
70 -51.900[R] KOG2444 WD40 repeat protein  ali follow..  12  4.EFDNPPLCMKSNKDGSRLVVGFVDGSIRFYDTQQHEEEFQEKFQTKSSIRGVDLDEHKK-RVYAVTKNRSLCVFDIDTGK-RVRCILKCHRSVPTAICTLPKSQQLATADESGEVKTWNLDPEVENANIRKWQEQDEDINDLKVDVKSNLLATSS-DGTLGAY--DLRKAKLKMRSELMHSEL--YSVCGTNRSVYVGGEDGYVEVFNLNEYGN--------------------LLERVESGFEMGVNGIVELRSGLGLTSQGSNRMRLLNVQPSK-RLGYAGYHGDEKSDDDGIDAITISTDKSFTMISMSCTIKKWDMG 307
71 -51.700[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  13  12QTYGVPIYAVDWILEEAVRSKITKDQDDDDDDGSSSSSYIVLSGGGTDLPYRMAIHPRQGGLICALPNSCRLFDWENNEEESEKVVKELKDVGQQLSLSFNQDGTVLATGAEDGTLRVFEWPSMKT---LLNESKTHASVKSLTFSESGKFLVSLG-APLCRVWDVNASA-AIASLSKEKDEMFASCRFSVDNSVAANTQRGGSIITWDTTSWR---------------------RRSSKLIKRNNSISAFNVSADGKLAVGTLEGDVLIIDSTKMQ------TNQIVKKAHLGLVTALTFSPDSRLVSVSFDSRARLTVIK 348
72 -51.500[B] KOG0264 Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1  ali follow..  17  120INHEGEVNRARYMPQNPIIATKTPSSDVLVFDYTKHPAKPDPSGGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGP-DAKAIFTGHSAVVEDVAWHLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEILATGSADKTVALWDLRNLK-LKLHTFESHKDEIFQVHWSPNETILASSGTDRRLNVWDLSKIGEEQSAEDAE--------DGPPELLFIHGGHTAKISDFSWNPPWVICSVSEDNIMQIWQMAEN-----------IYNDEESDVTTSELEGQG................. 424
73 -50.700[R] KOG0322 G-protein beta subunit-like protein GNB1L, contains WD repeats  ali follow..  11  13RSPDGAVNSLCFQESDR-LLAGTIKGSVFLWDLQTNRSALHFEV-GSDPITSLHHTPDR---LVTQEKGGTITMFSIGGSSYVKENHLGFCRSALHTNTSKTNEQLLFYPCEESSIGVLHVTDAAAPTQILVPDDPQLPCFKPFECASQLFLLAGYESGHFLTWDISSSV---ILDVMELAQDATSVDYDPVTNRGIVGGPTDKLISFSYQRSSMQMQL------------------GSELCIKNPGVNGVRIRPDQKFASAGWDGRIRIFSWKSLRP-------LAVLTQHKNGVMDLAFSSQQVMAAAGMDGQISLWDLY 322
74 -50.400[R] KOG2321 WD40 repeat protein  ali follow..  10  7NPNNVRVYTVSGEGVTQRLPNWISKRKLKKDYALSHRIELLQDFEYPEASNRIKCTRDGKYAMATGVYKPHIKVFDF--AEMSLKFERHTDAENVQFEILSDDWTKSVHLQTDRTVDFHSQGGIHY------STRIPKYGRDLKYHYPNCDLYLAAAGDEVYRLNLEQGR-IESAQIDSPTGGVNVIDINPMHQLLAFGTDAGSVEFWDPRDRSRVGILEIPSTV-----------PSTPYSDNSRSVTALKYRNDGLVAIGLSDGATLLYDLRSSSP------YMSKDQGYSMPIKSLHWMDSAARVLSADSKIIKIWEKD 313
75 -50.300[KL] KOG4283 Transcription-coupled repair protein CSA, contains WD40 domain  ali follow..  16  40SPHRGSVNSLQVDLEGRYLLSGAADGSAAVFDVQRATDYEASGNGHKYAISSAIWYPIDTGLFITGSFDHYLKVWDTNTAQAVVDFKMPGKVYRTAMSSMAMSHTLIAAGTEDVQVRLCDIASG---AFSHTLSGHRDGVMSVEWSTSSEVLYTGGCDGAIRFW--DIRRAGCFRVLDQSQT---QLGFRPPILKRTAVGSKVCS..................................................................................................................... 254

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhao Y, Hong DH, Pawlyk B, Yue G, Adamian M, Grynberg M, Godzik A., Li T. The retinitis pigmentosa GTPase regulator (RPGR)- interacting protein: subserving RPGR function and participating in disk morphogenesis. Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3965-70. Epub 2003 Mar 21.