current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [S] KOG1407 WD40 repeat protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MEETTIPFKSLHSREYQGHKKKVHSVAWNSNGTKLASGSVDQTARIWNIEPHGHSKAKDLELKGHTDSVDQLCWDPKHSDLVATASGDKSVRLWDARSGKCTQQVELSGENINITYKPDGTHVAVGNRDDELTILDVRKFKPLHRRKFNYEVNEIAWNMPGDFFFLTTGLGTVEVLSYPSLKPLDTLTAHTAGCYCIAIDPKGRYFAVGSADSLVSLWDISDMLCLRTFTKLEWPVRTISFNYSGEYIASASEDLFIDIANVQTGRTVHQIPCRAAMNSVEWNPKYNLLAYAGDDKNPKYNTDEGVFRIFGFESSLast
1 -99.000[S] KOG1407 WD40 repeat protein  ali  100  1MEETTIPFKSLHSREYQGHKKKVHSVAWNSNGTKLASGSVDQTARIWNIEPHGHSKAKDLELKGHTDSVDQLCWDPKHSDLVATASGDKSVRLWDARSGKCTQQVELSGENINITYKPDGTHVAVGNRDDELTILDVRKFKPLHRRKFNYEVNEIAWNMPGDFFFLTTGLGTVEVLSYPSLKPLDTLTAHTAGCYCIAIDPKGRYFAVGSADSLVSLWDISDMLCLRTFTKLEWPVRTISFNYSGEYIASASEDLFIDIANVQTGRTVHQIPCRAAMNSVEWNPKYNLLAYAGDDKNPKYNTDEGVFRIFGFESS 315
2 -72.600[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  12  446.KDALRKTWNPK-FTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPDVEPIYTFRAHKGPVLCVVMSSNGE-QCYSGGTDGLIQGWNTTNPNIDPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWNTTEVAPALSVELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLENSSCQINRVISHPTLSISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHESIHDVAFHPSKCYIASAGADALAKVF.............. 779
3 -69.400[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  17  1..........MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSV----NGERLGTYMGHTGAVWCVDADWDTK-HVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMVSFFDLRDPSQIDNPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTF-RTERPVNSAALSPNYDHVVLGGGQEAARFFHLAFEEEFGRVKGHGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFE.. 324
4 -69.000[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  19  39..RRTSNLQA-PIMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDC---ENVMAMSGHSGAVMEAHFTPDGS-HIFTCSTDKTLAFWDIATGQRQRRFGHGNFVNSVQGSRRGQQLCSGSDDRTIKIWDARKKHAAHTLESPFQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDTITGMSLSPEGDFILTNAMDNTLRVWDVRGERCVKVFQGHEKNLLRCAWSPGSDKITSGSADRHVYIWDVNTRRILYKLPGHNGVNAVDFSPKEPLILSGSSDKTLYLGEID........... 346
5 -67.500[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  18  2....KIKLIDSVVRSFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCE----KGTQSRTVNSKKYGVDLIHFTHANNTAISSTKVDDTIRYLSLHDNKYLRYFGHTKKVISLCISPVEDTFLSGSLDKTLRLWDLRSPNCQGLM-HLSGRPIAAYDPEGLIFAAGVNSESIKLYDLRSFDKFKLNQEKECDWTGLKFSRDGKTILISTNGSVIRLVDAFHGTPLQTFTGYPNNPIEASFSPDSQFIFSGSTDGRVHIWNADTGNKVSVLNGDGPVQCVQFNPKYMMLASACTNMAFWLPTSEEGL........ 317
6 -67.300[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali follow..  26  162..DGDVEIPPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSHCIREGGHDVPSNKDVTSLDWNSDGT-LLAMGSYDGFARIWTENGNLASTLGQHKGPIFALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQFGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPMLASASFDSTVRLWDVEQGVCTHTLMKHQEPVYSVAFSPDGKYLASGSFDKYVHIWNTQSGSLVHSYQGTGGIFEVCWNARGDKVGASASDGSVCVLD............. 521
7 -66.400[S] KOG0282 mRNA splicing factor  ali follow..  16  276.......LPKKQIHVWSGHTKGVSAVRLFPLGHLLLSCSMDCKIKLWEVYG---ERRCLRTFIGHSKAVRDICFNTAGTQ-FLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDLFVAGMSDKKIVQWDIRSGEIVQEYRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKCIGAVWHPETSKVITCGWDGLIKLWD............. 579
8 -65.600[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  16  314.........SVCMYTFHHTNNNMNCAEFSPDSTMIACGFQESYIRLWSIKADKEDSDGSVRLLSHSGPVYGTTFSPDNK-YLLSCSEDASARLWSVDTKTALVAYGHTGPVWDVAFGPFGHYFATASHDQTAQLWSCDHIYPLRVFGHLSDVDCVTFHPNSAYVLTGSSDKTCRLWDVHRGHSVRVFNGHTQPVTAVAIAPDGHTMASADSEGLIHLWDIGTGRRIKTMRGHRGNIYSLSFSRESTVLVSGGSDCTVRAWDVFKTNYNNPVSSSTPIFNVSFTRRNLCLAISVS..................... 643
9 -65.600[R] KOG0286 G-protein beta subunit  ali follow..  15  34..VSGLEVVGRVQRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSY----TTNKVHAIPLRSSWVMTCAYAPSGN-FVACGGLDNMCSIYNLKSREGNVKVAHTGYLSCCRFLDDNN-IVTSSGDTTCALWDIETGQQKTVFGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESCGITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNVSCLGVTADGMAVATGSWDSFLKIWN............. 340
10 -65.500[R] KOG0645 WD40 repeat protein  ali follow..  20  1................SGHTGRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNLVHVID---GFHTRSIRRVAWRPIERPVLAVASFDSVVSINEKIDDDTAALEGHENEVKCIAWSCNGNYLATCSRDKSVWIWEATEDDLAVLQEHTQDVKVVTWHPTEDLLVSGSYDNSICFWRDDDWALTCQLQGHTNTVWALAFSPNGNTLASADNDGNVFLWIKISSQQTSLPHIHKGAVYTISWMNDAT-LCSAGGDGKIVVYQREKHDEALW-HGVYEINSLEYLRDDR-LLSGGDDGECRVWSFK........... 322
11 -65.100[S] KOG0293 WD40 repeat-containing protein  ali follow..  22  252YSDHQCGKHQIPAQILESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGHI-SLKHTLVGHHKPVIAILWSPDDR-QVLTCGAEEVIRRWDVDSGDCVHMYKGGISPISCGWYPDGQGIIAGMTDRSICMWDLDGREKECWKQRTQKVSDIAMTDDGKWLVSVCKDSVISLFDREATV--ERLIEEEDMITSFSLSNDNKYILVNLLNQEIRLWNIEGDKIVSRYKGHKRSIRSCFGGYKQAFIASGSEDSQVYIWHRSTGKLIVELPGHAGVNCVSWSPTNHMLASASDDGTIRIWGLDRINQQ...... 567
12 -65.000[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  16  5......ELPTKEAHILKGHEGAVLAARFNGDGNYALTCGKDRTIRLWNPH----RGILIKTYKSHGREVRDVHVTSDNAK-FCSCGGDRQVYYWDVSTGRVIRKFGHDGEVNAVKFNDSSSVVVSAGFDRSLRVWDCRSHSVEPVQIDTFLDTVMSVVLTKTEIIGGSVDGTVRTFDMRIGREMSDNLGQP--VNCISISNDGNCVLAGCLDSTLRLLDRTTGELLQVYKGHISKKTDCCLTNSDAHVIGGSEDGLVFFWDLVDAKVLSKFRAHDLVNSIDVDFYLRKFFVAGDKRELPPEGRLYVDFF...... 306
13 -63.300[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  56LKDKKLKTQEKLYGKSAKAAAKIEKWLLPAEAGYLETEGLEKTWRVKQTD-DILSSRNQYDIVLPDFGPYKLDFTASGR-HMLAGGRKGHLALLDMMNMSLIKEIQVRETVRDVAFLHNDQFFAAAQKKYAYIYGR--DGTELHCLKERGPVARLRFLKNHFLLASVNMSGQLHYQDVTHGGMVASIRTGKGRTDVMEVNPYNSVVGLGHSGGTVTMWKPTSQAPLVQMQCHPGPVSSVAFHPNGHLMATSGKERKIKIWDLRKFEEVQTIHSFYQIEKVMFRPYEDVIGIGHSMGWSSILIPGSGEPNFDSWVA 421
14 -63.200[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  20  82.GDDLGYIWDITTCQLTGHKDSIVAIDWSFDGTYIATGGMDSQVRLWKSS----TGFEFITAFETVDEIVWLSWHPKGL-FLAAGCNDGSIWMWSLPSGKVVQVMGHTAPVNAGKFIPPGKRLATVDDSGTLIVWNPATGAPECREETAAGWTSFDCNAEGNVLFLGGSSGKVKVVNINSSHILASLEAQTESVEAIALCTALPICACASVDGTVALYDSASLKFRKSL-PHEQAVIDCKFLPNTPYLLTACADCVIRKWDVRSGQLLGEYTGHQEILCMAITPDGKRVVTGSDDTELLVFDCEH.......... 399
15 -63.200[T] KOG0279 G protein beta subunit-like protein  ali follow..  16  1.....MAEGLVLKGTMCAHTDMVTAIATPVDNSVIVTSSRDKSIILWKLTKEKSYGVAQRRMTGHSHFVQDVVLSSDGQ-FALSGSWDGELRLWDLATGESTRRFGHTKDVLSVAFSTDNRQIVSASRDRTIKLWNTLGECKYEADGHKEWVSCVRFSPNTLTIVSASWDKTVKVWNLQNCKLRNTLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGS-IIHSLCFSPNRYWLCAAT-ENSIRIWDLESKSVVEDLKVDIYCTSLNWSADGNTLFSGYTDGVIRVWGIGR.......... 325
16 -62.800[A] KOG0285 Pleiotropic regulator 1  ali follow..  19  158.........WKNYRVLQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVA----TGVLKLTLTGHIGQVRGLAVSNRHT-YMFSAGDDKQVKCWDLEQNKVIRSYGHLHGVYCLALHPTLDVVLTGGRDSVCRVWDIRTKMQIFVLPHDSDVFSVLARPTDPQVITGSHDSTIKFWDLRYGKSMATITNHKKTVRAMALHPKENDFVSASADNIKKFSLPKGEFCHNMLSLQRDIINAVAVNEDGV-MVTGGDKGGLWFWDWKSGHNFQRAETEAGIYAACYDQTGSRLVTCEGDKTIKMWKEDED......... 458
17 -62.500[S] KOG0295 WD40 repeat-containing protein  ali follow..  22  84.RDKRQAADPPETQKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYE----TGQLERTLKGHTDAVNDIAIDAAGK-QLVSCSSDLSIKLWDFQTYDCLKSLGHEHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTFGHNDWVRMIRISNDGTLFASASLDQTVTVWSFATKSAKLVLRDHEHAVECVEWAPDTAYLFSGSRDRSIKAWNINTGDVLFTLLAHENWVRGLAFHPKGKYLISVADDKTLRVWELSAQRCMKAIEAHEHVSTVAFHQTSPFVITGSVDMSCKVWE............. 402
18 -62.400[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  15  1............MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGS--QWVKAHELKEHNGHITGIDWAPKSD-RIVTCGADRNAYVWSQKDGVTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFEAENKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKESEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVSTLKTEFLPLLSVSFVSENSVVAAGH-DCCPMLFIYDDRGCLTFVSKQNSITQVSIKQDCRKFCTTGIDGAMTIWDFKTLESSIQ.... 365
19 -62.100[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  14  6.NTSQTGPKIIRDEHEYSNRSAVSALQYDAQNGRLFTGGSDTIIRTWSVPHHKSPVQYQGSLEQHTDWVNDMILCGHGK-ILISASNDTTVKVWNIERDNKHGFITHKDYVSCLAYAPIVEKAVSASFDHNIFVYDINANFKTNLIGCKDSIYSLATTPNLSLVLGAGTEKCIRLFDPRTNEKIMKLRGHTDNVRALVVNDDGTRALSAGSDATIRLWDIGQQRCIATCIAHEEGVWTLQVDSSFTTVYSAGKDKMVVKTPLYDFTKSQLLFKEAPVKKLLLSEKDNSLWVGTWKSDIKRWSIRPSAQL...... 341
20 -61.800[R] KOG0289 mRNA splicing factor  ali follow..  18  194VPEELVKPEELSKGLHSASIPGILALDLCPDTNKILTGGADKNVVVFDKS----SEQILATLKGHTKKVTSVVFHPSQD-LVFSASPDATIRIWSVPNASCVQVVAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQDNNFEVKSLIFDQSGTYLALGGTD--VQIYICKQWTEILHFTEHSGTTGVAFGHHAKFIASTGMDRSLKFYS............. 503
21 -61.600[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  19  125.GDQTMRIWDIELHTCKSHKSWVLCIAWSPDATKIASACKNGEICIWNAKTGEQIGK---TLKRHKQWITSLAWQPMHCRLLASCGKDGNIFIWDTVQGTVVRCLGHTASVTCLRWGGEGL-IYSGSQDRTVKMWRADDGVMCRNMGHAHWINTLALNTDGERLVSGSDDFTLFMWNPETKQSINRMTGHMQLVNQVVFSPDTRYIASASFDKSVKLWCGRTGKYLASLRGHVGPVYQVAWSADSRLLVSGSADSTLKVFELKTKSLYYDLPGHGDVFTVDWSPEGTKVVSGGKDKVLKLWR............. 472
22 -61.400[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  17  328.SSGAFYLYELPIHSLSISDYPISAALFNCTGDWVALASREGQLLVWEWQ----SEQYIMKQQGHSSEMTCIAYSSDGQ-FIATGGEDSKVKLWNTQSSFCFVTFEHTSGVTGIQFSRNKKFLVSSSLDGTVRAFDVNRYRNFRTFPNPAQFSCVAVDYSGELVVAGGQDFDIFLWSVKTGKLLEIISGHEGPVVSIAFSPTSSTLVSGSWDKTVKIWNCLESNSEHETIDAVSDVTNVTFSPSGEEIAVATLSGNITIFDIKSAGQVTTIEGRNYFSTIEYSADGECILAAGKSANICIYHVREAILLKKFEIT 668
23 -60.900[YU] KOG2445 Nuclear pore complex component (sc Seh1)  ali follow..  17  2............QPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEGRIIASASYDKTVKLWEEDPDQLCTLNDSKGSLYSVKFAPAGLKLACLGNDGILRLYDALEPSDLRSANHLQSDFCLSWCPSRFEKLAVSALEQAIIYKDGKLHVAAKLPGHKSLIRSISWAPSYQLIATGCKDGRIRIFKITEKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNTELQSNLQVELLSEHDDHGEVWSVSWNLTGTILSSAGDDGKVRLWKATYS......... 336
24 -60.700[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  19  96.........SYETAYVTSHKQACRAGAFSCDGSLVATGSVDASIKILDVEREQQGHPVIRTLYDHTDEVSYLEFHPKEH-ILASASRDGTVKLFDIAKPSVKKAFTDCEPVLCLSFHPTGDYVAIGTEHNVLRVYDVATTQCFVSQQHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRCINTIAEAHGGICSLEFTRNGKYLLSSGMDSLVYLWELCTSRPIQTYTGQEHQTEAVFNHTEDYVLFPDEATTSLCSWNSRNGCRLTLNGHNGPVRYITHSPNGPAFLTCSDDFRARFWYRRANNQ....... 424
25 -60.300[U] KOG1332 Vesicle coat complex COPII, subunit SEC13  ali follow..  17  1.......MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNG--GQILIADLRGHEGPVWQVAWAHPMGNILASCSYDRKVIIWREENGTSHEHAGHDSSVNSVCWAPHGLILACGSSDGAISLLTYTGEGKKINNAHTIGCNAVSWAPAVKRFASGGCDNLIKLWKEEEDGEEQKLEAHSDWVRDVAWAPSTSTIASCSQDGRVFIWTCDDASSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISQGSVSASVTEGQQNE............................ 321
26 -60.300[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  16  385.QNNLVELYSLNPSTIGGHRSDVRTLSFSSDNIAVLSAAAD-SIKIWNRSTLQCIRTM------TCEYALCSFFVPGDR-QVVIGTKTGKLQLYDLASGNLLETIDHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKDERTLQLDEDVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLKFFLSLYGHKLPVICMDISHDGALIATGSADRNVKIWGLDFGDCHKSLFAHDDSVMYLQFVPKSHLFFTAGKDHKIKQWDADKFEHIQTLEGHQEIWCLAVSPSGDYVVSSSHDKSLRLWERTREPLILEEERE 716
27 -60.000[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  16  1.....MPLRLEIKRKLAQRSERVKSVDLHPTEPWILASLYSGTLCIWNYQ----TQVMAKSFEVTELPVRSAKFVARKQ-WVVAGADDMYIRVYNYNTMDKVKVFAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWACIFEGHSHYVMQVTFNPKDNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGERVWAIGYIKSSRRVVIGYDEGTIMVKLGRE.......... 302
28 -59.800[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  14  6.........GGAARMLRTPGRHGYAAEFSPLPGRLACATAQGTLLILDPDE---AGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGDGSLQLWDTAKAALQVYKEHAQEVYSVDWSQTRGLVVSGSWDQTVKLWDPTVGKSLCTFGHESIIYSTIWSPIPGCFASASGDQTLRIWDVKAAGVRIVIPAHQAEILSCDWCKNENLLVTGAVDCSLRGWDLRNRQPVFELLGHTYAIRRVKFSPHASVLASCSYDFTVRFWNFSKPSLLETVEHHTETCGLDFSLQSPQVADCSWDETIKIYDPACLTIP...... 322
29 -59.800[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  16  87.CDGEVRIWNLTIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGQRTNPICSMTWGFDSISSVKFNPIETFLLGSCASDRNIVLYDMRQATPLKKVILDMRTNTICWNPMEAFFTAANEDYNLYTFDMRALDVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYTKRMQHVICVKWTSDSKYIMCGSDEMNIRLWKANASEKLGVLTSREKAAKDFQHYPHIKRIARHR-HLPKSIYSQIQEQRIMKEARRKEVNRIKHSKPGSVPLVSEKKKHV................. 440
30 -59.300[R] KOG1334 WD40 repeat protein  ali follow..  15  270............QYLLGSHAGSVSTIHFNQRGTRLASSGDDLRVIVWDWVRQK---PVLNFESGHDINVIQAKFFPNGDSTLAMCGHDGQVRVAELINASYCENTKHRGPAHELALEPDSYKFLTSGEDAVVFTIDLRQDRPASKVDKKVGLYTISMNPANIQFAVGGHDQFVRIYDQRRIDHHLVYCDFPTNITCVVYSHDGTELLASYNDEDIYLFNSSLSDGAQYVKRYKG-KCVNFYGPRSEFVVSGSDCGHVFFWEKSSSQIIQFMEGDDIVNCLEPHPYLPVLATSGLDQHVRIWTPTA.......... 593
31 -59.100[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  13  10.EQGESSMGGAKLHRITGHVARINDVILLSKDEGVWTASDDRSVRLYLKRDNDQFWP--SIHHFMPVAPTSLYYSEETY-KLLVGLINGNVYEFSVADDESRKWTCHAGPISGLGFALSSELIFSCSRDKSIVWHCSENSNKMG--SYLLENSCTAMVIDLPFVFVGDHGGHVTVLRIVDNQLVSKLSAHTNAITSLTWDGNKKVLYSGSSDHLIIMWDIGGGRGEYELNGHNGKVTTLCAAPAAKRLFSADEHGKLMCWDMNCKRVETPEWKTSDITAMHLQETLGLLVTSGQNRVIMIWDVRSVCSA...... 410
32 -59.100[R] KOG0288 WD40 repeat protein TipD  ali follow..  16  208.EDGTDHFVSTCANRIHAHEGGCGSIVFEYNSGTLFTGGQDRAVKMWDTN----SGTLIKSLYGSLGNILDMAVTHDNK-SVIAATSSNNLFVWDVSSGRVRHTLGHTDKVCAVDVSKFSRHVVSAAYDRTIKLWDLHKGYCTNTVLFTSNCNAICLSIDGLTVFSGHMDGNLRLWDIQTGKLLSEVAGHSSAVTSVSLSRNGNRILTSGRDNVHNVFDTRTLEICGTLRASGNRLASSCISPDDDYVAAGSADGSVHVWSLSKGNIVSILKEQTSILCCSWSGIGKPLASADKNGYVCTWT............. 515
33 -58.900[S] KOG4328 WD40 protein  ali follow..  15  208.............NVARVVPGRIFVVQFLPNVKMVAAGDKLGNVGFWNLDCGNEDNDGIYLFTPHSAPVSSIVFQQNSLSRVISSSYDGLIRLMDVEKSVFDLVYSTDEAIFSLSQRPNDQSLYFGQDYGVFNVWDLRAGKSVFHWEHERRINSIDFNPQNPVMATSSTDGTACLWDLRSMGKTLSTVNHSRAVHSAYFSPSGLSLATTSLDNYIGVLSGANFENTCMIYHNNTSKFKAVWGWDDSYIYVGNLSKKIDVINPKLKRTVMELHNPAIPCRIHCHPNVGTLAGSTAGGQVYVWTTK........... 516
34 -58.700[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  10  6..LPAEKFLSRTILLDEDEPAVVSSVRISPKKPYHVATTSSVRLTLYDTV----VCEPLNLFSRFKKGVCSIDFRHDGR-LLAIGGDEGKVRIFDVEKTTLRVMQASQSTVKSVHFSPRGDTVFSMADDGKIKQYRVADTAYGEIQAHEDAIRCGAVSSNDHIVLTGGYDHKVRLWDIRSKEKSLEL-DCEHPVESVLFLPGEQLIATAA-GPIVKIWDTTTGRQLTALQAHYKTVTSLRLATNSTCLLSAGIDRRVNAFRTTNYSLINSWSMPSPVLDIDVSRDDQTMAIGMGNLLALYRRAEIKKEA...... 322
35 -58.600[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  16  14.YDHTIKVWQAHTGNCFVETSQVNALDRTPDKTRLAACGYQ-CIRLYDLESN--CTAPVINFDGVQKNVTRLGFQEDGN-WMFTAGEDHHVRIWDMIAAPCSRIFDCEAPVNAACLHPNQVEIAMGSQNGSVFLWDVKSERHERIVEVDASIQDVAISPDGRYLAAANNKGNCYIWSLTSLRPNRKIPAHSRYILRCKFSPDSRLLLTTSGDGTVCIWKTDDFSKWRELCIENYWVWDAAFSADSKWLFTASSDGIARLWKLQTKSSIRDYTGHTKITALSFKDEIPVKSTNISDVQSSAKPMGNTTTELN.... 362
36 -58.300[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  14  4.........KLSASRKTRHTEMVCGVGWIGTEA-ILSAADDHVFLLTNTA----TNESQQILNMPETFPTSLHIFPRSNDVFAVSTSDGKINILSRNGKVENMVDAHNGAALCARWNSDGTGLLSSGEDGFVKMWSRSGMLRSVLAQFATAVYCVAWDSTSSNVLYCNADHCY-IKSLKMQVAPIKWKAHDGIILCCDWNPTSDLIVTGGEDLKFKVWDG-FGQILFNSSVHDYPITSISWNTDGTLFAVGSHN-ILRLCDKSGWSHSLEKMNAGSVMALSWSPDGTQLAVGTAAGLVFHAHIIDK......... 299
37 -58.200[BK] KOG1063 RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily  ali follow..  12  337.MDKTMMIWRVCVGELSHCALGFYGGHWSPNSLSILAHGYGGAFHLWRNVSSSENWQMQKVPSGHFAAVTDVTWARTGE-YLLSVSQDQTTRVFSAWKNDEGNEAGHDINCVAMVQGKGNHRFVSGAEEKVVRVFEAPLSFLKTLNGGGEGLDTFETVPEAAPAELKEPPIEDQLAFHTLWPESHKLYGHGNELFSLCSDHKGNLVASSCKAQSIWLWEVGTWKAVGRLQSHSLTVTHLEFSYDDTLLLSVSRDRHFSVFSIQRTKLMAKVEAHKRIWACSWNPFGHQFATSSRDKTVKIWSVENDARIKQILV. 736
38 -58.200[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  18  437.........TVESMVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATG-----RCIRTIETDEVVRCVAWCPNPKLSIIAVATGNRLLLVNPKVGDVRVVITHFKPIRQVTWHGRGDYLATVMPEGANRIHQLSKRRSQIPSKSKGLIQFVLFHPVKPCFFVAT-QHNIRIYDLVKQELVKKLLTNSKWISGMSIHPKGDNLLVSTYDKKMLWFDLDSTKPYQTMRLHRNAVRSVAFHLRYPLFASGSDDQAVIVSHGMVYNPLKKLQTHEGVLDVNWHPVQPWVFSTGADSTIRLYT............. 784
39 -57.600[R] KOG2096 WD40 repeat protein  ali follow..  14  59.NHPKSQASDKNLNTLKGHGDAVTGLCFSSDGKSLATACADGVIRVFKLDDASLKFRFLRINLPAGGHPTAVAFADDASSIVVQGKLPLPSIKWDHHHIHEKRSVTISGATATYGTADGSVVIASCSEGTDIVLWHGKTGRNLGHVTNQLKNHMAAVSPNGRFLAAAAFTADVKVWEIKEVSRVMQLKGHKSAVTWLCFSPNSEQIITASKDGSIRVWNINVRIPLCDSGGNPLHYDRLSLCPEGKILAASH-GSTLQWLCAETGNVLDTAEKEGDITCISWAPKAMVLGTSGDDKKVKLWEAPKSQSL...... 454
40 -57.500[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  15  42.NGNSVIIRNIEADVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKEETGTSVGEISGQSKSINSADFRPARPFRIVTGSEDNTIAVFEGPPFKFKMTKDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEFAHKGGVYALAWKPDSTQLLTCSGDKTCRLWTVESRELVSEVMGTTVDDQQVSCLWQGDNLITVSLSGVITYLNVADSKPLRVVKGHNKPITVLGLSDDRSTIYTGSHDGVVTNWNSGSGTNDRITGTGHGNQINGIAAWGDFVYTCGIDDSLRQFSVEGN......... 398
41 -57.400[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  14  7.........SAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNS-----LKGEFLHGGAVLDCCFHDDFSGF--SVGADYKVRRIVFNVGKEDILGTHDKAVTLCLFCDVTGQVITGSWDKTVKCWDPRGASGPERTTYLQPERVYSMSLVGHRLVVATAGRHVNIYDLRNMSQPRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSRKSEAGRDIVYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRLYQYSKYTSISALSFSRDGQLLAVASSYTFEEGEKEPEAIFVRSVNEI 340
42 -57.200[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  17  2..............SLCGHTSPVDSVAFNSEEVLVLAGASSGVIKLWDLE----ESKMVRAFTGHRSNCSAVEFHPFGE-FLASGSSDTNLRVWDTRKKGCIQTYGHTRGISTIEFSPDGRWVVSGGLDNVVKVWDLTAGKLLHEFCHEGPIRSLDFHPLEFLLATGSADRTVKFWDLETFELIGTTRPEATGVRAIAFHPDGQTLFCGLDDG-LKVYSWEPVICRDGVDMGWSTL-GDFCINEGKFIGCSYYRNSVGIWVSDISESVSPDYETREIKNIYVDSTGGNLNVAQNPGSLKATLPLESGKVATMVSE 332
43 -57.200[R] KOG2055 WD40 repeat protein  ali follow..  13  209...........DANFQAPSHSGIRCMSIHPYFPLLLTCGFDRTLRIYQLD--GKVNPLVTSLHLRSSALQTALFHPDGKR-VIAAGRRKYMYIWDLESAQVQKVSNFQPSMERFHVDPTGKYIALEGRSGHINLLHALTGQFATSFKIEGVLSDVLFTSDGSEMLVLSYGAEVWHFNVEQRSVVRRWQVQDGSTTHFCLDPSNKYLAIGSKSGIVNIYDLQTSKPVTTLDNITFSINSMSFSQDSQVLAIASKKDTLRLVHVPSFSVFRNWPTSGRVTCLAFGKGGE-LCVGNEAGRVGLWKLAHYDLKFVPDKI 527
44 -56.700[A] KOG0299 U3 snoRNP-associated protein (contains WD40 repeats)  ali follow..  17  198.........SRSRRGENDHVKEITCLAISNDGRWIVTGGLDHRIVIRDSV----TLEPQHCWKHHRDAVMGLAMRRGTNE-MFSCSADRSIKVWSLDQMSYIETLGHQDVIFGVDALARERCVSVGGRDRTSRLWKIVEESQLATAGYMEGSVDCVAMIDEDHFVTGSDNGVIALWSVQRKKPLFTIPPQPRWITSLAAIPYSNLFASGSWDGNIRLWKIAEGLRSATPLSVYGCINSLSLSLQGKVFAACGRETRVGRWKTLRGIPNSGFVFNIPLTVIPSVTDGDEID......................... 523
45 -56.700[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  16  254............LCSQVGDTRPVSSAAFSEDSSLLLTSSWSGLCKLWSVP----DCELKQTLRGHASYVGGVALRPGVKAAMASGGHDGAVKLWGFNNEESIADITMPHRVSKVAFHPSGRFLATACYDSSWRLWDLEQKTEVLHQGHAKPVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGRCIMFLEGHLGAVFGVDFSPNGFHIATGSQDNTCKIWDLRRRQPVYTIPAHTNLISDVKYQQEGSFLVTCSYDSTTKIWSNKTWQPLKTLQGHDNVISVDIAPNSQYIATTSFDRTFKLWSPDS.......... 553
46 -56.600[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  15  101.ETEAISIIKLCEAKISHGTQAISALRVEPPGVRFASGGLDYYVKLFDFQKMDMSMRYDKELPAESHVINSLAFSPNGE-TLVVASGEAIIRLLDRAGKQWSETVGHTATVNCVEFNPLNKEFISCSDDGSLRLWNLDDHKVITKNGKRVSPQVCTFSPDGKWIAAGCDDGSVQAWKYGSQYNYLVRKAHNGSITSIAFSPDSKRLLSRGFDDTLKMWSLDNPKLVKTGLENAFKSTDCGFSPRAEVVFTGTTPGTLQFFDPMTFDLVYKIDYPGICHRIQWHPRLNQIIAGLSDGTIHVYYDQTM......... 450
47 -56.300[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  13  339.NTSEIRLYNTKTLDRGHTESVLSVVSPTWDTSLLASCSKDNSIIFWRLVTSPSTLVPVAAATGHANTVTALAISNTGRAFLASVSTDCTIKLWGLGVSTKLKEVAHGKDVNCVDISESDALIATGGMDKLVKLWQVDTHKMQTLSGHRRGVGDVKFAKNSHKLASCSGDMTIKIWNISEKSCLQTISGHSCAVFRVIFARNDSQLISADSAGIIKIWTIKTADCECSIDAHTDKIWSLSKNHNESEFVTAGTDGRIVVWKDVTEEKQKAEDNKR-REAIEQDQTLTNLLSQKRYSEALVFALT........... 677
48 -55.900[S] KOG0283 WD40 repeat-containing protein  ali follow..  19  375.ANEWVKVRPTGCQEIQAHEGAVWTIKFSQDAHYLASGGADRVIHVWEVQECELSDKPVCSLKGHLDAILDLSWSKSQL--LLSSSMDKTVRLWDIETKTCLKLFAHNDYVTCIQFSPDENYFLSGSLDAKIRIWSIQDRHVVEWSDLHEMVTAACYTPDGQGALIGSHKGICRAYDTEDCKLSQTNSQAKRKITSFQFSPVNPEVLVTSADSRIRILDGSEVIHKFKGFRNTCSQLSASYSQDGKYIICASEDSQVYLWKNDFHRTRSTLTTQSWHGHVRGEPPPVQIHSKRHSKRISTSSQPSS......... 769
49 -55.900[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  17  2.........................SFFNRSNTTSALGTSTAMANEKDLAND------IVINSPAEDSISDIAFSPQQDFMFSASSWDGKVRIWDVQNGVPQGRAESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQTQQIGMHSAPIKVLRFPSNTECIVTGSWDKTIKYWDMRQPQPVSTVSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDGMPGSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQRHRLKGYPTLASIPVCSFNRNGSVFAYALSYDWHQGHMGNRP......... 343
50 -55.900[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  13  462.PPDALIGPGIPRHNTLNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNSPVSQLDCLNRDNYIRSCKLLPDGC-TLIVGGEASTLSIWDLAAPTKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQH-DFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPD-KYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYE............. 767
51 -55.600[T] KOG4378 Nuclear protein COP1  ali follow..  14  1......................MMSNLVEPSWRLLAASG-GDTVKLFDVSADSGDPCVLSYTPSPGCAVNSVKWNHTNL-VVASTGEDKKISLWRKNGQSLGTV-SAEECLSAISFSKKGRYICSGGTGQIVKIWDLQRKLCIKKLGHTSTITGVMYNCKDEHLASVSVGGDLIVHNLASGARATELKDPNGQLRLLDYSRSSRLLVTAGDDGTVHLWDTTGRSPKMSLKQHSAPTAGVCFSPSNEIIASVGMDKKLYTYDSGSRRSSSCIAYEAPFSSLAFGDNGYILVAGTSNGRVVFYDIRGKPQ....... 304
52 -54.900[R] KOG0646 WD40 repeat protein  ali follow..  15  57.TSGSIFYWSWTKPQKSYPVEPIKALAANNEGTYLVGGGISGDIYLWEVA----TGKLLKKWHGHYRSVTCLVFSGDDS-LLVSGSQDGSIRVWSLIRLFDDFQREHTMSVTDIVIDYGGCVIISSSEDRTCKVWSLSRGKLLKNIIFPSVINALALDPGGCVFYAGARDSKIYIGAINATQVLGSVSEKGKAITCLAYCADGNLLISGSEDGVVCVWDPKSLRHVRTLIHAKGSRKGPVNNQIVRKTIVANSNKTQVSWKSRGALIPPPLEKYER--PVEDTMDGIVTVDPPPFSDVPVYSSFLSADLIDEQVK 386
53 -54.900[R] KOG1273 WD40 repeat protein  ali follow..  17  2....NAPIIDPLQGDFYLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDFETRGIA--KEIRDNDCSAAITSVSWSKYGH-RLLVSAADKSLTLWDVSTGEKIARTILQQTPLQARLNPDCTTLLPVSVPEMPDVLAPPQRSKCPESNPPFSPAAACFNKCGDLVYIGNSKGEILIVDYKSVRVLALVSSGAAPVKNIVFSRNGQYLLTNSHDRTIRIYENLLPAKNKMKTVTKMHWKAPCFSGDGEWVVGGSGEHKIYIWD-RAGHLVKILEGPEALIDLAWHPVHPIIVSVSLAGLVYIWAKDYTENWSAFAPD 358
54 -54.400[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  12  339.SSGNILVWGKGTAVQGAHEGGISPLCMLRDGTLVSGGGKDRKLISWSGNYQKLSGDFTPITQGHTDELWGLAIHASKP-QFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVESDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHISSHVTNVDFLCEDSHLISGGKDTSIMQWR............. 715
55 -54.400[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  17  147.ETGALELFDSRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQTSKVFDLSTQQCITRLGRVDGYHSHSVKQVNFCNDSPYNLVSCSRDGSIIFWDMRTHGITENSGRDCSITSATWLPQSTVISSCSANSALKLWDLRTVHTVRTSKRDFGVTNVCTSPDGERIYAASRDSIIYEYSSRHLNSKDPRLRISSFYVKLACSPDGATLACGGKTSGVVVFDTTRNSSAMLTGGHTKDVTAVDWSSEGQ-LASISDDGSVRVWNSSLHGSAANLKNFSEIFYWGFSEK.............................. 490
56 -54.300[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  13  1.....MASNQQPPSNLQTYGVPIYAVDWILEEAVRSKITKDQDDDDDDGSSSSSSEQPIGRRVIGTDLPYRMAIHPRQGGLICALPNSCRLFDWEEESEKVVKELKDVGQQLSLSFNQDGTVLATGAEDGTLRVFEWPSMKTLNESKTHASVKSLTFSESGKFLVSLG-APLCRVWDVNASAAIASLSKEKDEFASCRFSVDNSVAANTQRGGSIITWDTTSWRRRSSLIKRNNSISAFNVSADGKLLAVGTLEGDVLIIDSTKMQTNQIVKKLGLVTALTFSPDSRCLVSVSFDSRARLTVIKQKGEK...... 353
57 -54.300[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  15  120.............APGLRDDFSLNLLDWGSANVLAIAL--GDTVYLWDASSG--STSELVTIDEDKGPVTSINWTQDGL-DLAVGLDNSEVQLWDCVSNRQVRTLRGGHESRVGSLAWDNHILTTGGMDGKIVNNDVRIRSSITYLGHTEEVCGLKWSESGNKQASGGNDNVVHIWDRSLAQWLHRFEEHTAAVRALAWCPFQASLLAGVGDGKIKFWNTHTGACLNSVETGSQ-VCSLLWSQSERELLSGFTQNQLTLWKYPSMSKMAELNGHSRVLFMAQSPNGCTVASAAGDENLRLWNVFGE......... 420
58 -54.100[R] KOG1539 WD repeat protein  ali follow..  14  252.SFGVISIWNLNKKRLDAHDSSIISLNFLANEPVLMSASADNSLKMWIFDTNDGDPRLLRFRSGHSAPPLCIRFYSNGR-HILSAGQDRAFRLFSVIQEQQSRELHLLLAILACAISACGNFAVVGTAGGWIERFNLQSGISRGSYAHDGEVIGVACDSTNTLMISAGYHGDLKVWDFKKRELKSQWDVGCS-LVKIVYHRVNGLLATVADDFVIRLYDVVTLKMVREFRGHTDRITDLCFSEDGKWVISSSMDGSLRIWDVILAKQIDGVHVDVPITALSLSPNMDVLATAHSDQ--------NGVYLWVNQSM 652
59 -53.600[R] KOG0322 G-protein beta subunit-like protein GNB1L, contains WD repeats  ali follow..  11  9............VFSLRSPMGAVNSLCFQESD-RLLAGTIKGSVFLWDLQ----TNRSALHFEVGSDPITSLHHTPDR---LVTQEKGGTITMFSIGGSSYVKERSCRSALHTNTSKTNEQLLFYPCEESSIGVLHVTDAAAPTQILVPDDCFKPFECASQLFLLAGYESGHFLTWDISSSVIL-DVMELAQDATSVDYDPVTNRGIVGGPTDKLISFSYQRSQLGSELCIKNPGVNGVRIRPDQKVFASAGWDGRIRIFSWKSLRPLAVLTQHGGVMDLAFSSQAPIMAAAGMDGQISLWDLYN.......... 323
60 -52.900[R] KOG4497 Uncharacterized conserved protein WDR8, contains WD repeats  ali follow..  14  28..QYRLVVRDVNTLQILTCLDQIQHIEWSADSLFILCAMYKGLVQVWSLE----QPEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWSLCTKSVSYIKYPKACLQGITFTRDGRYMALAERRDCVSIFVCSDWQLLRHFDDTQDLTGIEWAPNGCVLAVWDTCLEYKILLYSDGRLLSTYSAWSLGIKSVAWSPSSQFLAVGSYDGKVRILNHVTWKMITEFANPKMGIGMLAFSPDSYFLATRNDNNAVWVWDIQKLRLFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSV...... 408
61 -52.800[R] KOG2394 WD40 protein DMR-N9  ali follow..  15  170............VKSIHFSNSNPMCHAFAKDGHDLLIGLNSGDVYTVSLRQQLQDVSKKLSVNNRQDRCTSISWVPGGDGAAIRDPTQFSVDKAKYSKSNPVARWHCQGSINSIAFSNDGAHLATVGRDGYLRIFDFLTQKLVCGKSYYGALLCCSWSMDGKYILTGGEDDLVQVWSMEDRKVVAWGEGHNSWVSGVAFDSNWSRFGSVGQDTQLLLWDLEMDEIIIAHRVHTEPLSGLMFTQES--VVTACREGHIKIWTRPSESETQTNSSTTALLSTSFTKDNKASLSSKIISGSTFKQ............. 556
62 -52.700[R] KOG4227 WD40 repeat protein  ali follow..  16  46............KKDLLGHFGCVNAIEFSNNGQWLVSGGDDRRVLLWHMEQAIHSRKPIQLKGEHHSNIFCLAFNSGNT-KVFSGGNDEQVILHDVESSETLDVFAHEDAVYGLSVSPVNNIFASSSDDGRVLIWDIRESPPFCLANYPSAFHSVMFNPEPRLLATANSKEGVGLWDIRKPQSRYGGNLSLQSAMSVRFNSNGTQLLALRRRLPPVLYDIHSRLPVFQFDFNSCTMKSCCFAGDRQYILSGSDDFNLYMWRIPANGAFMVLKGHRSVNQVRFNPHTYMICSSGVEKIIKIWSPYK.......... 364
63 -52.600[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  18  111.STPDVPVDCILTTAMNKVKCPVYSVCWSPEGKRLITGCQTGEFTLWNGT----AFNFETILQAHDSAIRALKWASNEQ-WLLSADQGGYVKYWQPNMNNAHMFSHKDEAIRGLAFAPTDVKFATASDDGTARVWDFARYTEERVLGHGAEVRCIDWHPTKGLIATGSRDTPVKIWDPKSGSCLATLQEHKSSVMAVEFNKNGNWLLTGGRDHLVKMYDIRMMKEMRTYRAHKKEVISLAWHPIHELFVSGGGDGSIVYWMVDGEKEIGLLAHDQAIWSMKWHPLGHILATGSNDNNTKFWARNRPGDTVEDIFG 430
64 -52.600[T] KOG1354 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  14  5.GGGNDIQWCFAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSDYLKSLEIEEKINKIRWLPQKNAQFLLSTNDKTIKLWKISEPRRIFANAHTYHINSISINSDYETYLSAD-DLRINLWHLEITDRSNMEELTEVITAAEFHPNSNTFVYSSSKGTIRLCDMRASALCSFFSEIISSISDVKFSHSGRYMMTRD-YLSVKIWDLNMNRPVETYQVHEYDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASREKILHTAWHPKENIIAVATTNN----------LYIFQDKVN 447
65 -52.500[T] COG5170 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  10  7.SLDQWKFAQCFGDKGITEADIISAVEFDHTGDYLATGDKGGRVVLFERNHSKKGCEDYLKSLEIEEKINKIRWCKRTNAHFLLSTNDKTIKLWKLYEKNLKVVAAHAYHINSISVNSDAETYISAD-DLRINLWNLSISDHSNMEELTEVITSAEFHPNCNHLMYSSSKGNIKLLDLRQSASKSFFSEIISSISDVKFSQNGRYILSRD-YLTLKIWDVNEKAPVKTIPLHDVDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLPGDNLDYNKKILHASWHPFEDSVAIAATNN----------LFVFS.... 461
66 -52.400[R] KOG2321 WD40 repeat protein  ali follow..  13  1..........MSLKVQNPNNVRVYTVSGEGVTQRLPNWISKRKLKK---DYALSHRIELLQDFEYPEASNRIKCTRDGKYAMATGVYKPHIKVFDFAEMSLKFERHTDAENVDLKYHYPNCDLYLAAAGDEVYRLNLEQGRFLNPLSPTGGVNVIDINPMHQLLAFGTDAGSVEFWDPRDRSRVGILEDNSRSVTALKYRNDGLNVAIGLSDGATLLYDLRSSSPYMSDQGYSMPIKSLHWMDDGTARVLSADSKIIKIWEKDTGKPFSSIEPTVELNDVCPIEGTGLILTANEGSPMHAFYIPS.......... 355
67 -52.300[S] KOG0281 Beta-TrCP (transducin repeats containing)/Slimb proteins  ali follow..  20  182.IETIESNWRCNLQRIQCRSENSKGVCLQYDDEKIISGLRDNSIKIWDKT----SLECLKVLTGHTGSVLCLQYD---ERVIVTGSSDSTVRVWDVNTGEVLNTLHHNEAVLHLRFSNGL--MVTCSKDRSIAVWDMASATDITLVGHRAAVNVVDF--DDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQY--RDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRF--DNKRIVSGAYDGKIKVWDLQSTLCLRTLVEHSGVFRLQF--DEFQIISSSHDDTILIWDFLNVPPS...... 491
68 -52.300[Z] KOG0313 Microtubule binding protein YTM1 (contains WD40 repeats)  ali follow..  18  120..DKTSRIWSLEIMTIVGHTDVVKDVAWVKKDSLLLSASMDQTILLWEWNVERNKVKALHCCRGHAGSVDSIAVDGSGT-KFCSGSWDKMLKIWSTVPTDEEDEMGHMEAVSSVLWSDAEE-ICSASWDHTIRVWDVGSGSLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDVSLSLTSHTGWVTSVKWSPTHQQLISGSLDNIVKLWDTRSCAPLYDLAAHEDKVLSVDWTDTGL-LLSGGADNKLYSYRYSPTT................................................. 418
69 -52.100[R] KOG2444 WD40 repeat protein  ali follow..  13  4.................EFDNPPLCMKSNKDGSRLVVGFVDGSIRFYDTQQHEEEFQEIWK-FQTKSSIRGVDLDEHKK-RVYAVTKNRSLCVFDIDTGKRVRCICHRSVPTAICTLPKSQQLATADESGEVKTWNLDPEVASKWQEQDEDINDLKVDVKSN-LLATSSDGTLGAYDLRKAKLKMRSELMHSEL--YSVCGTNRSVYVGGEDGYVEVFNLNEYLLERVESGFEMGVNGIVELRSGLLGLTSQGSNRMRLLNVQPSKRLGYAGYHGGIDAITISTDKSTVTMISMSCTIKKWDMGPIID....... 311
70 -51.800[KL] KOG4283 Transcription-coupled repair protein CSA, contains WD40 domain  ali follow..  13  10............................TGRIRSNSFANRFKSRRILSLQ----LSNRKDFVSPHRGSVNSLQVDLTEGRYLLSGAADGSAAVFDVQRATDYEASGLIAKHKCIF-----------------------TVDKQHENGHKYAISSAIWYPDTGLFITGSFDHYLKVWDTNTAQAVVDFKGKVYRTAMSSMAMSHTLIAAGTEDVQVRLCDIASGAFSHTLSGHRDGVMSVEWSTSSEVLYTGGCDGAIRFWDIRRAGCFRVLDQS--QTQLGFRPPILKRTAVGSKVCS................. 254
71 -51.700[I] KOG0301 Phospholipase A2-activating protein (contains WD40 repeats)  ali follow..  14  7.GDVPMETESMPSHVIEAHKSDTKALAVTQGGC-LISGGRDETVKFWAKKGKQYT-KTHAFEQPKGITVNSIAYAEADGWRLFVGRRDGTIAVFGPSQAEPYAIFEHKQNVCCLHINEKATHMLSGSWDSNVIIWPITELNTIVCPGHTLSVWALASFPDLNTYLSASADKTIRMWF--GDTTLSVFKGHTDVVRALVVLSSSH-FLSAGNDGHIIHWDVASASILRKFATQAHEF-IYSMTLSDSHILTTGEDGTLEFWAIDGGKDGNLAIVSTNTWDAKVLLNSD-IAVAGSDGRIYIMTTDKN......... 324
72 -51.100[S] KOG0294 WD40 repeat-containing protein  ali follow..  12  38............KQTFADSSYARSITSLAVQWPWVASGGTDGRIFVYDMR----TRKQSQIILSHAGRVNTLKFTPDLS-LLLSGSDDGHMIATRVGSWTKEYDWHAGQAVTHVSCHPSSKLALSLGGDQVLNTWNLVNGCVAHKTNLDFQTGCLSWSKQGDHFTLSG-PLVLEIWGIENAHVMRRIE-MPSKPICITWL-DGNECLTGLDNGNIAWISLKDEDPPTFILAHEVRVKAIAYL--NEFLATVSIAGQIKVWKIDMETEIARSFMDCRPTDLGLLDLRQFGNVRPVEQRTKVEEKPKA......... 336
73 -50.700[R] KOG2919 Guanine nucleotide-binding protein  ali follow..  15  120.............TSSTEAQHYTKGCYWSPDGTCLLVPVHLDGMHVIEMPSDSLTKLQSEVHVPEGGTVYDCVWYPHMNCLWLATRQHEPIHMWDAFDGSLRCSYDEVMAAISLAFSHDGEQIYAGY-KRCIKIFDTSRGRFCDDYPVKFAISCIAQTTAHPTLTCGNWHGYIQHFDLRCSHPLFTLGGHKGGITQLRYGEFGNLFSGARKCDKILQWDMRNKQPLVELQRHVDTNQRIQFDSDSNWLASGDTRGFVNVWDLKKYGDPSVLPLHSDCNGVALNPAMPILATSSGQFNQKEVLYENAVVMWWCGQT 486
74 -50.200[R] COG2319 FOG: WD40 repeat  ali follow..  16  132..ERDDNVFTYAKLQKSDMTQKCPTMVASEKDNKGKLNEKKNRSPENLLP----FRILDAPELRDDFYTSLLSWSPKGDLAIGL---AENIYLWSKELGPTRVLEESIYDVSSVAYSYNGDILAVGRVDGTLQFWQDNERVPRISIHHPGDIGVLAWKPETNRLLVGKGNGNIFVYDIKAVLVATITNAHDEQVCGLTWNHDGSQFASGGNDNRVCLFKGSDLRQPLYVWQQNAAVKALSFCPWQRSLLAGSHDKHIRFYNCFNGKKIDELYCGAQITSIHWSPKYREFSVTTVQHRFAVYSWPQLECLVSVLPS 455
75 -50.100[DK] KOG0973 Histone transcription regulator HIRA, WD repeat superfamily  ali follow..  16  2..............TFVGHDTGILAIDCHPSGKKFITCGSNGLVVVWNAEPSNENVPKLLFQVESQSQSNSCRWSPDGK-RFAFGSDDSSVSVWEYVGLICCVLRGHSMEVLTVEWSPNGKYLASGSIDYRIIIYNARKLPDRVLNDIQLPVKGLSWDPIGKYLASLEGDKKLRFWATDSWQCVKSVTIEETMLTRLDWSPDGKYLMTPAAVRLIKLIQRQTWKSDQFLAGHHKGTTCVRAMPQLTCAAVGSRDKSISIWVFPGTLKPLFVINNFNHTVMDFAWCGRNLLACSQDGTVKVIHLSES......... 349

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhao Y, Hong DH, Pawlyk B, Yue G, Adamian M, Grynberg M, Godzik A., Li T. The retinitis pigmentosa GTPase regulator (RPGR)- interacting protein: subserving RPGR function and participating in disk morphogenesis. Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3965-70. Epub 2003 Mar 21.