current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [R] KOG2486 Predicted GTPase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MILAHLPRFHLSILAKPSFSLSSSHFSFLNPKPSVTVSRTLFSFASKSNLATVEPIPLSVSDSTDLDDAPVEIALDKLFIPPETDISGEDSASLTTRILKGSNIVLSKYARDAQVVQADYVKSSVKTEDCPADGLPEFALVGRSNVGKSSLLNSLVRRKRLALTSKKPGKTQCINHFRINDKWYLVDLPGYGYASAPHELKQDWNKFTKDYFLNRSTLVSVFLLVDASIPVKPIDLEYASWLGQNQVPMTLIFTKCDKRKKKKNGGKKPEANIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEILLHMAQLRNYWLKHLast
1 -106.000[R] KOG2486 Predicted GTPase  ali  100  1MILAHLPRFHLSILAKPSFSLSSSHFSFLNPKPSVTVSRTLFSFASKSNLATVEPIPLSVSDSTDLDDAPVEIALDKLFIPPETDISGEDSASLTTRILKGSNIVLSKYARDAQVVQADYVKSSVKTEDCPADGLPEFALVGRSNVGKSSLLNSLVRRKRLALTSKKPGKTQCINHFRINDKWYLVDLPGYGYASAPHELKQDWNKFTKDYFLNRSTLVSVFLLVDASIPVKPIDLEYASWLGQNQVPMTLIFTKCDKRKKKKNGGKKPEANIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH 318
2 -78.500[R] COG0218 Predicted GTPase  ali follow..  35  2...............................................................................................................ELNTHNAEILLSAANKSHYPQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDDKMRFVDVPGYGYARVSKKEREKWGCMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEFLKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFD-------PSDDFILFSSVSKAGMDEAWDAILEKL...... 195
3 -44.000[R] COG1160 Predicted GTPases  ali follow..  12  66......EGVEEKMAEQSLLAIDEADIVLFLVDARAGLTAADIGIANYLRQRQNKITVVVANKTDGIDADSHCAEFYQLGLGEIEQIAASQGRGVTQLMEQVLAPFAEKMENADENDRTSEEEQDEWEQEFDQDKNIKIAIVGRPNVGKSTLTNRILGEDRVVVFDMPGTTRDSIYMERDGQQYTLIDTAGVRKRGKVHLAVEKFS--VIKTLQAIQDANVVLLTIDARENISDQDLSLLGFILNAGRSLVIVVNKWDGLDQDVKDRVKSELDRR-------LDFIDFARVHFISALHGSGVGNLFDSIKEAYACATQK 391
4 -41.200[R] COG3596 Predicted GTPase  ali follow..  20  39.......................................................................................................................................PVIGIMGKTGAGKSSLCNALFAGE-VSPVSDVAACTRDPLRFRLEHFMTIVDLPGVG------ESGVRDTEYAALYREQLPRLDLILWLIKADDRALATDEHFYRQVEAYRHKMLFVISQSDKAEPTSGGSTEQKQNISRKICLLHELFQPVHPVCAVSVRLQWGLRVMAERMIKCLPREPSS 222
5 -36.600[R] COG1084 Predicted GTPase  ali follow..  15  94................................................LNWAVGILNQLESDYMARIKRSKPSDASHLRREAFGRISSVIKRIEGDLDFLDFAKNKLRNMPTV------------------DLDAFTVVIAGFPNVGKSTLLRTLTGAE--PEVADYPFTTKGIQIGHLWKRIQVIDTPGL------DRPVEDMNNIELQAMVALENIDVIMFIFDASETCGYTLESQYSLYLGFDIPVVTVFNKMDLAENVKYLEEYINM---------------VEDPLKVSAFEGRGVSKIIKKLEGLYEKETRE 331
6 -33.200[E] COG4917 Ethanolamine utilization protein  ali follow..  17  1......................................................................................................................................MKRIAFVGSVGAGKTTLFNALQGNYTLAR------KTQAVEFNDKG----DIDTPGEYFNH---------PRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLD--IGVSKRQIAVISKTDMPDADVAATRKLLLET------------FEEPMFELNSHDPQSVQQLVDYLASLTKQEEAG 152
7 -31.700[R] COG1159 GTPase  ali follow..  22  11.........................................................................................................................................IAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRI-HTEGPYQAIYVDTPGL-----MEEKRAINRLMNKAASSSIGDVELVIFVVEGTRW-TPDDEMVLNKLRDGKAPVILAVNKVDNVQEKVDLLPHLQFLASQM---------NFLDIVPISAETGMNVDTIAGIVRKHLPE.... 175
8 -27.100[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  13  157.............................................................................................................................HMARLPDPNTRTVLICGYPNVGKSSFMNKVTRAD--VDVQPYAFTTKSLFVGHTDLRYQVIDTPGI---DRPFEDRNIIEMCSITALAHLRAAVLFFLDISGSCGYTIAQQALFHSIKSMNKPLVIVCNKTDLMPMENISEEDRKEEMKSEAMKTAMGASEEQVLLKMSTLTDEGVMSVKNAACERLLDQRVE 355
9 -27.000[P] COG0370 Fe2+ transport system protein B  ali follow..  18  5........................................................................................................................................TYCILGNPNTGKTSLFNALTGSYE--YVGNWSGVTEKKVGTLRSKTGKLIDLPGYDLNPISRDET-----VVTRFLLE-EKFDCMLNIVDSSQ--IERNLNLTVQLLEYGAPVVMGLNMIDVAAGRGI-----HLNIQNLAKKLR-------PILPVVARSGKGTEDILSTLSEKHVA.... 163
10 -24.900[R] COG0486 Predicted GTPase  ali follow..  19  229........................................................................................................................................KVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLR----GMPLHIIDTAGLREATDEVERI------IVRAWSEIEQADRILLMLDSTEADNQDLEKVRSEFLTSNIPVTIVRNKADLSGENEGIVEQNGY-----------------TVITLSAKTQQGIALLREHLKQSMGY.... 389
11 -23.900[J] KOG1191 Mitochondrial GTPase  ali follow..  18  334..................................................................................................................SQDVESALDTANYDKLLQSGL-QIAIVGRPNVGKSSLLNAWSKSERAIVTEVAGTTRDVVE----GVPITLLDTAGI---RETNDIVEKIG--VERSETAAKVADVIIMAVSAVEGWTEEDTELLRKIQSLKQPMILVMNKIDCAPPGSCDQLEDQRKKEEVFH----------KSVFTSAVTGQGIEELEDAILEILG..... 534
12 -22.200[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  18  22........................................................................................................................................KILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKI--KFKAFDLGG------HQIARRVWKDYY-------AKVDAVVYLVDAKERFAESKRELDALLSDATVPFLILGNKIDIPYAASEDELRYHLGLTNFTTGKGKVTLGDSEVFMCSIVRKMGYGEGFKWLSQYIN..... 193
13 -22.100[R] COG2262 GTPases  ali follow..  18  194...................................................................................................................................KADVPTVSLVGYTNAGKSTLFNRITEARVYAADATLDPTLRRIDV---VGETVLADTVGF-IRHLPHDLVAAFKATLQE----TRQATLLLHVIDAADVRVQENIEVLEEIDAHEIPTLLVMNKIDMLEDFEPRIDRDEEN--------------KPIRVWLSAQTGAGIPQLFQALTERLSG.... 363
14 -21.600[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  17  19........................................................................................................................................RILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQS---GFKLNVWDIGG------QRKIRPYWKNYF-------ENTDILIYVIDSRKRFEETGQELAELLEESCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDR---------QIQSCSALTGEGVQDGMNWVCKNVNAKKK. 182
15 -21.500[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  11  28.........................................................................................................................LTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGERNITICPRPECYRSCGSSMPDERHVSFVDCPGH-------------DILMATMLNGAAVMDAALLLIAGNESPQPQTSEHLAAIEIMKLKILILQNKIDLVKER-----QAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRD 249
16 -20.800[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  18  22........................................................................................................................................ELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGNMRKITR---NVTIKVWDIGG----------QPRFRSMWERYC---RGVNAIVYMVDALDKLEASRNELHSLLDKAGIPVLVLGNKRDLPGALDETGLIERMNLSSIQDR---------CCYSISCKEKDNIDITLQWLIQHSKSQSR. 186
17 -20.700[R] KOG0410 Predicted GTP binding protein  ali follow..  21  306...................................................................................................................................AIPVPVVSLVGYTNAGKSTLLNQLTGANVLAENATLDPTTRRVQM---GKEFLLTDTVGF-IQKLPTTLVAAFRATLEE----IAESSLLVHVVDISHPLAEQQIEVMSELDVSSIPKLVVWNKVDRVDDPQKVKLEAEET---------------GDTICISALTGEGLDDFCNAVHEKLKD.... 474
18 -20.500[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  13  52...................................................................................................................................RTKSNTVLLSGLSGSGKTVLFYQLRDGSSHQGAVTSMEPNEGT-----VKPVHLIDVPGH-------------SRLISKLEEYLPRAAAVVFVVDALPNIRAASEYLYDILIKNKTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKEVFSFSHCHNKVTVAEASGLTGETDQVQEFIREHVK..... 259
19 -20.500[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  13  18........................................................................................................................................RLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEH---GFKLNIWDVGG------QKSLRSYWRNYF-------ESTDGLIWVVDSRQRMQDCQRELQSLLVEAGATLLIFANKQDLPGALSSNAIREALELDSIRSH---------CIQGCSAVTGENLLPGIDWLLDDISS.... 178
20 -20.500[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  14  23........................................................................................................................................RILMLGLDAAGKTTILYKLKLNQSVVTIPTVGFNVETVTYKNI--KFNVWDVGG----------QDKIRPLWRHYF---TGTKGLIFVVDSSNRISEARQELHRIISDRDCLLLVLANKQDLPGALSPAQITDVLQLDKLKDR---------NVQPTCALTGDGLLEGLAWLSQNAKL.... 183
21 -20.300[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  12  19........................................................................................................................................RILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNL--KFQVWDLGG----------QTSIRPYWRCYY---SNTDAIIYVVDSRDRIGISKDELLYMLREAGAILVVLANKQDMDGCMTVAEVHHALGLENLKNR---------QIFKTSATKGEGLDQAMDWLSNTLQSRK.. 181
22 -20.200[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  15  20........................................................................................................................................RILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKNL--KLNVWDLGG----------QTSIRPYWRCYY---ADTAAVIFVVDSKDRMSTASKELHLMLQEQDAALLVFANKQDQPGALSASEVSKELNLVELKDR---------SIVASSAIKGEGITEGLDWLIDVIKE.... 180
23 -20.200[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  13  19........................................................................................................................................RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNI--SFTVWDVGG----------QDKIRPLWRHYF---QNTQGLIFVVDSRDRVVEARDELHRMLNERDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQR---------YIQSTCATSGEGLYEGLDWLSNNIAS.... 179
24 -19.900[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  16  19........................................................................................................................................SILILGLDNAGKTTFLETLKKEKALEKIQPTVGQNVATIPVDSKQILKFWDVGG------QESLRSMWSEYY-------SLCHGIIFIVDSRERLDECSTTLQSVVMDEGVPILMLANKQDRQDRMEVQDIKEVFNKIAEHISARDS-----RVLPISALTGEGVKDAIEWMIVRLERNKKS 192
25 -19.900[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  17  9.........................................................................................................................................IGLVGHVDHGKTTLTKALSGWTDTHSEETKRGISIRLGYADITRKVSFVDAPGH-------------ETLMATMLSGAALMDGAILVIAANEPPQPQTKEHLMALDVIGVKVIVVQNKIDIVSKERA-----LESYREIKEFVKGTCAEDAPIIPVSAQQGANIDILIETIEERIKTPKRD 203
26 -19.400[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  12  55...............................................................................................................................DPFSTEVKPRILLMGLRRSGKSSIQKVVFHKNETLFLESTNKICREDVSNSSFVNFQIWDFPG----------QIDFFDPTFDYEMIFRGTGALIFVIDSQDDYMEALARLHLTVTRADINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKIHLSFYLTSIYDHSIFEAFSKVVQKL...... 237
27 -19.200[R] COG5258 GTPase  ali follow..  18  109........................................................................................................................................TVVALGNVDAGKSTLVGVLTTRSYASRHEVLTGRTSAVSLRLLDKLVLLVDVGGH-------------ERYLRTALRGLSQPDYVMLVVAANSGVQKMTKEHLGIAVAIGIPVFVVVTRIDITPSEVFQKTVEEVVRDVVLAAKAMPAGRVAPVFYVSSVTGHGLDLLLRFLSLLPRRRRWD 334
28 -19.100[R] KOG2485 Conserved ATP/GTP binding protein  ali follow..  13  30......PGHMAAATRAIRNRLKLSDLVIEVRDARI---PLSSANEDLQSQMSAKRRIIALNKKDLANPNVLNVIRFFK---------------TRHFESSKQDCIAINAHSRSSVMKLLDLVELKLKEVIAREPTLLVMVVGVPNVGKSALINSIHQRLKRATVGPLPGVTQDIAGFKIAHRIYVLDSPGVLVPSIPDIETG--GSVKDSVVGEERIAQYFLAILNIR.......................................................................................... 250
29 -19.100[R] COG2229 Predicted GTPase  ali follow..  14  5........................................................................................................................................KIIFTGPVGVGKTTAIAAISDEALVMTLDRKRNTTVAMDYGAIDTKVHLYGTPG----------QERFNFMWEILS---QGSMGLVLLLDNARTNPLKD--LEFFLHSEKAPVVVGITKMDIRSQPGIDVYHKYLAKHNLN-----------PVFEIDARKEDDVKQLVSAMLFSIDPGLE. 177
30 -19.000[J] KOG0460 Mitochondrial translation elongation factor Tu  ali follow..  16  56.........................................................................................................................................IGTIGHVDHGKTTLTAAITK--DKAPEEKARGITISSAHVEYNRHYAHVDCPGH-------------ADYIKNMITGAATMDGAIIVVSATDGQMPQTREHLLLARQVGVKIVVYINKVDMVEPD-----MIELVEMEMRELLSEYGFDGDNTPIVSGSALCALEGREPEI.......... 226
31 -18.800[R] COG1163 Predicted GTPase  ali follow..  21  59................................................................................................................................DVARTGVASVGFVGFPSVGKSTLLSKLTGTE--SEAAEYEFTTLVIRY---GAKIQMLDLPGI-------DGAKDGRGRGKQVIAVARTCNLLFIILDVNKPLHHKQIIEKELIRLNKTPPDILIKKKEK............................................................ 187
32 -18.800[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  14  339......................................................................................................................................IADLGLIGLPNAGKSTILNKISNAKPKI-TTLSP-TIGTVSLGFGQDVFTVADIPGI-------QGASLDKGMGLEFLRHIERSNGWVFVLDLSNDLQLLIEEVGTLEKVKTKNILIVCNKVD-IDAEKSESFAKYLQVEKFSKSQEW------DCVPISALREKT.................. 499
33 -18.800[R] COG0536 Predicted GTPase  ali follow..  17  89.............................................................................LEVPPGTVVLNEKGETLADLTSVGMKFIAAAGGN-----NAALASKARKAPGFALIGMADVGLVGFPSAGKSSLISVMSAAK--PKIGDYPFTTLQPNLGVVNETFTMADVPGL-------PGASEGKGLGLDFLRHIERTSVLVHVVDTEAELAAYQSALDELGDLSQRPRLVVLNKADVPEAEELAEFLKEDIEKQFGW----------PVFIISAVARKGLDPLKYKLLEIVQDARKK 346
34 -18.700[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  11  59......................................................................................................................GYKDKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDK-VLPSGIGHITNCLVRVFWLRDDLVLVDSPGTD-------VTTELDSWIDKFC---LDADVFVLVANSESTLMNTEKHFFHKVNEWL--IFILNNRWDASASEPEYRQHMERCLHFLVEELKVANALEAQIFFVSAKEV.................... 288
35 -18.600[M] COG0481 Membrane GTPase LepA  ali follow..  13  2....................................................................................................................................KNIRNFSIIAHIDHGKSTLSDRLIQTCGGL--SDREMEAQVLDSMDLERELNFIDTPGH----------VDFSYEVSRSLAA---CEGALLVVDAGQGVEAQTLANCYTAIEMNLEVVPILNKIDLPAAD-----------RVAEEIEDIVGIDAMEAVRCSAKTGVGIEDVLEEIVHKI...... 180
36 -18.600[T] KOG1487 GTP-binding protein DRG1 (ODN superfamily)  ali follow..  23  58................................................................................................................................DVAKTGDARIGFVGFPSVGKSTLLSNLAGVY--SEVAAYEFTTLTIRY---GAKIQLLDLPGI-------EGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELIRLNSKPPNIGFKKKDK............................................................ 186
37 -18.600[R] KOG0395 Ras-related GTPase  ali follow..  12  2.....................................................................................................................MKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPT--HRKVYNIRGDMYQLDILDTSG----------NHPFPAMRRLSILTGDVF-ILVFSLDNRESFDEVKRLQKQILEVKSLPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAY--------FEVSAKKNTNVDEMFYVLFSMAKLPHEM 196
38 -18.500[J] COG0050 GTPases - translation elongation factors  ali follow..  16  15.........................................................................................................................................VGTIGHVDHGKTTLTAAITTQIDNAPEEKARGITINTSHVEYARHYAHVDCPGH-------------ADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFMNKCDMVDDEEL----LELVEMEVRELLSAYDFPGDDLPVVRGSALKALEGEAEWEAKIIE..... 191
39 -18.400[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  15  29.........................................................................................................................TKLVNLSEFTPDKIRNFGIVAHVDHGKSTLADRLLEMCGAVPVERERGITQTAALRHRGYLLNLIDTPGH----------VDFSAEVSRSLAV---CDGILLLVAANQGVQAQTIANFWLAFEKNIQIIPVINKIDLPGAD-----------SVETQLKNLFEFNPEECLHISAKSGLNVDKVLEAIIDRV...... 211
40 -18.200[R] KOG1673 Ras GTPases  ali follow..  11  103........................................................................................................................................KISLLGDCQTGKTTFVVKYVGDENQSFLEMTG-MDKTFYVQGVTISFSIWDVGG---------DEKRSKDHIPIAC---KDAVAILFMFDLTSRST---NSVFGWYSQKTAIPILIGTKFDDFVRLPPNLQWTIV-----TQARAYAKVMNASLFFSSATHNINVNKIFKFILARL...... 266
41 -18.100[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  15  14........................................................................................................................................KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFKFDVWDTAG----------QEKFGGLRDGYYIN---AQCAIIMFDVTSRIT---KNVPNWHRDENIPIVLCGNKVDVKERKVKAKTITFHRKKNL------------QYYDISAKSNYNFEKPFLWLARKL...... 170
42 -18.000[T] KOG1486 GTP-binding protein DRG2 (ODN superfamily)  ali follow..  15  29...............................................................................................................QLKAKIAKLRTQLLEPPEVTKYGHGRVALIGFPSVGKSTLLTMLTGTH--SEAASYEFTTLTIHY---DTKIQLLDLPGI-------EGASEGKGRGRQVIAVAKSSDLVLMVLDASKSEGHRQILTKELLRLNKTPPQIYFKKKKTGGISFNTTAPLTHIDEKLCYQI---------LHEYKIHNAEVLFRENATVDDFIDVIEGN 235
43 -18.000[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  13  3.........................................NFFRTVPRANRNEITFYPDYEEEGQKKKKTRSMFSWLGGDSSKKKNKEVLETVSEGLRKIYKQKLLPLEEFHKFHDF----HSPALDDPDFDAKPMILLVGQYSTGKTTFIRYLLESDFPGIRIGPEPTTDRFIAVMHGESVTIVDTPGILSGEKQRIDRGDFTGVLEWFA---ERVDRIILLFDAKLDISDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQLMR.................................................... 265
44 -18.000[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  7.........................................................................................................................................IGVGGPVGAGKTMLIERLTRYYSMAAITNDIYTKEEMCDKHPDLQLLFLESGGDNLSATFSPDLV----------------DFSIYIIDVAQG-EKIPRKGGQGMIKSD---LFIINKVDLAPYVGANVEVMKADTLKSRGNK--------DFFVTNLKTDEGLKSVADWIEKRLQLALLE 205
45 -18.000[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  22  181.......................................................................................................................................PVVTIMGHVDHGKTTLLDKF--RKTQVAAVETGGITQHIGAFLVGEKITFLDTPGH-------------AAFSAMRARGAQVTDIVVLVVAADDGVMKQTVESIQHAKDAQVPIILAVNKCDKAEADPEKVKKELLAYDVVCEDYG----GDVQAVPVSALTGDNLMALAEATVALAE..... 343
46 -17.800[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  18  22........................................................................................................................................KLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGLTQTVCLDDTTVKFEIWDTAG----------QERYHSLAPMYYRG---AQAAIVVYDITNEES---ARAKNWVKEPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLF----------METSAKTSMNVNEIFMAIAKKLPKNEPQ 187
47 -17.700[J] COG3276 Selenocysteine-specific translation elongation factor  ali follow..  22  3.........................................................................................................................................IVTSGHVDHGKTALLKALTGSTAHLPEEKKRGMTIDLGYAYLNKVLGFIDVPGH-------------EKFLSNMLAGLGGVHYAMLIVAADEGVAVQTKEHLAILRQLQFH-IVVITKADRTNSAQI--ESLIQTIKQDYSFLRN-----ANYFVTSAETGQGISELRHYLANLAELADTQ 168
48 -17.700[T] KOG4252 GTP-binding protein  ali follow..  19  11........................................................................................................................................KMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGLERQIQVNDEDVRLMLWDTAG----------QEEFDAITKAYYRG---AQACVLVFSTTDRGS---EAVSSWREKGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLR-----------RFYRTSVKEDLNVNEVFKYLAEKYLQKLKQ 175
49 -17.700[J] KOG0468 U5 snRNP-specific protein  ali follow..  15  128...................................................................................................................................PPLIRNVALVGHLHHGKTTFVDCLIRQTHPQFETMEERQLRYTDTLFTEQELNIFDTPGH--------------NFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQERQAITVCINKIDRLILEKLPPQDAYFKLKHIVEEVN..................................... 288
50 -17.600[R] KOG1533 Predicted GTPase  ali follow..  11  3........................................................................................................MNLNEKKQLLRVRVYATSEKGENLGSTHWTMYGVLVIGAPGAGKSTFCAGLTDKRPFLTINLDPANTEMITVNDVHKKYLIIDCPG----QLELYKSEGELWKVIRFLEKSGVRLCALHLADSLYCSDPSKLSTLATMVTMEMPQVNCLSKADLFSEEVPGLEKYRKLNEAICGVISDF--DLVSFVPLAVENKESMMKVIQMVDAANGFSLTE 287
51 -17.600[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  14  11........................................................................................................................................KLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGLSKTMYLEDRTVRLQLWDTAG----------QERFRSLIPSYI---RDSSVAVVVYDVANRLS---LNTSKWIEEGDVIIVLVGNKTDLVEKRQVSIEEGDSKGREYGVMF----------IETSAKAGFNIKPLFRKIAAALPGMESY 176
52 -17.500[DZ] COG5019 Septin family protein  ali follow..  19  97........................................................................................................................................NVLVLGESGSGKSTLVNTLLNRDNPEPTVMINSSAVEIVENGISLQLNVIDTPGFG-TDCWQPVLTDIEGRYDQYLELEKHNPCIFFIQPTGHAISAMELRVMLALHEK-VNIIPIIAKADTLTDDELNFTKEMILRDIQYHNIRIF................................... 272
53 -17.500[R] KOG0394 Ras-related GTPase  ali follow..  16  10........................................................................................................................................KVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGLTKEVQFEDRLFTLQIWDTAG----------QERFQSLGVAFYRG---ADCCVLVYDVNSMKS---ENLNNWREEENFPFVLIGNKVDVDDGNSRVVSEKKAKAWCASK-------GNIPYFETSAKVGTNVEEAFQCIAKDALKSGEE 182
54 -17.500[J] COG4108 Peptide chain release factor RF-3  ali follow..  12  1........................................................................................................................MLMSTTPYFGEVSKRRTFAIISHPDAGKTTITEKVLGSNQHAKSDWMEMEKERMQFPYGDCLVNLLDTPGH-------------EDFSEDTYRTLTAVDSCLMVIDAAKGVEDRTRKLMEVTRLRDTPIVTFMNKLDREIRDELDQAVGADLAAQLREELEFLQGELTPVFFGTALGNFGVDHMLDGLTQWAPS.... 280
55 -17.400[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  16  14........................................................................................................................................KIVLLGEGCVGKSSLVLRFVENKFSCKHLSTIQQNKTVNVEDCQADLHIWDTAG----------QEKYHALGPIYYRG---SNGVLLVFDITDRKS---EKVKNWVLENTAEILIVGNKIDLEEERQVTRQDAEAYAESEGALY----------METSAQDNVGISDAFESLTAKMIEHSRT 179
56 -17.300[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  16  29........................................................................................................................................RFLTCGSVDDGKSTLIGRLLHDTRQIQAEREQGITIDVYFSTEKRKFIIADTPGH-------------EQYTRNMATGASTCELAILLIDARKGVLDQTRRHSFISTLLGIKLVVAINKMDLVDYSEETFTRIREDYLTFAGQLPGNL----RFVPLSALEGDNVASLLEVLETV....... 235
57 -17.300[R] KOG0080 GTPase Rab18, small G protein superfamily  ali follow..  20  10........................................................................................................................................KILIIGESGVGKSSLLLRFTDDTFDPELAATIGKVKTISVDGNKAKLAIWDTAG----------QERFRTLTPSYYRG---AQGVILVYDVTRRDTFVKLELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIE-----------ASAKTCDGVQCAFEELVEKI...... 169
58 -17.200[DZU] KOG2655 Septin family protein (P-loop GTPase)  ali follow..  22  37........................................................................................................................................TLMVVGESGLGKSTLVNSLFLTDKQKQTVKLEASTVEIEERGVKLRLTVVDTPGFG-SNSFGAILEYIDEQYERFLRDESGLNCFYFISPFGHGLKPLDVEFMKKLHSK-VNIVPVIAKADCLTKKEILRLKCRIMQEIESHGIKIY................................... 209
59 -17.100[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  15  24........................................................................................................................................KILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGKVKTIYRNDKRIKLQIWDTAG----------QERYRTITTAYYRG---AMGFILMYDITNEES---NAVQDWSTQDNAQVLLVGNKCDMEDERVVSSERGRQLADHLG-----------EFFEASAKDNINVKQTFERLVDVICEKMSE 189
60 -17.100[R] KOG0079 GTP-binding protein H-ray, small G protein superfamily  ali follow..  16  12........................................................................................................................................KLLIIGDSGVGKSSLLLRFADNTFSENYITTIGKIRTMDINGQRVKLQIWDTAG----------QERFRTITSTYYRG---THGVVVVYDVTNGES---GNVKRWLQEDSVQKVLVGNKCEENERRVVLESDARNYAQSMN-----------SFFETSAKEDKNVEPMFTCITSLVLTAKLA 176
61 -17.100[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  15  11........................................................................................................................................KIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGMIKTVEINGEKVKLQIWDTAG----------QERFRSITQSYYRS---ANALILTYDITCEES---RCLPEWLRENKVITVLVGNKIDLAERREVSQQRAEEFSEAQD-----------YYLETSAKESDNVEKLFLDLACRLISEARQ 176
62 -17.100[R] KOG1424 Predicted GTP-binding protein MMR1  ali follow..  18  388........................................................................................................................................TVGLVGYPNVGKSSTINTIMGNKKVS-VSATPGHTKHFQTLYVEPGLCLCDCPGLVMPSFVST-----------------KAEMTC------SGILPIDQ-----MRDHVPPVSLVCQNIPRHVLEATYGINIITPREDEDPHRPPTSEELLTAYGYMRMTAHGQPDQPRSARYILKDYVS. 541
63 -17.000[TU] KOG0078 GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins  ali follow..  21  11........................................................................................................................................KLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGKIRTIELDGKRIKLQIWDTAG----------QERFRTITTAYYRG---AMGILLLYDVTDKKS---DNVRTWFSNENVYKILIGNKCDCEDQRQVSFEQGQALADELG-----------KFLEASAKTNVNVDEAFFTLAREIKKQKID 176
64 -17.000[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  19  10........................................................................................................................................KLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGKIRTVEQDGKTIKLQIWDTAG----------QERFRTITSSYYRG---AHGIIVTYDVTDLES---NNVKQWLNEENVNKLLVGNKCDLTSQKVVSTETAKAFADELG-----------PFLETSAKNATNVEEAFMAMTAAIKTRMAS 175
65 -16.900[J] KOG0469 Elongation factor 2  ali follow..  14  1................................................................................................................MVNFTVDEIRALMD----RKRNIRNMSVIAHVDHGKSTLTDSLVSKAGII-AGSKAGETRFTDTRKDEQEINLIDSPGH--------------DFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLEQLGAEELFQTFQRIVENIN..................................... 198
66 -16.900[D] KOG3859 Septins (P-loop GTPases)  ali follow..  18  44........................................................................................................................................NILCVGETGLGKSTLMDTLFNTKHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGYKPIVEFIDAQFEAYLQEELKIRRVLHCLYFIAPTGHSLKSLDLVTMKKLDSK-VNIIPIIAKADAISKSELTKFKIKITSELVSNGVQIY................................... 213
67 -16.800[U] KOG0086 GTPase Rab4, small G protein superfamily  ali follow..  18  10........................................................................................................................................KFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGGSRVVNVGGKTVKLQIWDTAG----------QERFRSVTRSYYRG---AAGALLVYDITSRET---NSLAAWLTDPNIVVILCGNKKDLDPEREVTFLEASRFAQENELMF----------LETSALTGENVEEAFLKCARTI...... 169
68 -16.800[T] KOG3886 GTP-binding protein  ali follow..  13  27.........................................................................................................................EGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRR--GATILDRIHSLQ-VLNLWDCGG--------------DTFMENYFTSQRNVEVLIYVFDVESRELEKDMHYQSCLESPDAKIFCLVHKMDLVQEDQR-----DLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIVYQL...... 241
69 -16.700[U] KOG0097 GTPase Rab14, small G protein superfamily  ali follow..  18  13........................................................................................................................................KYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGGTRIIEVSGQKIKLQIWDTAG----------QERFRAVTRSYYRG---AAGALMVYDITRRST---NHLSSWLTDPNTVIILIGNKADLEAQRDVTYEEAKQFAEENG-----------LFLEASAKTGENVEDAFLEAAKKIYQNIQD 178
70 -16.700[K] KOG1534 Putative transcription factor FET5  ali follow..  14  6.........................................................................................................................................AFVCGVASSGKSTFCGALMSGRSCHLVNLDPAARDLISIDDVDEDYLIFDMPG--------THVPILPALIRHLQVTLNFRPCAVYLLESQFLVDRTKLSAMSAMVMMEVPHINLLSKMDLLKDNETTNPKFHELNRCIVQLIDDF--NMVNFLPLESGNEESVSRVLSYIDDATQWYEDQ 259
71 -16.500[U] KOG0098 GTPase Rab2, small G protein superfamily  ali follow..  18  8........................................................................................................................................KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGGARMVTIDGKQIKLQIWDTAG----------QESFRSITRSYYRG---AAGALLVYDITRRDT---NHLTSWLEDSNMVIMLIGNKSDLEARREVKREEGEAFAREHGLVF----------METSAKTAANVEEAFIDTAKEIYRKIQE 173
72 -16.500[U] KOG0087 GTPase Rab11/YPT3, small G protein superfamily  ali follow..  18  12........................................................................................................................................KTVLIGDSGVGKSNLLMRFTRNEFNIESKSTIGATRNIVLDNKKIKAQIWDTAG----------QERYRAITSAYYRG---AVGALIVYDITKQSS---DNVGRWLKESNIVIMLVGNKTDLLHLRAVSTEEAQAFAAENN-----------SFIETSAMDASNVEEAFQTVLTEIFRIVSN 177
73 -16.400[U] KOG0081 GTPase Rab27, small G protein superfamily  ali follow..  14  11........................................................................................................................................KFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRAHLQLWDTAG----------QERFRSLTTAFFRD---AMGFLLLFDLTNEQSFLNSQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYG-----------PYFETSAANGTNISQAIEMLLDLIMKRMER 187
74 -16.300[R] KOG0091 GTPase Rab39, small G protein superfamily  ali follow..  21  11........................................................................................................................................RLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDKLQLWDTAG----------QERFRSITKSYYRN---SVGVLLVYDISNHASFEHMEAQRHIEPHRPVFALVGCKLDLINAGGHREVTTEEAQKFAKQH---------HFVETSARSGANVEEAFRMVTQEVYARIRS 181
75 -16.100[R] KOG2484 GTPase  ali follow..  12  134......EQSLKQYFKEFRKVIENADVVLEVVDARDPLTRCNEVERAVRGAPGNKRLVLVLNKADLVPRENLNIKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVCIGAELLMSMLGCRNKGIKTSIRVGVVGIPNVGKSSIINSLTRGR-SCMVGSTPGVTKSMQEVELDSKIKLIDCPGIVFTSGGENSHAVLKNAQR-----------------------------VGDVKDPFTIAESVLKRASKEYFCTMYDITNYDTFEEFFAKKAARM---------GKFLKKGVPDVVAAARSVLNDWNT. 410

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.