current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [O] KOG0739 AAA+-type ATPase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .
# Score Template Links and tools%idFirst MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQESLast
1 -127.000[O] KOG0739 AAA+-type ATPase  ali  100  1MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES 437
2 -85.300[O] KOG0737 AAA+-type ATPase  ali follow..  33  369..................................................................................EGQGCFEDSLKLDTNIDSKEVAPDNEFEKRIRPEVIPNEIGVTFADIGSLDETKESLQELVMLPLRRPDLFKGLLKPCRGILLFGPPGTGKTMMAKAIANEAG-ASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRTRGEHEAMRKIKNEFMTHWDGLMSNGDRILVLAATNRPFDLDEAIIRRFERRIMVGLPSVESREKILRTLLSKEK--TENLDFQELAQMTDGYSGSDLKNFCTTAAYRPVRELIKQECLKDQERRKREE-----------AEKNSEEGSEAKEEVSEERGITLRPLSMEDMKVAKSQVAASFAAEGMNELKQWNDLYGEGG 715
3 -82.900[O] KOG0740 AAA+-type ATPase  ali follow..  36  341..................................................................VPPIPKQDGGEQNGGMQCKPYGAGPTEPAHPVDERLKNLEPKMIELIMNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSG-ATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVINLMSKEQCCLSEEEIEQIVQQSDAFSGADMTQLCRGASLGPIRSLQTADI-------------------------------------ATITPDQVRPIAYIDFENAFRTVRPSVSPKDLELYENWNKTFGCG. 673
4 -61.900[O] KOG0652 26S proteasome regulatory complex, ATPase RPT5  ali follow..  31  151..........................................................................................................SEYDSRVKAMEVDEKPTEDYNDIGGLEKQIQELVEAIVLPMTHKERFEKL-RPPKGVLLYGPPGTGKTLMARACAAQTN-ATFLKLAGPQLVQMFIGDGAKLVRDAFQLAKEKAPCIIFIDEIDAIGTKRFDSEDREVQRTMLELLNQLDGF-SSDERIKVIAATNRADILDPALMRRLDRKIEFPHPTEEARARILQIHSRKMNVH-PDVNFEELARSTDDFNGAQLKAVCVEAGMLALRR-------------------------------------------------DATEVNHEDFNEGIIQVQAKKKAS................ 419
5 -61.600[O] KOG0728 26S proteasome regulatory complex, ATPase RPT6  ali follow..  32  128..........................................................................................................NKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDGIAQP-KGVLLYGPPGTGKTLLARAVAHHTE-CTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGDSEVQRTMLELLNQLDGF-EATKNIKVIMATNRIDILDPALLRRIDRKIEFPPPNEEARLDILKIHSRKMNLT-RGINLRKIAELMPGASGAEVKGVCTEAGMYALRE-------------------------------------------------RRVHVTQEDFEMAVAKVMQKDSEKNMSIKKL......... 403
6 -61.200[O] KOG0727 26S proteasome regulatory complex, ATPase RPT3  ali follow..  31  139..............................................................................................................SSISLLSQSEKPDVSYNDIGGCDIQKQEIREAVELPLTHHELYKQI-DPPRGVLLYGPPGTGKTMLAKAVANHTT-AAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQDREVQRILMELLNQMDGF-DQTVNVKVIMATNRADTLDPALLRRLDRKIEFPLPDRRQKRLVFQVCTSKMNLS-DEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRK-------------------------------------------------NRYVILPKDFEKGYRANVKKPDTD................ 403
7 -61.100[O] COG1222 ATP-dependent 26S proteasome regulatory subunit  ali follow..  31  140......................................................................................................................DAKPDETYEDIGGLERQIEELNEAIVLSLTHPERFENIKPP-KGVLMYGPPGTGKTLMARACASKTN-ATFLKLAGPQLVQMYIGDGARLVRDAFALAKERKPTIIFIDEIDAIGAKRSDSDDREVQRTMLELLNQLDGF-SSSEEVKIIAATNRVDILDPALLRRLDRKIEFPLPNTLGRKRILQIHARKMSVR-DDVNFDELARSTEGFNGAQCKAVCVEAGMAALRK-------------------------------------------------EKTEISQNDFMDGIQEVLSRKKSKLL.............. 398
8 -61.100[O] KOG0651 26S proteasome regulatory complex, ATPase RPT4  ali follow..  31  130..........................................................................................................REVDPLVYKMSHEDPGNISYSDVGGLAEQIRELREVVELPLINPELFKRV-TPPKGCLLFGPPGTGKTLLARAVASQLD-CNFLKVVSSAIVDKYIGESARMIREMFNYARDHQPCIVFMDEIDAIGGRRFSEGTSADRRTLMELLNQLDGFDSLGK-VKVIMATNRPDTLDPALLRRLDRKIEIGLPNEQSRLEILKIHSNKITKH-GEIDFEAVVKLSDGFSAADLRNVCTEAGMFAIRA-------------------------------------------------EREFVIDEDFMKAVRKVGDAKRLETKLDYKP......... 405
9 -60.700[O] KOG0733 Nuclear AAA ATPase (VCP subfamily)  ali follow..  27  115...................................................................TSLWSSPNLKEIDGEDEKKSVGQESITGSAKRKDRRSKTNGSKRQKAEANREPPSDISLSDIGGLDDCINELLELVAMPIKHPEVYQYTIHPPRGVLLHGPPGCGKTMLANALANELG-VPFISISAPSIVSGMSGESEKKVREVFEEAKSLAPCLMFIDEIDAVTPKRESAQREMERRIVAQFLTCMDELSTDGKPVLVIGATNRPDSLDSALRRRFDREICLTVPSQDAREKILRTMAKGLKLS-GDFDFRQLAKQTPGYVGADLKALTAAAGIIAIKRIFNEISPLNKLDLNSDPRFNELDSDMALDSNDSLPYLNAHPDPLSPEELEPLAICPQDFIEALAKVQPSSKREGFATVPG......... 488
10 -60.600[O] KOG0726 26S proteasome regulatory complex, ATPase RPT2  ali follow..  31  164..........................................................................................................DDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEM-KPPKGVILYGPPGTGKTLLAKAVANQTS-ATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNEREIQRTMLELLNQLDGFDSRGD-VKVIMATNRIETLDPALIRRIDRKIEFPLPDEKTKRRIFTIHTSRMTLA-EDVNLSELIMAKDDLSGADIKAICTEAGLMALRE-------------------------------------------------RRMKVTNEDFKKSKESVLYRKKEGTPEGL........... 437
11 -59.100[O] KOG0729 26S proteasome regulatory complex, ATPase RPT1  ali follow..  31  155..........................................................................................................PKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNL-EPPKGVLLFGPPGTGKTLCARAVANRTD-ACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNRTMLELINQLDGFDPRGN-IKVLMATNRPDTLDPALMRRLDRKIEFSLPDLEGRTHIFKIHARSMSVE-RDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRA-------------------------------------------------RRKIATEKDFLEAVNKVIKSYAKFSAT............. 426
12 -55.700[O] KOG0730 AAA+-type ATPase  ali follow..  31  226................................................................................................................VKREDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSI-KPPKGILLYGPPGSGKTLIARAVANETG-AFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTNGEVERRIVSQLLTLMDGL-KSRAHVIVMGATNRPNSIDPALRRRFDREIDIGVPDEIGRLEVLRIHTKNMKLA-EDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDDSIDAEILNSMA--------------------------------VSNEHFHTALGNSNPSALRETVVEVPN......... 509
13 -54.200[R] COG1223 Predicted ATPase (AAA+ superfamily)  ali follow..  35  97......................................................................................................................EIVRDITLDDVVGQEEAKRKAKVILEY-LRNPEKF-GKWAP-KNVLFYGPPGTGKTMMAKALSNEAK-TPFLSVKSTKLIGEHVGDGARRVHELYERARQLAPCIVFLDEFDAIALDRGYQERGDVSEIVNALLTELDGT-NSNEGICTIAATNRVELLDASIRSRFEEEIEFRLPSYEERLEILRRNLEEFPVP-VKARLELVAAASEGFSGRDLVEKVIKASL.............................................................................................. 316
14 -52.900[O] KOG0741 AAA+-type ATPase  ali follow..  22  162......................................................................GEPATGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKESDIFRRAFAFRVFPPEIVEQM-IHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEANIRKLFADAEESGLHIIIFDEIDAICKQRGSMAGSTHDTVVNQLLSKIDGV-EQLNNILVIGMTNRPDLIDEALLRRLEVKMEIGLPDEKGRLQILHIHTARMRGH-ADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQ----------------------------------VTRGDFLASLENDIKPAFGTNQEDYASYIMN..... 505
15 -52.200[O] COG0464 ATPases of the AAA+ class  ali follow..  33  211.........................................................................................................................PTVMYEDLGGLKDAISKVREMIELPLKHPELFDRL-DAPKGVLLQGPPGTGKTMLAKAVANESD-AYFISINGPEIMSKYYGESERAIREIFEDAEKNAPAIIFLDEIDSIAPKRAEVTGEVERRVVAQLLSLMDGL-KARKNVIVIGATNRPEALDIALRRRFDREIELRVPDTEGRLEIFQIHTRGMPLA-DNVNLMDFAQITYGFVGADIAALCREAAMSALRRILPKINLNEPEISKEILDALQ--------------------------------VTREDFENALKDVQPSAIREILIEVPNWEDVGG... 493
16 -50.200[O] KOG0736 Peroxisome assembly factor 2 containing the AAA+-type ATPase domain  ali follow..  28  669..........................................................................................................DRSKKRNASALAPKVPNVKWDDVGGLEDVKTSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECS-LNFLSVKGPELINMYIGESEKNVRDIFEKARSARPCVIFFDELDSLAPARGASGDSGMDRVVSQMLAEIDGLSDSSQDLFIIGASNRPDLIDPALLRRFDKLLYVGVADASYRERVLKALTRKFKLS-EDVSLYSVAKKCSTFTGADMYALCADAWFQAAKRKVSKSDSGDMPTEEDDPDSVV--------------------------------VEYVDFIKAMDQLSPSLSITELKKYEMLRDQFQGR. 971
17 -42.300[O] COG0465 ATP-dependent Zn proteases  ali follow..  31  133...........................................................................................................SFGKSKARMLTEDQIKTSFADVAGCDEAKEEVSELVDY-LREPSRFQGGKIP-KGVLMVGPPGTGKTLLAKAIAGEAK-VPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGGHDEREQTLNQMLVEMDGF-EGNEGIIVIAATNRPDVLDPALLRRFDRQVVVGLPDVRGREQILKVHMRRVPLD-TDIDASVIARGTPGFSGADLANLVNEAALFAARG-------------------------------------------------NKRVVSMVEFEKAKDKIMMGAERRSMTEAQKESTAYHEAG 417
18 -40.200[K] COG1224 DNA helicase TIP49, TBP-interacting protein  ali follow..  18  1.....................................................................................................MAGEIREITQTFERRGLGLDENLRAKDVADGLVGQKRAREAAGVI---VRLIKSGKMAGRGILMAGPPGTGKTAIAVAISKELGDIPFVQVSASEFYSAEMKKTEALIQAMRKAVRIRETRTVLEGEVVGLDYNMVPNPYNPTQKIPESATLTLATKDEKRGGRLAMQFFTQGIEVGDVIVIDKETGRIGKLGRSEKAKKKYDLGDDEV-VPVPSGKVEKEKEFTYVVTLHDLDEANARRTS.............................................................................................. 252
19 -37.600[O] KOG0731 AAA+-type ATPase containing the peptidase M41 domain  ali follow..  32  312......................................................................................................................HSKNKIYFKDVAGCDEAKQEIMEFVHF-LKNPKKYEGAKIP-KGALLVGPPGTGKTLLAKATAGESG-VPFLSISGSDFMEMFVGVGPSRVRHLFQEARQAAPSIIFIDEIDAIGRARGRGGNDERESTLNQLLVEMDGFGTT-AGVVVLAGTNRPDILDKALLRRFDRQITIDKPDIKGRDQIFKIYLKKIKLDHESYYSQRLAALTPGFAGADIANVCNEAALIAARH-------------------------------------------------EGATVTMAHFESAIDRVIGGLEKKNISKLERRTVAYHESG 587
20 -36.800[O] KOG0734 AAA+-type ATPase containing the peptidase M41 domain  ali follow..  31  274......................................................................................................................VQMKNVTFEHVKGVEEAKQELQEVVEF-LKNPQKFTGGKLP-KGILLVGPPGTGKTLLARAVAGEAD-VPFYYASGSEFDEMFVGVGASRIRNLFREAKANAPCVIFIDELDSVGGKRIESPHPYSRQTINQLLAEMDGF-KPNEGVIIIGATNFPEALDNALIRRFDMQVTVPRPDVKGRTEILKWYLNKIKFD-QSVDPEIIARGTVGFSGAELENLVNQAALKAAVD-------------------------------------------------GKEMVTMKELEFSKDKILMGPERRSIDNKNKTITAYHESG 545
21 -26.600[R] COG2607 Predicted ATPase (AAA+ superfamily)  ali follow..  15  49.....................................................................................................................LPDPHTFPLVRLAGVGRQTELLVRNT-------QFIVG--RPANNVLMSGARGTGKSSLVKALLHEYADKGLRLIEVDK------SDLIGLPYLLTLLKECPEKFIVFCDDLSFESGDEQRCANVLVYATSNRRHLMPEYFDENAGTTGMRGEIHQKEAVEEKISLRFGLWLSFYPFDQNDYLAAVQNWLEDFGVPYDETAALQWAQTRGSRSGRSAWQFACDWAGRLPKQ......................................................................................... 284
22 -20.700[O] KOG0743 AAA+-type ATPase  ali follow..  20  710............................................................................................................................TFETLAMDPGAKKKIIDDMERFLKRREFYKRVGKAWKGYLLYGPPGTGKSSLIAAMANYLK----FDVFDLELSS--IYENAQLKSILLSTTNR---SILVIEDIDCSSAEVVDREADEYQEYEEGLLNFVDGLWSSDERIIVF-TTNHKERLDPALLRRMDMHINMSYCTGLGFRTLVSNYLGLGGLNHP-EEIEALIDSTE-VTPAELAEELTDVVLRGVVSFVENRKVEISKTKELEGSTCRKLDGDDKHNVSSTNDLKKTKKKKKGGKGKAK..................................... 994
23 -20.100[L] COG2255 Holliday junction resolvasome, helicase subunit  ali follow..  20  27............................................................................................................................LLTEYVGQPHVREQMEIFIQAAKQRGDAL-------DHVLIFGPPGLGKTTLANIIANEMG-VNLRTTSGPVL--------EKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEILYPAMEDYQLDIMIG---IKLDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVADLEHIVSRSAKCLGLELTPEGAHQLARRSRGTPRITNRLL.................................................................................................... 227
24 -16.300[L] COG0470 ATPase involved in DNA replication  ali follow..  19  23............................................................................................................................TLDEVYGQNEVITTVRKFV-------------EGKLPHLLFYGPPGTGKTALAREIYGKNYSNMVLELNASD------DRGIDVVRNQIKDFASTRQKLIILDEADAM----TNAAQNALRRVIERY----------TKNTRFCVLANYAHKLTPALLSRCTRFRFQPLPQEAIERRI-ANVLVHEKLKLSPNAEKALIELSNG----------------DMRRVLNVLQSCKATLDNPDEDEISDDVIYECCGAPRPSDLKA----------VLKSILEDDWGTAHYTLNKVRSAKGLA............. 273
25 -16.000[L] KOG2028 ATPase related to the helicase subunit of the Holliday junction resolvase  ali follow..  19  35................................................SHRSSPQSTATLQPKLDRFLRLHPKALAPAMGDDSSKRPNPKTQIHVAADDSNKRHKLSSSSHRQHQPLSERMRPRTLDDVVGQDHLSSLLRSAV-------------SNRLPSIVFWGPPGTGKTSIAKSLINSSKDPSFVSLSAVT-------SGVKDVRDAVESAKRLKRTVLFMDEV-----------HRFNKSQQDTFLPVIE-----DGSILFIGATNPSFHLITPLLSRCRVLTLNPLKPNHVETLLRRAVDDSESVEVDDSVIEFLANNCDGDARVALNAL.................................................................................................... 306
26 -15.800[L] KOG0990 Replication factor C, subunit RFC5  ali follow..  16  49............................................................................................................................SLDDVAAHRDIIDTIDRLT-------------ENKLPHLLLYGPPGTGKTAVARKLYGPKYRNMILELNASD--DRGIDVVRQQIQDFASTQSFSLGKLVLLDEADAM----TKDAQFALRRVIEKY----------TKSTRFALIGNHVNKIIPALQSRCTRFRFAPLDGVHMSQRL-KHVIEAERLVVSDCGLAALVRLSNGDMRKALNIL.................................................................................................... 240
27 -15.600[L] KOG0991 Replication factor C, subunit RFC2  ali follow..  19  46............................................................................................................................KLNEIVGNEDTVSRLEVFA-------------EGNVPNIIIAGPPGTGKTCLARALLGPALKDAMLELNASN--DRGIDVVRNKIKMFAQQKVTLPKGIIILDEADSM----TDGAQQALRRTMEIY----------SKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQILTRL-MNVIEKERVPYTDDGLEAIIFTAQGDMRQALNNL.................................................................................................... 236
28 -14.700[L] COG2256 ATPase related to the helicase subunit of the Holliday junction resolvase  ali follow..  22  25............................................................................................................................TVEQYIGQQHIGKPLRRAL-------------AGHIHSMILWGPPGTGKTTLAEVAANYAN-AEVERVSAVT-------SGVKEIRAAIEKARENRRTILFVDEV-----------HRFNKSQQDAFLPHIE-----DGTVTFIGATNPSFELNNALLSRARVYKLTSLNQQEILQALHQAILGKVAAVFADNVLDRLAELVNGDARMSLNYL.................................................................................................... 216
29 -14.600[KE] COG3283 Transcriptional regulator of aromatic amino acids metabolism  ali follow..  14  195.....................................................................................................................LSTQDLSAFSQIIAVSAKMKHVVEQA----------RKLAMLSAPLLITGDTGTGKDLFAYACASPRSAKPYLALNCASIPSELFGHAPEGKKGFFEQANG---GSVLLDEIGEM-----RMQAKLLRFLNDGTFRRVGEDHEIHVDVRVICATQK--NLVELVQKLFREDLYLNLPPLRDCPQDIMPLTELFVARFA----DEQGVPRPKLSADLSTVLTRYGWPGNVRQLKNAIY................................................................................... 424
30 -14.500[S] COG4916 Uncharacterized protein containing a TIR (Toll-Interleukin 1-resistance) domain  ali follow..  11  6...............................................................................................................................TLGDVFKTVGLPPYTYVKPKHFGEVRADISQVGKHLLIEGPSGIGKTCVVFKVFEELQWSQGRDFTYVGCRDQNAEQIIDDFLKNAAAGNALSPCVLVIDDFHLL---SQAKRMEIGSTLKR--LSDRAFEQAEPAKVILIGIPTAGVSLAYDLGPRLGS-YALTRASDVEIDKLISE--GEQALAVLFEDRDVLLAESAG-NFWLAQYVCNKVCA.............................................................................................. 215
31 -14.300[KT] COG1221 Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain  ali follow..  14  214............................................................................................................................VLGDMLGQSPQMEQVRQTI----------LLYARSSAAVLIEGETGTGKELAAQAIRQGKKSHPFVAVNCGAIAESFTGSRRGGRAGLFEIAHG---GTLFLDEIGEM-----PLQTRLLRVLEEKEVTRVGGHQPVPVDVRVISATHC--NLEEDMRQQFRRDLFLQLPPLRERVADILPLAESFLKVSLAALSAPFSAALRQGLQASETVLVHYDWPGNIRELRNMMERLALFLSVEPTPDLT------------PQFLQLLLPELARESAKIPAPRLLTPQQALEKFNGDKTAA................ 511
32 -13.700[KT] COG3604 Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains  ali follow..  16  190............................................................................................................................DSVEIIGNSGPMLAMKADIVAPS-------------FNILIHGETGVGKELVARTIHQRSNRKRLVYVNCAAIPENLL-ESELFVKGAFTGADRARMGTLFLDEIGEL-----SAQSKILRALQNHEIQPVGQDRVQTVDVRILAATNR--DLKKEVEARFRADLYIYVPPLRERKGDLSLLAGYFVEQAR----RKLGITQLKLHGDVLSQLIQYPWPGNVRELEHVINRAALKAKARQRGRPVTTLKVEDLGELQGPRAAMVEPTAQDEPMLGEWIGELGLRDATDEFQRHLISETLTQ............ 490
33 -13.700[H] COG1239 Mg-chelatase subunit ChlI  ali follow..  12  1.........................................................................MTAQTTAQPKARTLGELLQTPEYAGRKPFDGQRRLVQDEVRDNLTRRSGEELFPGVVGYDDTVIPQLVNALLA---------------NFILLGLRGQAKSRILRAITPRADRYVEKLATPDVTVADLIGDPIKAARLGTSLGDTRS-GIFAVNELADL----SPKVQVALFNILQEGDVQIKGYPIRLELDVMLVFSANPEDIVTPLKDRIGSEIRTHYPDVQLGMDITAQEAVKEEGVVVPPFIAELIEDI............................................................................................................... 300
34 -13.600[O] COG1219 ATP-dependent protease Clp, ATPase subunit  ali follow..  19  79................................................................................................................................VIGQERAKKVLAVAV---LNQRDKKDDIELGKSNILMIGPTGSGKTLLAETLA-RLLNVPFTIADATTLTEAYVGEDENIIQKLLQKCEKAQMGIVYIDEIDKISRKSSITRDVSGEGVQQALLKLIEGLQVDTRNILFICGGAFA-GLERVIQNRSARGGI--IPEFVGRLPVIATL-----DELDEAALMQILTEPKNFRPDALKAVARKALARGLRSILEGI.................................................................................... 379
35 -13.400[O] COG0542 ATPases with chaperone activity, ATP-binding subunit  ali follow..  20  144.............................................................................................GGQNVNDPNAEESRQALEKYTIDLTARAESGKLDPVIGRDEEIRRAIQVL------------QRRTKNNPVLIGEPGVGKTAIVEGLAQRIKNKRVLSLDMGALIAKYRGEFEERLKAVLELSKEEGRVILFIDEIHTMVGAKTDGAMDAGNLLKPSL---------ARGELHCVGATTLD-EKDAALERRFQK-VFVGEPTVEDTIAILRGLKERYEVQITDPAIVAAATLSHRYVSDDKAIDLIDEAASSIR.......................................................................................... 401
36 -13.000[O] KOG1051 Chaperone HSP104 and related ATP-dependent Clp proteases  ali follow..  21  148.............................................................................................GNKRIDSKNAEEGFDALNKFTVDLTELARNGQLDPVIGREDEIRRTIRVL------------SRRTKNNPVLIGEPGVGKTSIAEGLARRISNCKLLSLDVGSLVSKFRGEFEERIKSVLEVEESETPIILFVDEMHLLMGAGGEGGMDAANLLKPML---------ARGKLHCIGATTLA-EKDAAFERRFQI-ILVKEPSIEDTISILRGLKEKYEVTISDRALVTAAHLASRYLTSDSAIDLVDEAAAAVR.......................................................................................... 406
37 -12.900[KT] COG3829 Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains  ali follow..  16  261.....................................................................................................................ANAPDEPHIEQLVGECRVMRQLKRLI----------SRIAPSPSSVMVVGESGTGKEVVARAILSGRRNKPFIAINCAAIPEQFTGASANGKTGLIQAANT---GTLFLDEIGDM-----MLQAKLLRAIEAREILPIGASSPIQVDIRIISATNQ--NLAQFIAEKFREDLFITLPPLRERQEDIELLVHYFLHLHT----RRLGSVYPGIAPDVVEILRKHRWPGNLRELSNLME................................................................................... 498
38 -12.300[QK] COG3284 Transcriptional activator of acetoin/glycerol metabolism  ali follow..  15  313.............................................................................................................SKVRAPLVSREQIPPALRRLGGDAPVIAALQAKA----------AKLARTRLPILIQGETGTGKEHLARAIHEGSGLEPFVAINCAAIPEQFTGASAKGRKGLIEQAD----GTLFLDEIGDM-----ALQSRLLRVLAEGEVLPVGGTAPRKVRIRIVSASHR--PLQTLVSQAFREDLYLTLPALRDRPDF----------WVLEQLLKRHGDGELILSPAALSALKAHDWPGNIRELDNVIGVAAALAENG---VVELGDLPDQLLANADTVGGNEASATLSLTLTACNWNISEAARRLGLDRSTVHRQ-IKRY........... 620
39 -12.300[L] COG0593 ATPase involved in DNA replication initiation  ali follow..  12  120........................................................................................................................NTKHLFDNVEG--KSNQLARAVGQKLAQAP------EPSANPFFLYGGTGLGKTHLLHAIGNGIPNARVLYIHANNFMQHMVKAVRDNKMDQFK-KFYRSLDALLVDDIQFFAEKEKTQE---------EFFHIFNSLFETGRQI-ILTSDRYPKEIEERLKSRFGWGLTTAIPDLETRVAILLKKAEEHNMNLPEEVAFFIAQRLR----TNVREL--EGALNRV........................................................................................... 331
40 -12.200[DL] KOG2035 Replication factor C, subunit RFC3  ali follow..  15  12............................................................................................................................DLLGKDGVDYHIEQANHLKFLS----------ADCMPHLLFCGPSGAGKKTRIKCLLREVSSNYHIEMTPSDVGIYDRVVVQDLVKEMAQTSQIESTSVVVLCEADSL----TRDAQHGLRRTMEKY----------ANNCKIVLSCESLSRIIEPLQSR--IIINVPAPTDEDVTKVLRKVIERESFLLPENVLQKIVEKSEGNLRRAILMT.................................................................................................... 232
41 -12.200[KT] COG4650 Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain  ali follow..  16  180..........................................................................................................................DFLKSGIATRNPHFNRMIEQIEKVAIKSRA----------ILLNGPTGAGKSFLARRIARHQFSGAFVEVNCATLRGDTA-MSTLFVKGAFTGARESREGMLFLDEIGEL-----DEQAMLLKAIEEKTFYPFGSDRQVSSDFQLIAGTVR--DLRQLVAEKFREDLYFTLPGLRQRQEDIEPNLDYEVERHASLTGDSVRFNTEARRAWLFATSPQATWRGNFRELSASVT................................................................................... 420
42 -12.000[R] COG0714 MoxR-like ATPases  ali follow..  19  5...................................................................................................................................ISVLTQNLSQTIVGKDEAIRLVLVALLSGGHALLEDVPGVGKTLLAKSLARSINGK---DITGTNIWNPSSREFEFLPGPAFA-------NILLADEIN-----RATPRTQAA-EVMEEKQVTVDGETRLVPHPFFVIATQNPFPLPEAQLDRFALSLSLGYPSEAEELKMLQRQQNPEAIAVGDLESCISLEEVEALQKAVRQVKLTEDLQQYLLRLVRASR................................................................................... 232
43 -11.600[L] COG2812 DNA polymerase III, gamma/tau subunits  ali follow..  18  14............................................................................................................................KLQDVVGQEHITKTLQNAL--------------KFSHAYLFSGPRGTGKTSAAKIIATSGSIVDVMEIDAAS------NNGVDEIRDIRDHVK-FAPSVYIIDEVHML------TTGAFNALLKT--------LEEPPSHAIFILATTEPHKIPLTIISRCQRFDFKRISNDA--VGRMKEILTHEGIEAEDEALVLVARAAEG-GMRDSLSLLDQAI............................................................................................... 225
44 -11.400[O] KOG2004 Mitochondrial ATP-dependent protease PIM1/LON  ali follow..  12  334.................DLQEMMDEIDVSKRLKIALLLIQKEKAVAKLKYDINKDVEKKVQDHNEQLKVIKKELGIEKDEKTTIIEKIDERIKTLAVPEYALKVINEEKTKLVTRNYLEWLTSVPWEGHYGMKDVKERIMEFIAVNLLRKSIGGKI------LCFHGPPGVGKTSIAKSIATALNRE-YFRFSVGGMTDVYVGA--KMIQCM-KKVKTENP-LVLIDEVDKIGGAGFHGDPASA-EQNANFNDHFLDVPVDLSRVLFICTANEISKIPGPLRDRME---MIDVSGYLAHQHLIPQLRKDTSLATEQLKIEDLEELIKHYC-SGVRNLQQH-----IERIFRKAALQIAEQQNEDEEPAEKATTAITENSEAEPITSTSSADCLKSSAEQIVVCTENLQKFVSDRMYEVTPPGVIMGLAWTAMGGS.. 801
45 -11.300[T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains  ali follow..  15  112..........................................................................................................DALYKAIDEALEQSAPATDDSWRNAIVTRSPLMLRLL-------EQARMVAQSDVSVLINGQSGTGKEIFAQAIHNASPRSNFVAINCGALPEQLL-ESELFARGAFTGAVSNREGTLFLDEIGDM-----PLQVKLLRVLQERKVRPLGSNRDIDIDVRIISATHR--DLPKAMAREFREDLYLKIPALAERTEDIPLLANHLLRQSA----QRHKPFVRAFSTDAMKRLMTASWPGNVRQLVNVIE................................................................................... 362
46 -11.200[O] COG0466 ATP-dependent Lon protease, bacterial type  ali follow..  16  203...................MKQKENINFQMEMAKKVTDKISKSNREAMLREQLKMIQEELNGGDDAASGEGGYRERIEKSTMPEEVKKKALSELKKLETGGPHNPESSVIRNYLDLMIDEARRVLESNHNGLEKVKERIIQHLAVMKLKKEKQGSI------LLLTGPPGTGKTSLGKSIADALGR-EYVRISLGGVRDEYIGALPGRIIQGMRKAGTKNP-VFILDEVDKLSTSYAGDPASALLEVNNTFSDHYLEVPYDLSEVFFIATANSLASIPWPLLDRME--IEISGYTKNEKLAIAKDHLDADKLKIEDEALKGIIDKYTREAGKQLARTARFVSEKIVSG......................................................................................... 565
47 -11.200[L] KOG1968 Replication factor C, subunit RFC1 (large subunit)  ali follow..  15  369............................................................................................................................SLKDICGNKGVVQKLQK---LQDYHKNRKSNFNKP-KAVLLSGPPGIGKTTAAHLVAKLEG--DVLELNASDTRSK-----DEQLFGVTDSQMAKSRLVLIMDEIDGMSSGDRGGVGQLNMIIKK-------------SMIPIICICNDRAHPKLRPLDRTTFDLRFRRPDANSMRSRIMSIAYREGLKLSPQAVDQLVQGTQS----DMRQIINLLST.............................................................................................. 586
48 -11.100[L] COG1484 DNA replication protein  ali follow..  14  71.................................................................................................................ASEITHAFRQLGFKEFR-TEGKPQAIKDAFECTKEYVADYEQIKDC-NSIALLGQPGSGKTHLLTAAANELCYVPVIYFPFVEGFTD-FALLEAKLNRMKQA------DVLFIDDL------KPVNGKPRATDWQLEQMYSVLNYRYLNHKPILL-SSELTIEGLVRVDEALGTKIYVIIKGAAYELN........................................................................................................................................ 259
49 -10.900[U] COG3267 Type II secretory pathway, component ExeA (predicted ATPase)  ali follow..  18  35.......................................................................................................................................................LQAGLGDGGGFAMLTGEVGTGKTTVARAILASLPGKTRATFSDLELLEAICDE-QVLHEFLLAEHAQGIQVLLMIDEAQHL-------APDVLEQLR--LLTNLETESHKLLKVLLIGQPELQEKLRLPQLRQLAQRITGPLNEEQTADYIRFRIASGNPELFNRKACQWIAEQTHGIP---INLVCDAALKQAYQAGEPTLSLARIKLACQE......................................................................... 264
50 -10.900[LO] COG1474 Cdc6-related protein, AAA superfamily ATPase  ali follow..  13  9.........................................................................................................KAQSLDGLFEKLLDGKSIFKNKEVLRPSYTPDLLEQINSLATILVSALRG--ETPSNVLIYGKTGTGKTAVTRYVGKELERVSVVYINCEVIDTQYR-PTDQVFMKFKEIDARDQVIIIILDEIDKLIKK------------GDDVLYNLSRINTDKAKVSMIGVSNFTEFLDPRVKSSLEEELIFPPYDAEQISDILKQRAKMNDGVLGEMVIPLCAAFAAQEHG-DARDLLRVSGEIAERENQPQVLEEHVRRAQEKIEIDRVVEVVRTLPTQSKLVL-YSIILLRSRGREGKNVTTGEMYNVYRQLCHHIDVDILTQ............ 353
51 -10.800[R] KOG2170 ATPase of the AAA+ superfamily  ali follow..  14  75..............................................................................................................................NLLFGQHLVKDVVVNSI---------HWYNENPRKPLVLHGYTGSGKNYVAEIIA----NNTFRLGLRSTFVQHIVATQVELRNRILTTVQKCQRSIFIFDEADKIKPFLDYYSTISGVDFRRSIFILLSNKGGGEIARITKEQYESGYPREQLRLEAFERELFLPLQREHVRSCVGAYLRGRGDLVSNVDFVERVLNSLQ-FSSSGCKRVDAKTDL.............................................................................................. 338
52 -10.800[LD] KOG2227 Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase  ali follow..  14  22...........................................VKSESLESAAYEIPRKRKMRSDSAAVSGNSVSTPKKLKSHLPSSVPNPGMSEKEVVEDSNEILRYPVNLAVSDCLGTKSKWSPRDEEQMRAVKEALHVSKA-PSTILRIFEFVKGCIDQLYICGCPGTGKSLSMEKVVQQVGDWSTLSVNCTSLSKTT----SKILGEI-QESSSSRMMLIIADEMDYLITK------------DRGVLYDLMLTTLPFSRCILIGVANAIDLADRFLPKLKSLNCFRAYSKDQILRILQERLRVLSYVAFQPKALELCARKVAAASG-DMRCVCRSAL-----------------------------------EILEIETRGSTGPESQGPTPDDSVVRMDHMAAALSKTFKSPVVETIQSL........... 407
53 -10.800[L] KOG1942 DNA helicase, TBP-interacting protein  ali follow..  23  40..............................................................................................................................AGFVGQLEAREAAGLVV-------DMIKQKKMAGKALLLAGPPGTGKTALALGISQELGSKVFCPMVGSEVYSSEVKKTEVLMENF---LRIKETKEVYEGEVTELSPEETESLTGGYGKSISHVVITLK--TVKGTKHLKLDPT...................................................................................................................................................................... 178
54 -10.500[S] COG4983 Uncharacterized conserved protein  ali follow..  10  470..............................................................................................................................AYLIPIEAERVRFEQWLAHIVQRP----EELPQSAYLFITEETGIGRNWLSSVLVRVLRGYVAAGIDIQELDGTFNGRLSRKL-------------LAVVDEAKA--GMQGYGRWSHSEKLKS--MINPEMRRINEKHG-WLFFSNNWDALFDASDRRF-ERIYSQIANPDFISAVRKRLEL---LDISGFKPGAIPDMNE--AKRKALGAMASDLDNLLAAFRDEWPGPLAERSDVINYLHVSIAKLPGEKTINKLIEQALVERISIGPNKYRFVVVRDYTAQQIETNPQWAYAEAVNAGKYGFRQG... 780
55 -10.400[L] KOG0481 DNA replication licensing factor, MCM5 component  ali follow..  16  325.........................................................................................................SGDIYERLSQSLAPS--------IFGSRDIKKAI-----------MLFGGSRK--RGVLLLGDPGTAKSQLLKFVEKVAPIAVYTS-SAAGLTASVMKDPQTRNFVMEGGAMVLADGVVCIDEFDKMREDDRVAIHEAMEQ--QTISIAKAGITTTNSRCSVLAAAN-S-DFMPTILSRFD--IVKDIHDESRDITLAKHIINVHLSSNKSAPSEPAEGEISHYCRTHCGPRLSEAAGEKLKS-----RYVLMRSGAGQQEKASDKRLSIPITVRQLEAV-IRISESLAKIRLQPFATDEHVNEALRLFQVSTLDAAMT............. 653
56 -10.000[L] KOG0482 DNA replication licensing factor, MCM7 component  ali follow..  15  329.........................................................................................................QDDFYERLATSLAPE--------IYGHLDVKKAL-----------LLVGGVDKRPDGICLMGDPGVAKSQLLGYISRLAVRSQYTT-SGVGLTAAVMKDPLTGEMTLEGGALVLADGVCCIDEFDKMADQDRTAIHEVMEQ--QTISIAKAGIMTTNARVSILAAAN-P-QLPAALLSRFD--LIQDKPDRDNDLRLAKHITYVHSHSKQPPTRVNLMRRYINLCKRKNPTIPDELT----DYIVGAYVELRREARNQKDMTFTSARNLLGILRLSTALARLRLSDS---------VEKDDVAEALRLLEMSKDSLNQIH............ 648
57 -10.000[DL] KOG1970 Checkpoint RAD17-RFC complex, RAD17/RAD24 component  ali follow..  11  30................................................................SGVSTITATSLGVNNSSHRRKNGPSTLESSRFPARKRGNLSSLEQIYGLENSKEYLSENEPWVD----KYKPETQHELAVHKKKIEEVETWLKA--SILLITGPPGCGKTTTLKILSKEHGNPVLPDFQKDDFKGMFNTESAVFKEFLLRATKRTDKKIILVEDLPNQFYRDSHTLHEVLRKY----------VRIGRCPLIFIISDSLSGDNNEIQEECSISNISFNPVAPTIMMKFLNRIVTIEANKNDKTSLELLCQGCSG----DIRSAINSLQFSSSKG......................................................................................... 347
58 -9.900[L] KOG0480 DNA replication licensing factor, MCM6 component  ali follow..  15  423.........................................................................................................SDHIYSRLTNSLAPS--------VYGHEIIKKGI-----------QLMGGVHK--RGICIVGDPSTSKSQFLKYVCNFLPRAIYTS-SAAGLTAAVVKDEETGDFTIEAGALMLADGICAIDEFDKMDLSDQVAIHEAMEQ--QTISIAKAGIQATNARTSILAAAN-P-NMSAPIMSRFD--VVLDECNESVDRHLAKHIVDIHRLRDDAMQPEFSTEQLQRY-ARTFKPKLNTESCAEIVKKYKQLRMDDAQGAGKNSYRITVRQLESMIRLSEAIA-RANCVDD---------ITPAFVNEAYSLLRQSIIHVERDD............ 743
59 -9.780[L] KOG1514 Origin recognition complex, subunit 1, and related proteins  ali follow..  17  380...................................................................................................................................LEKAKATLLLATRLPCRSKEMISDDQCLGRCMYIHGVPGTGKTISVLSVMKNLKAEVFVEINGLKLASP-----SVIYEGL-IGKENEKPCILLIDELDVLVTRNQS------------LYNILDWPTKPNSKLVVLGIANT--DLPEKLLPRISSRM-LCFGPYNHRQEIISTRLEGINA-FEKTAIEFASRKVAAISG-DAREICRRAA-----EVADYRLKKSNISAKSQL------------------------------------VIMADVEVAIQEMFQAPHIQVMKSV........... 670
60 -9.620[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  11  1.................................................................................................................................................TEVKPFFV-------RTVAILGGESSGKSTLVNKLANIFNTTSA----------------WEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTD-IDEYRFDLVILLENNTPWVADNLLVEMLEENVRVEEEDYDSRFLRCVELVRE................................................................................................................................ 181
61 -9.570[F] COG1618 Predicted nucleotide kinase  ali follow..  14  3........................................................................................................................................................IEGKEKTMLRIAVTGSPGVGKSTVVAKTAEKLAEKP--GFKIGGIRTAEIRKEGHREIGANAVRNALACDLVVIDEIGPMVEEVLESDKPVLAVLHHSSRHPLAQRFRKGFEVLTVDKGNRD-ELPEKITNRFLRKL.................................................................................................................................................... 183
62 -9.480[O] COG0606 Predicted ATPase with chaperone activity  ali follow..  20  184......................................................................................................................QVSQTRDLQDIIGQQQGKRALEIAAA----------------HNLLFLGPPGTGKTMLASRLCDAMETASIASLTQSSSMAALVGGGTIPRPGEISLAHN---GLLFLDEMKVLDSLREPLESGEIVISRAQGKTRFPA------RFQLVGALN-P-RANPQSILRYLSRLSGPLLD.............................................................................................................................................. 378
63 -9.480[L] KOG0478 DNA replication licensing factor, MCM4 component  ali follow..  15  457.........................................................................................................KPDIYDRLARAIAPS--------IYENDDIKKGI-----------QLFGGTKK--RSLLLCGDPGTSKSQMLQYVFNLVPRSQYTS-SAVGLTAYVTKDPETRQLVLQTGALVLADGVCCIDEFDKMNDSTRSVLHEVMEQ--QTLSIAKAGIICQNARTSILAAAN-P-QLPHTLLSRFD--LVLDPQDEIFDKRLASHLVSLYYVTRHEEEDTMFDMSV-AYAREHLSPTLSDEAQQRLIQAYVDMRKVGAGRGQISAYPRQLESL-------------IRLSEAHAKVRLSNQVELLDVEEAWRLHREALKQSATD............. 777
64 -9.410[L] COG1241 Predicted ATPase involved in replication control, Cdc46/Mcm family  ali follow..  17  279...............................................................................................................................SIFGHDIVKRSI-----------LLVGGNEV--RGILLVGDPSTAKSQLLRYVLNAAQLSIATT-SGVGLTAAVVLDKDTGEKRLEAGAMVLADGVVCIDEFDKMSDGDRVAIHEVMEQ--QTVTIAKAGIHTTNARCSVLAAAN-P-RLPESLLTRFD--VTLDKSNTDIDQLVSGHVLRMHMLTQGYEEEGEVFRAYIRYCRQKKPVLSREAAGLIAREYTSLRQSKDRKEQIVSITPRMLETMI-------------RLATANAKLRLSDVVEYDDAECAVNLVKDSLFQKIVK............. 584
65 -9.370[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  16  4................................................................................................................................................................PNILLTGTPGVGKTTLGKELASKSG---LKYINVGDLAREPILDEDRVVDELDNFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEEEIVHQLPSNKPEELENNVDQILKW...................................................................................................................................................... 162
66 -9.150[R] COG2842 Uncharacterized ATPase, putative transposase  ali follow..  13  94..................................................................................................................................................................ATVYGMSGVGKTKAIQEFAKSHANVWLVTASPSRSSLSEIPRRKGTLSRLIARKIKGTEGLLIVDEADHL----PYEALEELRIMQEEAGIG----------LVLVGNDKVYTRMKGGISPRLWSRVAKNTSIQKTKKADTQAVAQAWGLETDEEALKVMQSITE--TGGGLRILTQ.................................................................................................. 272

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 6 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.