current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [O] KOG0826 Predicted E3 ubiquitin ligase involved in peroxisome organization, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .
# Score Template Links and tools%idFirst MAEAANVRQNLQNVPSIFEISASETLDNLIYPALSKIFDYFGLRLDFKLWGSLRIQEELSPLLTWLLQYLYLRKRASSFGESFYGLQRTVTTTGDLLNRRQQFASATLLTFMPYVERKLRTRITRHEDTSPWEQRLLSAFHAFHAAKAAHTFFYLVKYASNHSPIFRLLGLTLRYPSEPPKEDQWTYVVLKMLEVLAFFLQFVQWWYSNDQRRKVGGTLINPEAMPRKQLPKEVQQSLPQRGECPVCLLSIQTPTACSVSGYVFCWKCIVSHMKEHGTCPVTHYPISLDDLVRIYETLast
1 -111.000[O] KOG0826 Predicted E3 ubiquitin ligase involved in peroxisome organization  ali  100  1MAEAANVRQNLQNVPSIFEISASETLDNLIYPALSKIFDYFGLRLDFKLWGSLRIQEELSPLLTWLLQYLYLRKRASSFGESFYGLQRTVTTTGDLLNRRQQFASATLLTFMPYVERKLRTRITRHEDTSPWEQRLLSAFHAFHAAKAAHTFFYLVKYASNHSPIFRLLGLTLRYPSEPPKEDQWTYVVLKMLEVLAFFLQFVQWWYSNDQRRKVGGTLINPEAMPRKQLPKEVQQSLPQRGECPVCLLSIQTPTACSVSGYVFCWKCIVSHMKEHGTCPVTHYPISLDDLVRIYET 297
2 -78.300[O] KOG0317 Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein  ali follow..  14  1MKNDNKLQKEALMRLSQLSIVQAHQKDEQIQGLLIMKVTELCKLI-KSQLFVNSYPKELSIFAKLLYLLFTTGRRGRTLGEEYVDLTYTNRKGTRLAGRLKMIVFAFAYPLCPYFITKLYKKIMKNNKEIEDTESVAAFCKGLLDFILDVHMTLFYFKGAFYSISKRIFGMRYVFKHILSKNEANFREEGSQKYKVLGYILLAQNVMKWYPVLTSTIPKESQLTHINLSDKNQLPFIPEASRKCILCLMNMSDPSC-APCGHLFCWSCLMSWCKERPECPLCRQHCQPQEILVLRQ. 337
3 -58.800[O] KOG2879 Predicted E3 ubiquitin ligase  ali follow..  11  24.SLLASRRSVIPVAISRVNQFDAARLDVEMSAMLKEQLVKVFTLM--KPGMLFQYEPELDAFLEFLIWRFSIWVDKPTPGNALMNLRYRDERGVVALTSPQKIWYCVASVGGQYLFSRLQSFSAFRRWGARRLWTLVQRIEGIYKAASFLNLLSFLYTGRYRNLIEKALKARLVYRSPHMNRSVSFEYMNRQLVWNEFSVGLLYPSIDQNILFRLATRNVMLGSDFSPFAKDKSSSTKEDTVTCPICQVDPAIPFIKELTCRRYCYYCIRTRCASAARCLRCNEPVVAIQREGVSSG 388
4 -30.900[O] KOG0823 Predicted E3 ubiquitin ligase  ali follow..  17  80...............................................................................................................................................................................................................ERSRERLVENGENKTYLIAKALNMEKTSSVPGGFFDCNICLEKAEDP-ILTCCGHLFCWGCFYQLPLIYLECPVCDGEVTDAEVIPIYGN 171
5 -30.400[O] KOG1813 Predicted E3 ubiquitin ligase  ali follow..  12  241...............................................................................................................................................................................................................EEAEKVRKRNKAMGVEDEDDEADKDSDEDENALPFACFICREPFVDP-VVTKCKHYFCEHCALKHHTKNKKCFVCNQPTMAHEIKKRMAE 334
6 -30.300[O] KOG0824 Predicted E3 ubiquitin ligase  ali follow..  19  2.............................................................................................................................................................................................................................NASTSSPSQQLQQAINSTIDKECAVCYSEMILPTTIPSCGHKFCFICLKGVSVSNNDCPICRGPIDSQIFKK.... 74
7 -29.100[O] KOG0978 E3 ubiquitin ligase involved in syntaxin degradation  ali follow..  644..................GIKVKEQEAEASIAEMETIGQAYEDMQTQNQHLLQQVAERDDYNIKLVSESVKTKHAYNTHLSEKQVMEKQLHQVNASVENFKARIA---------NEEQMKGCFSEAYKLIQEDRHLVISLETTKWEVADADKEFRWLKSAVSSSEKEYEQISRRTDDIKLELDDEREKKKLE--------------EELMELNKELEELGSESVEAAIVRLQEEVKNCKNILKCGVCFDRPKE-VVIVKCYHLFCQQCIQRSLERHRKCPGCGTAFGQNDVRLVK.. 898
8 -28.600[O] KOG0320 Predicted E3 ubiquitin ligase  ali follow..  18  230...............................................................................................................................................................................................................PRRSAENDPVVDLDVASPPKRVNRDIDESQKEELYKCPICMDSVSREPVSTKCGHVFCRECIETAIRATHKCPICNKKLTARQFFRIY.. 318
9 -27.900[R] COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers  ali follow..  12  222...................................................................................................................................................................................................................REWDSVQEKYKKGAKLEEGMVKNEKKEDIPFVCLICKKDYRSP-IATTCGHHFCEQCAITRYRKTPTCIQCGADTKDKNFDRLLKN 311
10 -25.000[T] COG5432 RING-finger-containing E3 ubiquitin ligase  ali follow..  20  23..............................................................................................................................................................................................................................................DTLLRCHICKDFLKVP-VLTPCGHTFCSLCIRTHLNNQPNCPLCLFEFRVSEIIQSYTS 89
11 -25.000[L] KOG0287 Postreplication repair protein RAD18  ali follow..  20  23..............................................................................................................................................................................................................................................DTLLRCHICKDFLKVP-VLTPCGHTFCSLCIRTHLNNQPNCPLCLFEFRVSEIIQSYTS 89
12 -24.900[O] KOG1571 Predicted E3 ubiquitin ligase  ali follow..  20  256.................................................................................................................................................................................................................KQEREEAKIRERLDTERRERRARSRPHTLSQDQLCVVCSTNPKE-IILLPCGHVLCEDCAQK----SVTCPVCRGSIV--SKAAAFIA 338
13 -22.700[R] COG5222 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  12  1MSSTIFYRFKSQRNTSRILFLTVFDLKREIIQENKLGDGTDFQLKIYNPDTEEEYDDDAFVITSVIVKRSPAIKSFSVHSRLKGNHTATTTANVSGTTEEERIASMFATQENQW--EQTQEEMSAATPVFFKSQTNKNSAQENEGPPPPGYMCYRCGGRDHW--IRRTTGI-LKSIEIDPETMTPEEMAQRKIMITDEGKFVVQVEDKQSWEDYQRKRENRQIDGDETIWRKGHFKDLPDDLKCPLTGGLLRQPVKTSKCNIDFSKEALENALESDFVCPNCETRILLDSLVP.... 342
14 -22.300[O] COG5574 RING-finger-containing E3 ubiquitin ligase  ali follow..  139VDEDIDTQTMSSDMSEVQSMEISLNCDHEFFEKLTSELQSVEGLQ---------------------------REQRKILFNAIDILSHEISLIASPNSKKKY-LYCWRKIFEIYMDSDIISCKEADQSHERTPELAERHLKWFDDQVRLAKCLPSSSKHRDRILYAKFLELNESLLKVASFQQMNKLAVTKIMK-RTSLTAQPLFFQVIESDPLLLVDNASKAICFSLSSKLFSIIPQLRDFECAICSNVAYKPVRL-GCSHVFCLHCLIILQKQKVFCPLCRAKEVMKA....... 406
15 -21.900[O] KOG3800 Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor  ali follow..  16  1.................................................................................................................................................................................................................................................KECKKCKSNEYTNKMINECGHPLCKNCVDNIFALNSNCHVCNRVLRKNNFREQIYE 61
16 -21.900[O] KOG4265 Predicted E3 ubiquitin ligase  ali follow..  13  232.....................................................................................................................................................................................................FSVKPLKQKQIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRD-TLILPCRHLLCTSCADTLRYQANNCPICRLFP--GPPADPGGA 329
17 -21.600[O] KOG1645 RING-finger-containing E3 ubiquitin ligase  ali follow..  12  69...............................................................................................................................................................................................................EYIDVLDSPVRVSQNESEGIENQNRRMSNGNKVTLRDCLVLSVWKFGPAVAKSGILDSIVFPVDTCMDTSGFSSDEVEGSLRDVRKIYAS 164
18 -21.200[O] KOG4275 Predicted E3 ubiquitin ligase  ali follow..  16  623.....................................................................................................................................................................................................................EKQELLDRVSRLWKTMRECPAVEKLATDELCKICMDAPIE-CVFLECGHM-CTSC----GKVLNECPICRQYIV--RVVRFFRA 700
19 -21.100[O] COG5540 RING-finger-containing ubiquitin ligase  ali follow..  10  147.......................................................................VQRGKCTYFDKALEAQRLGFKGVIVGDNRSPSSFRLVHIPSLFVSTSSYNLLWSDLLHSYRQPLKLYAKP---EELGDMFWPFLLCFSPSIIMLITVQALAIRKFIRTYRTKSKTRRFIEDLPSRTI--------SREGFYSEEEEIENSTQNGELVPLMDESTRRATFGVECVICLESFTKGDKVVPCKHEFHRPCIAKWIDYRHACPTCNTEVPPPK....... 370
20 -20.800[O] KOG2164 Predicted E3 ubiquitin ligase  ali follow..  28  207............................................................................................................................................................................................................................................SDFQLAACPFCLEEKPVAARMSRCGHVYCFSCLLRFVETPTSCPICWDSIRLRDVHPIR.. 285
21 -20.200[L] COG5627 DNA repair protein MMS21  ali follow..  11  1....................MSEAQLKTSL-EALSQNLLPGNQNHCSFDFQLKEIDDSIKQVIKCALV--AAEIKNNECLDMLDSGIRELLDAKQRLLLMQQSV------------DTLANKTSENISDFEVRTTEMTFLLFLLYVDENKSLLDIYTQ-------------IFKELIQEYEEKSDYGKYGTQGEYIEFKKTIWHEQNTDGSDFPSMKTFFNVMNTEEQEADEVMVYSATFDNRCPLTLQPIVHPILSTACNHFYEKDAILSLLNPTCVCPVCEARLQRSLLKE.... 247
22 -19.600[DKL] COG5220 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3  ali follow..  11  2........................................................................................................................................................................................................................................DDEGARKVDEKCPLCQADRLNPNINPECYHKMCESCVDRIFTTGPATPGCNKILRKAKFRE.... 70
23 -19.500[O] KOG0827 Predicted E3 ubiquitin ligase  ali follow..  20  5..................................................................................................................................................................................................................................................NCVICAELFGDEVFATVCGHMFHHNCLNQWLDRSKTCPQCRNKCTTRNIFRVYFN 61
24 -19.500[S] KOG2660 Locus-specific chromosome binding proteins  ali follow..  23  15..................................................................................................................................................................................................................................................SCSICDNILRDA-------TTISEKCIYEKITEDETCPVCNIDLGSTPLEKL... 61
25 -19.400[O] COG5243 HRD ubiquitin ligase complex, ER membrane component  ali follow..  11  70................LFGELRLIEHEHIFERLPFTIINTLF--------MSSLFHERYFFTVAFFGLLLLYLKVFHWILKEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDIESTSLYLIQVMEFTMLLIDLLNLFLQ-EGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEK....... 407
26 -19.300[O] KOG0828 Predicted E3 ubiquitin ligase  ali follow..  418MHHTN--TPSMVNKISFYCFSMINLVDGSL--ATLYFVAASVVPELYLPLVISAF---SCFILASIFEIRYLIVGIINLLRGNTGTYDENRPRPAFIPDEGSIGGSLYGRFFFMLIIFTFLILSSTSWPRQLRMVFEYILIFILNSYWIPQIFRNAVKGIPSTTIIRSLPVVYVFTYSSNVFRHHKDVHFVVFLSLWLLFQISILYSQDVLKHTIPDGYSYFKPLSNEYISEHGGGTAEHTVDCAICMSDVPIYIMVTPCNHVFHTSCLENWMNYKLQCPVCRSPLPP......... 757
27 -18.900[O] KOG0801 Predicted E3 ubiquitin ligase  ali follow..  14  149................................................................................................................................................................................................................SKSVASDEMEMHFIMCLSKPRLSYNDDVLTKDAGECVICLEELLQGDTIAPCLCIYHKSCIDSWFEVNRSCPEHPAD............ 227
28 -18.500[R] KOG3002 Zn finger protein  ali follow..  17  21...............................................................................................................................................................................................................YEVKMAKVEANSKPTKSGSGSIGKFHSSNGVYELLECPVCTNLMYPPIHQCPNGHTLCSSCKL---RVQNTCPTCRYELGNIRCLAL... 104
29 -18.400[OD] COG5194 Component of SCF ubiquitin ligase and anaphase-promoting complex  ali follow..  26  49.............................................................................................................................................................................................................................................DIAVDNCAICRNHIMEPCAWGVCNHAFHLHCINKWIKTRDACPLDNQPWQLARCGR.... 121
30 -18.200[O] KOG3970 Predicted E3 ubiquitin ligase  ali follow..  12  45...........................................................................................................................................................................................................................................TDQDYDPNCSLCKTTLAEGDTIRNCLHLLHWKCFDEWAANFPRCPCCSQEVFPPI....... 108
31 -18.200[R] KOG2979 Protein involved in DNA repair  ali follow..  64LSHSFRLLISPSKTNLGRENWSEGAIDMASASSSDGVAGRIQNASLVLVSDNSSTLADIRKAVAMM----------KNIAVQLEKENQTDKVKD--------------------LENSVAELLDLHSDCNHRSTAIQSVANRYQPVEQLTDF-------------KKLLDDEFTKLKATPSSVPQNDHLMRQF---------------REAVWNVHHAGEPMPGDDDEDIVMTSTQCPLLNMTCPLSVTELADPVRSMDCRHVYEKSVILHYIVNNPNCPVCRGKLQNSKVIC.... 305
32 -17.800[DR] KOG4739 Uncharacterized protein involved in synaptonemal complex formation  ali follow..  21  6...................................................................................................................................................................................................................................................CNHCGIKPNQTKYLTACGHVFCQNCTKAA--FNSQCYLCKKPLKVDEI...... 52
33 -17.500[O] KOG0800 FOG: Predicted E3 ubiquitin ligase  ali follow..  22  90.........................................................................................................................................................................................................................................KESFTVMDSQCSVCLGDYQPNDQIPVCKHTFHMDCIDLWLTSHTTCPLCRLALIPSR....... 149
34 -17.400[O] KOG4692 Predicted E3 ubiquitin ligase  ali follow..  16  438..................................................................................................................................................................................................................SSEEIDNVRRLIDSLRVKQTLLSDITLPSEDSLCPICCAKPIT-AVFTPCKHQSCSDCIMQHMMNSKVCFYCKTTI--QTIETLDGT 521
35 -17.300[O] KOG1100 Predicted E3 ubiquitin ligase  ali follow..  102.EESVVLNPSAYMQIQKNPTDPLMFLGQDLSSNVQQH------------------HFDIDRLIS----------------------NHVERMRMEIEEKRKTQGRRIVEAVEQGLMKTLRAKDDEINHIGKLNLFLEEKVKSLCVENQIWRDVAQSNEATVNALRSNLQQVLAAVERNRWEEPPTVAD------------------AQSCCGSNDEGDSEEERWKLAGEAQDTKKMCRVGMSMCRSCGKGEAS-VLLLPCRHMLCSVC-----SSLNTCPICKSPKT--ASLHVNLS 334
36 -16.800[O] KOG4159 Predicted E3 ubiquitin ligase  ali follow..  18  1.......................................................................................................................................................................................................................................................MRLFFEP-VTTPCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCV 49
37 -16.700[O] KOG0802 E3 ubiquitin ligase  ali follow..  12  76...............LSLKTLFFGDLYDVETKKLVERLANYIIYKGTFLPLVIPPTIFQGVLWTVWLTVLCTLKMFQALARD---LERLNASPSSTPWTYFRVYSVLFLVLS-FWIKLSLMTYNTIGSAVYLLLLFEPCSIAFETLQALLIHGFQLWKGLLNRNLGFFLDMATLVMALGHYLHIWWLHGIAFHLVDAVLFLNIRALLSAILKRIKGKLRIALGALHAALPDATSEELRAYDDECAICREPMAKAKRL-HCNHLFHLGCLRSWLDQGYSCPTCRKPLFVGR....... 410
38 -16.600[O] KOG2930 SCF ubiquitin ligase, Rbx1 component  ali follow..  22  55..................................................................................................................................................................................................................................................ECQANQASATSEVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKY...... 106
39 -16.600[DO] KOG1493 Anaphase-promoting complex (APC), subunit 11  ali follow..  15  68...............................................................................................................................................................................................................................................GEDTCGICRMEFESPLVLGICRHAFHRHCIDKWIAAPTNCPLCRQDWTIVE....... 135
40 -16.300[S] KOG4638 Uncharacterized conserved protein  ali follow..  125.....................AASRDSPYQRYDIQQAARWIEQILPFSLLLLVVFRQHLQGFFVAIWIAAVMFKSNDILKKQT-----ALKGERHISALIGISVAFTAHVVGVYWWFRKDDLLYPLIMLPPKSISFGAYSLVPIFLRYTCPAGLNDFQGQLLTLVEYFMLL-FLNKDYGSLFSSLMTGLYLTFKLTSVVEKLREIGNEIQVQSFFTALKALSRKEVHYGSYATTEQATCVPSARRRCTPQFFFAAIAFQSGEVFLHIAIIFVYE....................... 406
41 -16.200[O] KOG4172 Predicted E3 ubiquitin ligase  ali follow..  22  1........................................................................................................................................................................................................................................NGAQEVNEGDECTICMDAPVN-SVLYTCGHMMCFECGRRLLTTKGTCPICRAPV--QDVIKTYKS 63
42 -15.200[O] KOG4628 Predicted E3 ubiquitin ligase  ali follow..  93.......................................................................VARGECVFERKIRVAQNASYSA---------------VIVYNNEGDDLEQMSAENITGIRI--------------------SVFVGHTTGKALATYFTTEVVLIINDELPFNINTQLILPFSILIGMCFIIMVIYMIYKCIREQRRLRRHRLPKSMLKKLPTKNNANNKYDTCVICLEDFIEDDKLRPCSHPYHTHCIDPWLTENRRCPICKRKVFTKG....... 284
43 -15.100[O] KOG2817 Predicted E3 ubiquitin ligase  ali follow..  117VELAHLFCKEAGIEEPSESLHVFTLLKSIVQGIRDKDLKLPIEWASQCRGYLERKGSSLEYTLQKYRLVSNYLTTKDIMAAIRYCRTNMAEFQKKHLADIQKTMIALFFC-------------NEVLSGTNDSHDSIHHIISNNAQLNIPQEYIDVLDLDWKSLELLFVREFCAALGMSLESPLDIVVNAGAIALPILL--------KMSSIMKKKHTEWTSQGELPVEIFLPSSYHFHSVFTCPVSKEQATNPPMMMSCGHVIVKESLRQLSRNGSKCPYCPNENVAADAIRVY.. 397
44 -15.100[R] COG5109 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  117VELAHLFCKEAGIEEPSESLHVFTLLKSIVQGIRDKDLKLPIEWASQCRGYLERKGSSLEYTLQKYRLVSNYLTTKDIMAAIRYCRTNMAEFQKKHLADIQKTMIALFFC-------------NEVLSGTNDSHDSIHHIISNNAQLNIPQEYIDVLDLDWKSLELLFVREFCAALGMSLESPLDIVVNAGAIALPILL--------KMSSIMKKKHTEWTSQGELPVEIFLPSSYHFHSVFTCPVSKEQATNPPMMMSCGHVIVKESLRQLSRNGSKCPYCPNENVAADAIRVY.. 397
45 -15.000[DR] KOG1101 Apoptosis inhibitor IAP1 and related BIR domain proteins  ali follow..  17  535...............................................................................................................................................................................................................LYKNLFVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVS-VVFIPCGHLVCQECAPS-----RKCPICRGII--KGTVRTFLS 618
46 -14.700[O] KOG1734 Predicted RING-containing E3 ubiquitin ligase  ali follow..  91MPPPHELTEEEQWAEEHRKMHEKHKGHEAMHMEMMVIFMISVIVGQIFLVTWKRKHFKSYQMCTLIGMLTIPVYVCFNRSWYRF-----------------LATWLVFCIFSAFIWLKASAQHISGGTPRFVYKWFLFLHKLSYVLGVVGYLIMMGALLGFHVLFGVSQPTLMD---------AGILFMFYGVYYGVLGRDFAHICTARMASRIGYYTPEGLPKKHLEDGGRLDDSEHVHDADAVVTTKMVEDEDEKLSCGHVFHEFCIRGWVVKLQTCPYCKERVDLQRMFK.... 368
47 -14.500[O] KOG1039 Predicted E3 ubiquitin ligase  ali follow..  13  206...................................................................................................................................................................................................................PEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKAILSNCNHTYCLSCIRQWRCAKKSCPECRVISKKNELIEAFKQ 320
48 -14.500[O] KOG1814 Predicted E3 ubiquitin ligase  ali follow..  1.................................................................MLEVEVESDNKHLVADELIALQSIYPEIHLDGNNYGRLNIPV-------TESDYFLSFKSPDESTLTDTIVVRHFPDL--------VMEFFLPEAYPFNSPPTFFLKSSWLPLKQKRVLTSSLCVLFDAIEHVRSIATIAFHLPTEMVFPGGFDDLKKEILAFDKNAKLLEFQIRKFQCNVCFDEFNGTDCLTRCGHVSCQSCLRDYYTMC-KCI-CGKDAPVLTLKEL... 236
49 -14.200[U] KOG2066 Vacuolar assembly/sorting protein VPS41  ali follow..  10  484LKILMSCQ-----DFQIFNVIDKHQLFDLVKDQITELMNINSERALR-MEKIGRQPKLQLAYLTKLMSRNEGTEFADKAVQLYAEYDQKKLLPFLRKNANYNVNKARKLCSDKGYIEETIYLLAKSGNHYDAVKMMVREYRNMEKVID------YCKDQNDPDLWIHLLGV-IIEASNCLDPLLIMDKLPDDSDIPNLSEALDKLLVDYTNHAELQQCCYDSTLNDLNVLTQGLISAADIVSRCSLCAQIIINSNQETKCGHIFHLACSTSEMIEEGLCIACSDQIELINV...... 807
50 -14.100[R] KOG0289 mRNA splicing factor  ali follow..  25  5...................................................................................................................................................................................................................................................CSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVA 58
51 -14.100[O] KOG0006 E3 ubiquitin-protein ligase (Parkin protein)  ali follow..  12  178...................................................................................................................................................................................................................QEFFFKCGAHPTSDKETPVALHLIATNSRNITCITCTDVRSPVLVFQNSRHVICLDCFHLYCVTR-PCVAPNSLIKELHHFRILGE 281
52 -14.000[S] KOG0396 Uncharacterized conserved protein  ali follow..  15  1MSEIKALEHATLKVP--YEMLNKRSAQKIIDREVDQVINVSRQVEKALEAEEGPILAEVTKLVDNVAQKLQVLKRKQICKRKLDHLKGITPPSSVTGDLWQGSVDRLDRLVIEHLLREVEDDLASHSTTIDNKSKLRKINSTIEFSLRVQEFIELVRQNQRFE------AVKHSRRYFPAYEKTQLNEICHVMALLAYPLSALKTPHCYAQTCRNLNCPVCQEDLNRIALKLPYSHCVQSRLICRVTGLPLNNQPMMLPNGQIFGQMALPDITKDDGTCPVTNTKFSNPKVEKVF.. 392
53 -13.700[O] KOG3268 Predicted E3 ubiquitin ligase  ali follow..  11  35.DFHLRIVLPEDLQLKNARLLCSWQLRTILSGY-----HRIVQQRMQHPPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEFSTIKLKAEDASGREHLITLKLKAKY-QSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRILGNNVSINIEVDPRHPTMLPECFFLGADHVVKPLGIKLSRNIHLWDPENSVLQNLKDVLEIDFPARAILEKS--DFTMDCGICYAYQLDGTI-SQCGQPFHQICLYEWLRGLGECPYCSKPITLK........ 369
54 -13.500[S] KOG4445 Uncharacterized conserved protein, contains RWD domain  ali follow..  21  98..........................................................................................................................................................................................................................................SGSNLPSGQCVVCLYGFADGDEFTECFHYLHSYCLARHLNALRRCPVCREHIGDET....... 178
55 -13.100[O] KOG2231 Predicted E3 ubiquitin ligase  ali follow..  12  14.................................................................................................................................................................................................................FHRRPKDGVANTTTDNAAVKPEALESYTGNDDNACVVCFKNVE--FSIGDCDHPVCYECSTR-LCQQNECPICRHVLSK-----LFTL 98
56 -12.900[O] KOG3579 Predicted E3 ubiquitin ligase  ali follow..  14  443...............................................................................................................................................................................................................GPREVGGQGAGNTGGLEPVHPASLPDSSLATSAPLCCTLCHERLEDTHFVSVPSHKFCFPCSRQSIKQQGKCPLVGSNVMQGEIATILAG 550
57 -12.900[KL] COG5242 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4  ali follow..  21.ESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVFLNAH-----LAFNSANKVAVIAAYSQGIKYLYPESTSALKASESENKTRSDLKIINSDMYRRFRNVDET----LVEEIYKLFELEKKQIEQNSQRSTLAGAMSAGLTYVNRISKESVTTSLKSRLLVLTCGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATIDPSLRPIIVKPNHGSVDFRTSC-YLTGRVVA------VGFI-CSVCLCVLSIPGNKCPACDSQFDEHVIAKLKRK 323
58 -12.400[KL] KOG2487 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4  ali follow..  1MDEFQTLKQNASWDISEDA----NDTPSLLVVILD--ANPASWYSLSKKVPVSKVLADITVFLNAHLARVAVLASHSDKVEYLYPSIAPEQKVAEVDPTKEANTYRKFREVDDLVLSGMKRLMSSTDKVSRKTMISGALSRALAYINQV-RILIFSLTGDVALQYIPTMNCIFCAQKKNIPINVCNIEGGTLFLEQAADATGGIYLKVDNPKGLLQYLMMSLFPDQNLRKH-PNQANVDFRATC-FCHKKVLD-------GFV-CSVCLSIFCEPRVHCSTCHTKFTVEPMSKKLHT 297
59 -12.300[T] KOG0297 TNF receptor-associated factor  ali follow..  12  1..................................................................................................................................................................................................................MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRP-FQAQCGHRYCSFCLASILSSGPNCAACVHEGIYEE....... 80
60 -12.100[R] COG5236 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  28...............................................................................................................................................................................................................HNDRKNFRRKQKKNNLSAEPNLTTSSADDTDEENELCVICARKLTY-VSLTPCHHKTCHICGFRQLYNKKSCLICRTENEEVMFTD.... 114
61 -11.600[S] KOG3899 Uncharacterized conserved protein  ali follow..  137.....................................................RRHPISKALSKYSITPGSYSAVASEIGIEFRQPEIYKKKLNSISS---------VIATQNWIIKTTMYNVHFAHQSNTSLSVAKAETYNISHQDQNDTLQMISIIVRPMRQGVSDFHIRINALEFRNLENRVRRPIANIQLHRNVIDRFVDVFKAQVAQNPIFPDDATTEKHKQCADFDRNGAPLANGACCSNCY-----------CRPMWCVECLEVWLEQKCTCPMCRAKFCVLDVSYI... 386
62 -11.600[K] KOG2068 MOT2 transcription factor  ali follow..  23  2............................................................................................................................................................................................................................................SDYGEKTCPLCAEEMDLTDQ--KCGYQICVWCWHHIMDMEGRCPACRTPYDKEKI...... 65
63 -11.500[R] KOG3173 Predicted Zn-finger protein  ali follow..  20..........................................................................................................................................................FYGNPRTNGMCSVCYK-EHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRADTSLNNCEGAAGSPSVFQPSTSQSKEKAPELPKPKKNRCFMCRKKVGLTGLTADVEICFVHNCPYDYKAEAAA-PV----VVAEKIQRI... 167
64 -11.100[TZR] KOG1704 FOG: LIM domain  ali follow..  16  204..................................................................................................................................................................................................................................................QCAQCNDVLADQKYMQRANKPVCLKCFHSSS-STFSCTTCRLSFSSDTPHMSQGD 257
65 -10.800[O] COG3058 Uncharacterized protein involved in formate dehydrogenase formation  ali follow..  18  186...............................................................................................................................................................................................................................................QRQYCPVCGSMPVSSMV-TTQGYLHCNLCETEWHVVRVKCSNCEQS-GKLHYWSLDDE 246
66 -10.800[R] KOG2789 Putative Zn-finger protein  ali follow..  17  115...............................................................................................................................................................................................................SSDHLLTRNRSNSTPGSISADYRTTAITTIYANAMECPICF--LYYPSNFNYCAQPICSECFVE-ISEPAKCPYCMTE----RFGVIYKP 223
67 -10.800[R] KOG4323 Polycomb-like PHD Zn-finger protein  ali follow..  16  157...............................................................................................................................................................................................................EGMKTKSGRKIQRPVAYNPNATALKRKSRKVDMVTLCSVCQRGHSPLS-------VFCDGCNSPY---HQLCPIDDATVQDVD....... 235
68 -10.800[K] KOG1244 Predicted transcription factor Requiem/NEURO-D4  ali follow..  20  328.................................................................................................................................................................................................................................................KCCNICGTSENDDQL------LFC-YCLTPSMSEPPECHLCLD............. 376
69 -10.700[K] KOG2169 Zn-finger transcription factor  ali follow..  11  350.........................................................................................................................................................................YKKEHTVAVEWLADKRVWAAGVYFVHRVNSDILFKRLNQNVSRHRSLEVTKQEVIKKLSGGEDDIAMDRLNISLDPLCKTRMTTPSRCQDCTHLQCFD-LLSYLMMNEKCPVCSSNCPYDRLIDMLAK 488
70 -10.700[R] KOG4602 Nanos and related proteins  ali follow..  12  197...............................................................................................................................................................................................................GQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNGESRHVYSS-GVVVC-PILRHYV-----CPVCGATGDQAHTLK-Y.. 283
71 -10.700[B] KOG4718 Non-SMC (structural maintenance of chromosomes) element 1 protein (NSE1)  ali follow..  1......................................................MTDVHRRFLQLLMTHGVLEE------WDVKRLQTHCYKVHDRSATVDKLEDFINNI-LESLYIEIKRGVTEDDGRPIYVNLATTSISKMATDFAENELDLF------RKALELIIDSETGFASSTNILNLVDQLKGKKMRKKE-AEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNARCPHCNDYWPHE........ 228
72 -10.700[R] COG3582 Predicted nucleic acid binding protein containing the AN1-type Zn-finger  ali follow..  22  2...................................................................................................................................................................................................................................SAAIEKETGMLDVGKHCAYCRQLDFLPFHCSFCNEDF---CSNHRLKEDHHCR................. 51
73 -10.300[O] KOG0314 Predicted E3 ubiquitin ligase  ali follow..  1....................MTTFCRPRVEDKVQADMNNVITADASPVEDEFDEFGNDLY----------------SIPDAPAVHSNNLCHDSAPADDEETKLKALIDTPALDWHQQGADSFGPGRGYGRGMAGRMGGRGFGMERTTPPPGYVCH-VSGHFIQ-VKPPTGIPKSMLMATPNGSYSL--------------------PSGAVAVLKPNEDAFEKEMEGLTSTTRSVGEFPPELKCPLCKEVMRDAALASKCLKSYCDKCIRDHIIAKSMCVCGATHVLADDLLP.... 256
74 -10.100[R] KOG3183 Predicted Zn-finger protein  ali follow..  22  11.................................................................................................................................................................................................................................................KHCSVCKQIDFLPFTCDRCLQVYCHDCGNRGDVTVVICPLCAKGVRLNP....... 71
75 -10.000[S] KOG3113 Uncharacterized conserved protein  ali follow..  10........................................................................................................................................................................................................................KRHELVKGPKKVEKVDKDAELVAQWNYCTLSQEILRRPIVACELGRLYNKDAVIEFLLDKSAEKALGKAASIKNVTEL... 91

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 6 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.