current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [R] KOG1673 Ras GTPases, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MAEKVHEIAGKITPFCRKIVHVNRKWRIIERVSIFGDFFRFLWRKIVSCSSIIEKPILYRRIVHKISSTAGDIFDGDDDTTTEPTVSGRRFGSSSDSDLVSLKISLLGDCQTGKTTFVVKYVGDENQSFLEMTGLNLMDKTFYVQGVTISFSIWDVGGDEKRSKDHIPIACKDAVAILFMFDLTSRSTLNSVFGWYSQARKWNKTAIPILIGTKFDDFVRLPPNLQWTIVTQARAYAKVMNASLFFSSATHNINVNKIFKFILARLFNLPWKIDRNLTLGEPIIDYDSLast
1 -95.400[R] KOG1673 Ras GTPases  ali  100  1MAEKVHEIAGKITPFCRKIVHVNRKWRIIERVSIFGDFFRFLWRKIVSCSSIIEKPILYRRIVHKISSTAGDIFDGDDDTTTEPTVSGRRFGSSSDSDLVSLKISLLGDCQTGKTTFVVKYVGDENQSFLEMTGLNLMDKTFYVQGVTISFSIWDVGGDEKRSKDHIPIACKDAVAILFMFDLTSRSTLNSVFGWYSQARKWNKTAIPILIGTKFDDFVRLPPNLQWTIVTQARAYAKVMNASLFFSSATHNINVNKIFKFILARLFNLPWKIDRNLTLGEPIIDYDS 288
2 -73.400[R] KOG0079 GTP-binding protein H-ray, small G protein superfamily  ali follow..  18  2............................................................................................AGTRDYDHLFKLLIIGDSGVGKSSLLLRFADNTFENYITTIGVDFKIRTMDINGQRVKLQIWDTAGQE-RFRTITSTYYRGTHGVVVVYDVTNGESFGNVKRWLQEIENNCDSVQKVLVGNKCEE-----NERRVVLESDARNYAQSMNISFFETSAKEDKNVEPMFTCITSLVLTAKLANPQSASKDQS...... 186
3 -72.700[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  21  2..................................................................................ASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQE-RYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQAPNIVIALSGNKADL-----ANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTE 203
4 -72.600[U] KOG0097 GTPase Rab14, small G protein superfamily  ali follow..  21  1..........................................................................................MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQE-RFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTPNTVIILIGNKADL-----EAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKP 194
5 -72.600[T] KOG4252 GTP-binding protein  ali follow..  17  1............................................................................................MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQE-EFDAITKAYYRGAQACVLVFSTTDRGSFEAVSSWREKVVAEVGDIPTVLVQNKIDL-----LDDSCIKNEEAEALAKRLRLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDP.......... 181
6 -72.400[U] KOG0087 GTPase Rab11/YPT3, small G protein superfamily  ali follow..  21  2............................................................................................CQEDEYDYLFKTVLIGDSGVGKSNLLMRFTRNEFIESKSTIGVEFATRNIVLDNKKIKAQIWDTAGQE-RYRAITSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREHASNIVIMLVGNKTDL-----LHLRAVSTEEAQAFAAENNLSFIETSAMDASNVEEAFQTVLTEIFRIVSNRSLEAGDDGVHPTAGQ 193
7 -72.400[U] KOG0098 GTPase Rab2, small G protein superfamily  ali follow..  19  2................................................................................................SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFPVHDLTIGVEFGARMVTIDGKQIKLQIWDTAGQE-SFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSSNMVIMLIGNKSDL-----EARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYRKIQEGVFDINNEANGIKLGP 189
8 -72.400[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  22  2................................................................................ASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQE-RYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSDNAQVLLVGNKCDM-----EDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAK... 202
9 -72.200[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  22  2..........................................................................................LETNVDQKSFKFKIVLLGEGCVGKSSLVLRFVENKFCKHLSTIQASFQNKTVNVEDCQADLHIWDTAGQE-KYHALGPIYYRGSNGVLLVFDITDRKSFEKVKNWVLEIKTCLNTAEILIVGNKIDL-----EEERQVTRQDAEAYAESEGALYMETSAQDNVGISDAFESLTAKMIEHSRTRSTEPPSTNRSIRLID 195
10 -72.000[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  22  2.............................................................................................ASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFTTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE-RFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRNERGDVIIVLVGNKTDL-----VEKRQVSIEEGDSKGREYGVMFIETSAKAGFNIKPLFRKIAAALPGMESYSNTKNE.......... 182
11 -71.800[U] KOG0086 GTPase Rab4, small G protein superfamily  ali follow..  22  2..............................................................................................AETYDFLFKFLVIGSAGTGKSCLLHQFIENKFQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQE-RFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLAPNIVVILCGNKKDL-----DPEREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDPERMGSGIQYGD 191
12 -71.600[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  20  1............................................................................................MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPGQGATIGVGFMIKTVEINGEKVKLQIWDTAGQE-RFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYANKVITVLVGNKIDL-----AERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLPGEGK 192
13 -71.300[TU] KOG0078 GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins  ali follow..  23  1............................................................................................MSTKSYDYLIKLLLIGDSGVGKSCLLLRFSEDSFPSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQE-RFRTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQHAENVYKILIGNKCDC-----EDQRQVSFEQGQALADELGVKFLEASAKTNVNVDEAFFTLAREIKKQKIDAENEFSNQANNVDLGN 192
14 -70.700[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  21  2..............................................................................................NPEYDYLFKLLLIGDSGVGKSCLLLRFADDSYDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQE-RFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYAENVNKLLVGNKCDL-----TSQKVVSTETAKAFADELGIPFLETSAKNATNVEEAFMAMTAAIKTRMASQPAGGSKPPTV..... 186
15 -70.600[R] KOG0091 GTPase Rab39, small G protein superfamily  ali follow..  16  1............................................................................................MVEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFELSDPTVGVDFFARLIEMDGTQIKLQLWDTAGQE-RFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIHRPVFALVGCKLDLINA--GGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKSGF 197
16 -70.500[R] KOG0080 GTPase Rab18, small G protein superfamily  ali follow..  18  2..............................................................................................DEDVLTTLKILIIGESGVGKSSLLLRFTDDTFPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQE-RFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCNDIVNMLVGNKIDK------ENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHRE 191
17 -70.000[U] KOG0081 GTPase Rab27, small G protein superfamily  ali follow..  21  1............................................................................................MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFSKFITTVGIDFREKRVVYRGQRIHLQLWDTAGQE-RFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAENPDIVLCGNKSDL-----EDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNG 203
18 -67.900[R] KOG0394 Ras-related GTPase  ali follow..  20  2..............................................................................................PSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQE-RFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQAENFPFVLIGNKVDVD---DGNSRVVSEKKAKAWCASKGIPYFETSAKVGTNVEEAFQCIAKDALKSGEEEELYLPDT........ 190
19 -67.500[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  24  2..........................................................................................SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQE-KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDV-------KERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAP...... 186
20 -62.300[R] KOG0083 GTPase Rab26/Rab37, small G protein superfamily  ali follow..  21  453.....................................................................................ISSSKAPEEEDEFDIMGKVIMLGDSGVGKTSLLIRFRDGRYSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQE-RFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAEDVVIVLIGNKADC----SGSERQVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGK.......... 643
21 -57.300[R] KOG0395 Ras-related GTPase  ali follow..  16  2...................................................................................MKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFDQYTPTIE-DFHRKVYNIRGDMYQLDILDTSGNH-PFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKAELPMVICGNKNDH----GELCRQVPTTEAELLSGDENCAYFEVSAKKNTNVDEMFYVLFSMA...................... 190
22 -44.900[R] KOG0393 Ras-related small GTPase, Rho type  ali follow..  21  3....................................................................................................AIKCVVVGDGAVGKTCLLLSYTTNAFPGEYILTVFDTYSTNVMVDGRPINLSLWDTAGQDD-YDQFRHLSFPQTDVFLVCFALNNPASFENVAKWYPEVSHHCPNTPIILVGTKADLREDRESRLQPVSHTQGYVMAKEIKAKYLECSALTQIGLKQVFDEAIRTGLTPPQTPQTRAKKSNCTV.... 194
23 -43.700[R] COG2229 Predicted GTPase  ali follow..  14  3....................................................................................................ENKIIFTGPVGVGKTTAIAAISDEALRKRNTTVAMDYGAISL---DEDTKVHLYGTPGQE-RFNFMWEILSQGSMGLVLLLDNARTNPLKDLEFFLHSFRGLLEKAPVVVGITKMDI-----RSQPGIDVYHKYLAKHNLNVPVFEIDARKEDDVKQLVSAMLFSI...................... 172
24 -36.700[T] KOG3886 GTP-binding protein  ali follow..  12  1.............................................................MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTATILDRIHSLQINSSLGNLVLNLWDCGGQDT-FTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAEIIEADE 263
25 -31.000[S] KOG4273 Uncharacterized conserved protein  ali follow..  15  6......................................................................................................GVLVVGSSGVGKRTLLSRLLSVEFDSSESSSQTEVHGWTINTKYYTADVSVCISHICD-EYSLPNLPNSHPLVALVMVFDLSELSTLVALQDWVSHTDINSFD-ILLCIGNKVDRVPHHLAHDEKASDPSRDLYSDIDDFGISETEGSSLLGSEDASLDIRGACLE.................... 176
26 -30.600[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  13  6............................................................................................GDSSGSPKPIRIVVVGEKGSGKSSLIMAAARNTFHPNIPSL-LPYTNLPSEFFPDRIPATVIDTSSRPE-DKGKVVKEVRQADAIVLTFAFDRPETLDRLSKWLPLFRQLEVRVPIIVAGYEVDN--KEAYNHFSIEQITSALMKQYREVTSIQWSAQRLDQAKDVLYYAQKAVI..................... 178
27 -28.800[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  15  18.....................................................................................................VRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKS----VQSQGFKLNVWDIGGQRK-IRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELEEKLSCVPVLIFANKQDLLTAAPAS--EIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK................. 182
28 -28.600[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  16  22.....................................................................................................MRILMLGLDAAGKTTILYKLKLNQSVVTIPTVGFNVET----VTYKNIKFNVWDVGGQDK-IRPLWRHYFTGTKGLIFVVDSADSNRISEARQELHRIDREMRDCLLLVLANKQDLPGALSPA--QITDVLQLDKLKDRLWNVQPTCALTGDGLLEGLAWLSQNAKLK................... 184
29 -28.400[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  18  18.....................................................................................................MRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQ----VTYKNLKFQVWDLGGQTS-IRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMEEELAGAILVVLANKQDMDGCMTVA--EVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSRK.................. 181
30 -28.400[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  17  18.....................................................................................................MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVET----VEYKNISFTVWDVGGQDK-IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMEDELRDAVLLVFANKQDLPNAMNAA--EITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA.................. 181
31 -28.400[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  17  17.....................................................................................................LRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKT----LEHRGFKLNIWDVGGQKS-LRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLEERLAGATLLIFANKQDLPGALSSN--AIREALELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD.............. 184
32 -28.200[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  17  18.....................................................................................................YSILILGLDNAGKTTFLETLKKKALEKIQPTVG--QNVATIPVDSKQI-LKFWDVGGQES-LRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVDEEIEGVPILMLANKQDRQDRMEVQDIKEVFNKIAEHISARDSRVLPISALTGEGVKDAIEWMIVRLERNKKSRPPIYK.......... 198
33 -28.100[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  17  19.....................................................................................................LRILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVET----LSYKNLKLNVWDLGGQTS-IRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMEEELQDAALLVFANKQDQPGALSAS--EVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVIKEEQ.................. 182
34 -27.700[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  14  21.....................................................................................................AKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEE----LSIGKIKFKAFDLGGHQI-ARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALDEALATVPFLILGNKIDIPYAASEDETTGKGKVTLGDSGVRPLEVFMCSIVRKMGYGEGFKWLSQYI...................... 192
35 -27.600[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  16  21.....................................................................................................MELTLVGLQFSGKTTFVNVIASGQFEDMIPTVGFNMRK----ITRGNVTIKVWDIGGQP-RFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLKPQLAGIPVLVLGNKRDLPGALDET--GLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQS.................. 185
36 -21.800[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  16  64......................................................................................................RILLMGLRRSGKSSIQKKMSPNETLFLESTNKIC--REDVSNSS-FVNFQIWDFPGQIDFFDPTFEMIFRGTGALIFVIDSQDDEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIEQRANDDLADAGLEKIHLSFYLTSI--DHSIFEAFSKVVQKLIPQLPTLENLLN.......... 249
37 -21.500[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  14  57......................................................................................................TVLLSGLSGSGKTVLFYQLRDGSSQGAVTSMEPNEGTFVLTKKGKVKPVHLIDVPGHS-RLISKLEEYLPRAAAVVFVVDALERAASEYLYDILTNASVIKNKTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKLRHNKVTVAEASGLTG-ETDQVQEFIREHV...................... 258
38 -19.800[R] COG3596 Predicted GTPase  ali follow..  11  40......................................................................................................VIGIMGKTGAGKSSLCNALFAGEVSPVSDVAACTRDPLRFRLQIGEHFMTIVDLPGRDTEYAALYREQLPRLDLILWLIKADDRALATD-EHFYRQVIGEAYRHKMLFVISQSDKAEPTSGGNILSTEQKQNISRKICLLPVCAVSVRLQWGLRVMAERMIKCL...................... 216
39 -18.200[R] KOG2486 Predicted GTPase  ali follow..  11  137......................................................................................................EFALVGRSNVGKSSLLNSLVRRKRLALTSKKP---KTQCINHFRINDKWYLVDLPGLKQDWNKFTKDYFSTLVSVFLLVDASIPVK-LEYASWLGQ-----NQVPMTLIFTKCDKRKKKKNGGKKPEAQDLIQGFFETTPPWIMTSSVTNQGRDEILLHMAQLR...................... 312
40 -18.100[E] COG4917 Ethanolamine utilization protein  ali follow..  11  3......................................................................................................RIAFVGSVGAGKTTLFNALQGNY--LARKTQAVEFNDKGD------------DTPGNHPRWYHALITTLQDVDMLIYVHGANDPESRLP-----AGLLDIGVSKRQIAVISKTDMPDADVAATRKLLLETGFE-------PMFELNSHDPQSVQQLVDYLASLTKQEEAGEKTHHS.......... 158
41 -17.200[R] COG1084 Predicted GTPase  ali follow..  13  164......................................................................................................TVVIAGFPNVGKSTLLRTLTGAE-ADYPFTT-KGIQIGHLERKWK--RIQVIDTPGMNNIELQAMVALENIADVIMFIFDASETCGYTLESQ-LYLGIRSVFDIPVVTVFNKMDL----------AENVKYLEEYINMVEDPLKVSAFEGRGVSKIIKKLEGLYEKETREAHDNV........... 336
42 -15.600[R] COG0218 Predicted GTPase  ali follow..  14  27......................................................................................................EIALAGRSNVGKSSFINTMLNR--KNLARTSGKPGKTQLLNFFNIDDKMRFVDVPGEREKWGCMIEEYLTTREAVVSLVDLRHDPS-VQMYEFLKYY-----EIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPSDDF--ILFSSVSKAGMDEAWDAILEKL...................... 195
43 -15.000[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  12  171.......................................................................................................VLICGYPNVGKSSFMNKVTRADFTTKSLFVGH--------TDYKYLRYQVIDTPGDRNIIEMCSITALA-RAAVLFFLDISGSYTIAQQAALFHSIKSLFMNKPLVIVCNKTDLMPMENISEEDRKLIEETAMGASEEQVLLKMSTLTDEGVMSVKNAACERLLDQRVEAKMKSKKINDHLN... 368
44 -14.700[J] KOG1191 Mitochondrial GTPase  ali follow..  17  354.....................................................................................................LQIAIVGRPNVGKSSLLNAWSKSERAIVTEVAGTDVVEANVTVRG--VPITLLDTAG-EKIGVERSETAAKVADVIIMAVSAVEGWTEEDTE---LFGGLLYLKQPMILVMNKIDCAPPGSCDQLEDQRKK-----EEVFHKSVFTSAVTGQGIEELEDAILEIL...................... 533
45 -14.600[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  16  312.............................................................................TNLIRNPRFSKPGRNGLEQHFLFELKSILIGLPNAGKSTILNKISNAKFTTLSPTIGT------VSLGFGQDVFTVADIPG-ASLDKGMGLEFLRHSNGWVFVLDLSNKNPLNDLQLLIEEVGTLEKTKNILIVCNKVDIDA--EKSESFAKYLQVEKFSKSQEWDCVPISALREKT.................................. 499
46 -14.100[R] COG0486 Predicted GTPase  ali follow..  14  228.....................................................................................................MKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTDVLREHIHIDG--MPLHIIDTAG-ERIGIVRAWSEIEQADRILLMLDSTEADNQDLEKVRSEFLTKLPSNIPVTIVRNKADL------------SGENEGIVEQNGYTVITLSAKTQQGIALLREHLKQSM...................... 387
47 -14.100[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  15  95.......................................................................................................ILLVGQYSTGKTTFIRYLLESDFPRALSGFGNAFLNRCSTLPNQVLEVTIVDTPGRIDRFTGVLEWFAERVDRIILLFDAHKLDISDEFKRCIEALAGNEDKIRIVL--NKSDMV-------------DHQQLMRVYGALMWSLGVFKTPEVSRVYL............................ 288
48 -13.800[R] COG1160 Predicted GTPases  ali follow..  17  5......................................................................................................VVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKYGHAHIAGYDFIVIDTGG-EEKMAEQSLLAIDEADIVLFLVD--ARAGLTAADIGIANYLRQRQNKITVVVANKTDGIDA---------DSHCAEFYQLGLGEIEQIAASQGRGVTQLMEQVLAPFAEKMENADEN............ 174
49 -13.800[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  14  44......................................................................................................NFGIVAHVDHGKSTLADRLLEGAVPPGQKQMGITVKAQTAALRHRGYLLNLIDTPGHVD-FSAEVSRSLAVCDGILLLVAANQGVQAQTIANFWLAFEK---NIQIIPVINKIDL----PGADIKSVETQLKNLFEFNPEECLHISAKSGLNVDKVLEAIIDRV...................... 211
50 -13.200[M] COG0481 Membrane GTPase LepA  ali follow..  11  6......................................................................................................NFSIIAHIDHGKSTLSDRLIQ-DSMDLERERGITIKAQSVTLDGETYQLNFIDTPGHVD-FSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAIEM---NLEVVPILNKIDL----PAADPERVAEEIEDIVGIDAMEAVRCSAKTGVGIEDVLEEIVHKI...................... 180
51 -12.900[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  14  76.....................................................................................................MKVAFFGRTSSGKSSVINAMLWDKVSGIGHITNCDGDKAYLMTEGSDEKLVLVDSPGVTTELDSWIDKFCLDADVFVLVANSESTLMNTE-KHFFHKVNEWLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHEAQNRIFFVSAKEVLSARK............................... 293
52 -12.900[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  12  4....................................................................................................PLIIGVGGPVGAGKTMLIERLTR-YLSTKGYSMAAITNDIYTKEDARILLLLFLESGGD-----LSATFSPDLVDFSIYIIDVAQGEKIPRKGGQGMIKSD-------LFIINKVDLAPYVGANVEVMKADTLKS---RGNKDFFVTNLKTDEGLKSVADWIEKRL...................... 199
53 -11.900[R] KOG0410 Predicted GTP binding protein  ali follow..  11  311......................................................................................................VVSLVGYTNAGKSTLLNQLTGAN-NRLFATL--DPTTRRVQMQNGK-EFLLTDTVGFIQKLPTTLVAAFRASSLLVHVVDISHPLAEQQIEAVEKVMSELDSSIPKLVVWNKVDR----------VDDPQKVKLEAEETGDTICISALTGEGLDDFCNAVHEKLKD.................... 474
54 -11.700[J] KOG0458 Elongation factor 1 alpha  ali follow..  14  67LESTLAELKKTLKKKKTPKKPIAAANGSANVTQKLANISISQQRPNDRLPDWLDEEESEGERNGEEANDEKTVQRYYKTTVPTKPKKPHDISAFVKSALPHLSFVVLGHVDAGKSTLMGRLLYDLNIVNQSQLGVTVSICTSHFSTHRANFTIVDAPGHRDFVPNAIMGISQADMAILCV---CSTNAFESGFDLDGQTKEHM----LIIAMNKMDN-VDWSQQRFEEIKSKLLPYLVDIGINWVPISGFSGEGVYK............................... 361
55 -11.600[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  14  42.....................................................................................................INIGTIGHVAHGKSTVVKRFKNELERNITIKLGYANAPECYRSCGSSMPDEFVDCPGHDILMATMLNGA-AVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQ-NKIDLVKERQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKI...................... 243
56 -11.500[P] COG0370 Fe2+ transport system protein B  ali follow..  14  4.....................................................................................................NTYCILGNPNTGKTSLFNALTGSY-EYVGNWSGVTVEKKVGTLRSKTG--KLIDLPGDETVVTRFL----EKFDCMLNIVDSSQIERNLNLTVQLLEY-----GAPVVMGLNMIDVAAGRGIHL------NIQNLAKKLRIPILPVVARSGKGTEDILSTLSEKH...................... 161
57 -11.500[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  17  20.............................................................................................IAQQHKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCELAILLI---ARKGVLDQTRRHSFISTLLGIKHLVVAI-NKMDL-VDYSEETFTRIREDYLTFAGQLPIRFVPLSALEGDNVAS............................... 215
58 -11.200[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  15  7......................................................................................................NIAIIAHVDHGKTTLVDKLLK-DSNDQEKERGITILAKNTAIKWNGYNINIVDTPGH---FGGEVERVMSMVDSVLLVVDAQDGPMPQTRFVTQKAFKA---GLRPIVVVNKIDRPGARPDWVIDQIFDLFDNLGATLDFPIVYASALNGI................................... 171
59 -11.100[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  11  7...................................................................................................FVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEIALQYS--DYDKIALGHAQYIDFAVKYANKVAF-IDAFCKKYEGREHPFVQALIDEYRFDLVILLENNTGLRSLGSSVDRKEFQNLLVEMLEENNIEFVRVEEEDDSRFLRCVELVREMMGEQR.................. 187
60 -11.000[J] KOG0459 Polypeptide release factor 3  ali follow..  16  102.....................................................................................................LNVVFIGHVDAGKSTIGGQILFLSGQVDDRQIGKTVEVGRAHFETESTRFTILDAPGHKSYVPNMISGASQADIGVLVI---ARKGEFETGYERGGQTREHV----LIVVVNKMDDTVNWSKERYDEIEQKMVPFLKASGVVFLPISGLMGKNMDQ............................... 298
61 -11.000[R] COG1159 GTPase  ali follow..  14  11.......................................................................................................IAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGPYQAIYVDTPG-NRLMNKAASSSIGDVELVIFVVEGTRWTPDDEM---LNKLRDGKAPVILAV--NKVDNVQEKVDLLPHLQFLASQMNFLD----IVPISAETGMNVDTIAGIVRKHL...................... 173
62 -10.800[R] COG0536 Predicted GTPase  ali follow..  12  131............................................................................ASKARKAPGFALIGEPGEAHDLILELKSMLVGFPSAGKSSLISKIGDYPFTTLQPNLGV--------VNVGHETFTMADVPG-ASEGKGLGLDFLRHTSVLVHVVDTATRDPISDIEALEAELAAYQSALDRLVVLNKADV-----PEAEELAEFLKEDIEKQFGWPVFIISAVARKGLDPLKYKLLEIVQDARKKRPKEKAESV....... 355
63 -10.700[J] KOG0469 Elongation factor 2  ali follow..  21......................................................................................................NMSVIAHVDHGKSTLTDSLVSKATRKDEQERCITIKSTAISLKYNGFLINLIDSPGH---FSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAE---RIKPVLFMNKMDRALLELQLGAEELFQTFQRIVENINVIIATYGDDDGPMGPIMVDPSIGNVG..................... 224
64 -10.600[R] COG1163 Predicted GTPase  ali follow..  11  67......................................................................................................SVGFVGFPSVGKSTLLSKLTGTEFTTLVTVPGV--------IRYKGAKIQMLDLPGDGRGRGKQVIAVARTCNLLFIILDVNKPHHKQIIEKELEGVGIRLNKTPPDILIKKKEISITNTVPLTHLGNDEIRAVMSEYRINSAEIAFRCDATVDDLIDVLEAS....................... 238
65 -10.400[R] COG3911 Predicted ATPase  ali follow..  15  8......................................................................................................VFVLTGGPGSGKTTLI-AALRRAGFATSVVAGRGIVRDQSSIGGTALPWSDRTLFAELMLSWEMRSYQNAVEQKGPVFFDRGVPETLLPVADHVSTAAKRFRYNPRVFI--AQDEERKQTPDEAKCTYHALAEIYTELGYELVPLPLA---PVETRLRFVLADA...................... 180
66 -10.400[F] COG1618 Predicted nucleotide kinase  ali follow..  13  2............................................................................................RIEGKEKTMLRIAVTGSPGVGKSTVVAKTAEKLAEKPGFKIG-GIRTAEIRKEGHREGFSIRDLATGKTGILSHANAVRNALACDLVVIDEIGPMELIS-QSFVSAVEEVLESDKPVLAVLHHSSRHPLAQRFRK-------------GFEVLTVDKGNRDELPEKITNRFLRKLG.................... 184
67 -10.400[R] COG2262 GTPases  ali follow..  15  199......................................................................................................TVSLVGYTNAGKSTLFNRITERVYAADQLFATLDPTLRRIDVADVG-ETVLADTVGFIRHLPHDLVAAFKAATLLLHVIDAADVRVQENIEAVNTVLEEIDHEIPTLLVMNKIDMLEDFEPRIDRDEENKPIR---------VWLSAQTGAGIPQLFQALTERLSG.................... 363
68 -10.300[DTZ] KOG1547 Septin CDC10 and related P-loop GTPases  ali follow..  10  279...................................................................................................FEFNIMVVGQSGLGKSTLINTLFKSKIERIPKTIEIKSITHDIEEKGVRMKLTVIDTPG-NDQYEKYLKKRIPDTRVHCCLYFIPTGHSLRPLD--IEFMKRLSKVVNIVPVIAKAD---TLTLEERVHFKQRITADLLSNGIDVYSEDRLVNEKFREMFAVVGSD....................... 485
69 -10.300[R] KOG2203 GTP-binding protein  ali follow..  10  43.......................................................................................................VAIMGPQSSGKSTLLNHLFKTSFREMDAFAGRSQTTKGIWMARCVGITIAMDLEGTDGRERGEDDTTFEKQSAAIAVADIV-------INMWCHDIGREQAANKPLL---------------KTVFQVMLRLFSPRKTTLLFVIRDKTKTPIELLERALREDIQKIWDSVRKPEAHKNTPLN... 208
70 -10.300[J] KOG0468 U5 snRNP-specific protein  ali follow..  15  133......................................................................................................NVALVGHLHHGKTTFVDCLIRQTTLFTEQERGCSIKATPVTLKQKSYLLNIFDTPGH---FSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQE---RQAITVCINKID---RLILELKLPPQDAYFKLKHIVEEVNGLLSTYGAPDDNLLVSPILGNV...................... 310
71 -10.200[J] KOG0052 Translation elongation factor EF-1 alpha/Tu  ali follow..  14  8.....................................................................................................INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVV---CGTGEFEAGISKNGQTREHA----LIVACNKMDSTEPFSEARFTEITNEVSGFIKKIGVPFVPISGFNGDNMLE............................... 203
72 -10.200[DZ] COG5019 Septin family protein  ali follow..  13  94...................................................................................................FNFNVLVLGESGSGKSTLVNTLLNRDVVNPEPTVMINSSAVEIVENGISLQLNVIDTPG-EGRYDQYLRSTIQDPRVHACIFFIQTGHAISAME--LRVMLALHEKVNIIPIIAKAD---TLTDDELNFTKEMILRDIQYHNIRIFFPPTYETDDPES............................... 284
73 -10.100[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  15  7.....................................................................................................INIGLVGHVDHGKTTLTKALSGVWTDTHSESIRLGYADITFTETELLRKVSFVDAPGHETLMATMLSGA-ALMDGAILVIAANEPCPQPQTKEHLMALDVIGVKDVIVVQ-NKIDIVSKERALESYREIKEFVKGTCAEDAPIIPVSAQQGANIDILIETIEERI...................... 197
74 -9.950[R] COG4639 Predicted kinase  ali follow..  11  11.......................................................................................................VVLIGASGAGKSTFARKHFQP----------------FEVISSDFCRGLVSNDENSQSASRDAFDVLHYITTKRLTVIDATNVQP-EDRKTLLQMAKQYHCFTVAIVFDLPEELCHE-----RNQQRSDRQFGSHVVRRHTQMLRRSLRSLEKEGFRYVYT........................ 154
75 -9.920[J] COG5256 Translation elongation factor EF-1alpha (GTPase)  ali follow..  16  2............................................................................................KIMASQKPHLNLITIGHVDHGKSTLVGRLLYEHGEIPAHIIGVTIDLAHRKFETDKYYFTLIDAPGHRDFVKNMITGTSQADAAILVISAREGEGVMEQTREHAFLARTLGVPQMVVAI-NKMDATPPYSEKRYNEVKADAEKLLRSIGISFVPISGYKGDNVTK............................... 199

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 8 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;