current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [K] KOG2907 RNA polymerase I transcription factor TFIIS, subunit A12.2/RPA12, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MSVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSLRAKKSVVKTSLKKNELKDGATIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTNNLast
1 -54.000[K] KOG2907 RNA polymerase I transcription factor TFIIS, subunit A12.2/RPA12  ali  100  1MSVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSLRAKKSVVKTSLKKNELKDGATIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTNN 125
2 -39.900[K] KOG2906 RNA polymerase III subunit C11  ali follow..  26  1......MEFCPTCGNLLRYEGGG-NSRFFCSTCPYVAYIQR-----------QVEIKKKQLLVKKSIEAVVTKDDIPTAAETEAPCPRCGHDKAYFKSMQIRSADEPESRFYRCLKCEFTWREE. 106
3 -36.900[K] COG1594 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS  ali follow..  28  1.......MFCPKCGSLMTPVNGR----YVCPSCGYEVSKKKEDLKIVNK-------------SNDKETIMIREEVSAEPLDSDAICPRCHHKGARYVLKQTRSADEPETKFYTCEECGYRWREY. 100
4 -36.800[K] KOG2691 RNA polymerase II subunit 9  ali follow..  16  1...MSTMKFCRECNNILYPKEDKEQKIYACRNCDHQEVADNSCVYRNEVHHSV---------SERTQILTDVASDPTLPRTKAVRCSKCQHREAVFFQATAR-GEEGMTLFFVCCNCGHRWRE.. 114
5 -28.800[K] KOG2461 Transcription factor BLIMP-1/PRDI-BF1, contains C2H2-type Zn-finger and SET domains  ali follow..  16  510.........CKDCNKTFHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPS 633
6 -26.900[K] KOG2462 C2H2-type Zn-finger protein  ali follow..  17  121.........CPECGKKYSTSSNMDKKARHCPYCEKVYVSMPAYSMHVRTHN--QGCECQFCGKRFSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKAFALKS 245
7 -23.400[K] KOG1105 Transcription elongation factor TFIIS/Cofactor of enhancer-binding protein Sp1  ali follow..  17  200..............SRIFNLRDKKNLALRENVLTGVVRAEKFATMTSEEMASAEIREMRDKFTKEA-ILEHQMSVQQGTPSDMFKCGKCGKKNCTYTQLQTRSSDEPMTTFVFCLECGNRWK... 306
8 -20.200[R] KOG3608 Zn finger proteins  ali follow..  17  207.........CFHCGELFRTKTENNTNSFQCAQCFKFFATKKLLKSHVVRHV--NCYKCTMCDMTCSSASSLTTHIRRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTVHQCEDCHYSVRTYT 333
9 -16.900[K] KOG2482 Predicted C2H2-type Zn-finger protein  ali follow..  11  163.........CMFCNEEFLGNRQKKLDNLQCLYCEKTFRDKNTLKDHMRKKQHRKINPKNREYDRFLLDHQEDDWSDWEEHPASAVCLFCEKQAETIEKLYVHEDAHEFDLLKRCYGCHVKFKSKA 358
10 -16.700[R] KOG4377 Zn-finger protein  ali follow..  11  304.........NEDCGF----GYRNHQSHFHCRDCHYSFCDKTRFVQHTARHERMDTLGAATETNHLSRIDPTEAVTASSRKTSHFHCRKCDYVCTDSNKVVAHRRLHLRQTHYHCVTCDGGVLSRA 473
11 -15.800[R] COG5048 FOG: Zn-finger  ali follow..  11  552.........CPGCTKTFHIQTHLEDRPYSCDGCDKAFVRNHDLIRHKKSHQ-----------------------------EKAYACP-CGKKFNREDALVVHRSRMSGGKKYENVVIKRSPRKRG 651
12 -14.800[O] COG3058 Uncharacterized protein involved in formate dehydrogenase formation  ali follow..  16  189........YCPVCGSMVQIGTTQGLRYLHCNLCETEWHVVRV------------------------------------------KCSNCEQSGKL--HYWSLDDEQAAIKAESCDDCGTYLK... 263
13 -13.900[S] COG4332 Uncharacterized protein conserved in bacteria  ali follow..  16  12..........................................................................TPEIAPQPLINCNRCGGVKAYRCSGKFRVNANGKRIIYRCVDCDNSWNFG. 65
14 -13.400[KL] COG5151 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1  ali follow..  10  310........HCPRCKAKV-------TLPIECPSCSLVLILSTHLARSYHHLFPLKNWSEIPWSANPKSPKPPVSPFDESTSSMRYACPSCKNHFCLDCDVFAHEQ------LHECYGCQCSGN... 421
15 -13.400[KL] KOG2807 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1  ali follow..  10  310........HCPRCKAKV-------TLPIECPSCSLVLILSTHLARSYHHLFPLKNWSEIPWSANPKSPKPPVSPFDESTSSMRYACPSCKNHFCLDCDVFAHEQ------LHECYGCQCSGN... 421
16 -12.900[S] KOG4696 Uncharacterized conserved protein  ali follow..  15  1......MLSCNICGETVTSEPDHMESEIICPFCKLSGVNYDEMCFHIETSENLTESRKFLKSREKQSSLTEIKGSVYETTYSPPECPFCGKIEEHSEDMETHPLEDCDQPLYDCPMCGLICTNYH 206
17 -12.900[R] KOG4684 Uncharacterized conserved protein, contains C4-type Zn-finger  ali follow..  12  50.ASGIPVINCRVCQSLINLDGKLHQHVVKCTVCNEATPIKDTSRRIGCPRPNCRRIINLGPVMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLW--------MELRFNTLAKCPHCKKICSSS. 184
18 -12.700[KD] COG5189 Putative transcriptional repressor regulating G2/M transition  ali follow..  17  576.............................................................QQAYIDDPARRLYVMDHEEQKPFKCPGCEKTYKNQNGLKYHRLGSAKDKPYRCEVCGKRYKNLN 672
19 -12.700[O] KOG0006 E3 ubiquitin-protein ligase (Parkin protein)  ali follow..  14  299....MGGVLCPGCGAGLLPEPDQRKVTCECRECKEAYHEGECSAVFEASGTTTQAYRVD---ERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVC 429
20 -12.700[R] COG5525 Bacteriophage tail assembly protein  ali follow..  10  175.SSDFKCVALTDYDRFPEDVDGEGDAFSLASKRTTTFMSLGMTLVESSPGREITDTRWKPSSPHEAPPTTGILSLYNRGDRRRWPCPHCGEANMTGYRHIADPMEASEAARIQCPHCHKLTEPQQ 306
21 -12.600[R] KOG2785 C2H2-type Zn-finger protein  ali follow..  12  2.........................ATYTCITCRVAFRDADMQRAHYKTDWHRYNLR---------------------RKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFN 80
22 -12.500[U] KOG4173 Alpha-SNAP protein  ali follow..  82.........CAGCCQVFDALDDHTLHGNVCSFCKRAFPSGHLLDAHILEWHDSLF-------------------QILSERQDMYQCEGCTEKFKTSRDRKDHMRMHLYPADFRFDKPKKSRSPAS 188
23 -12.200[L] COG0551 Zn-finger domain associated with topoisomerase type I  ali follow..  15  118.........CDKCGADMHLKLGRFGKYMGCTNCDNT--------------------------RKILKNGEVAPPKEEPVHFPELKCEKSDAYFVL--------RDGASGVFMSAHKSRET..... 197
24 -12.100[L] COG3677 Transposase and inactivated derivatives  ali follow..  25  2................................................................................STHCHCPQCGHGNV------VKNGFVKDKQRFKCKSCQYQFTNLS 40
25 -11.800[C] COG3005 Nitrate/TMAO reductases, membrane-bound tetraheme cytochrome c subunit  ali follow..  14  39IKLTSTTEFCVSCHSM-VHFQNASGVRAECHDC-PGMVKRKLEASNDLYQTFIAHSIDTPEKFEAKRAELAEREWARMKENNSATCRSCHNYDAMDHAKQNPEAARQMKI--SCIDC........ 173
26 -11.400[S] KOG2673 Uncharacterized conserved protein, contains PSP domain  ali follow..  10  601..............................KEVQGSSTSKSAKLKVIKVYSFADVVTTTKKGNIQTEESSLNHEKKLGTVVEPMKCDERSKEVQGSSTSKSEKPKYSFADVVTTTKKGNIQTEES 702
27 -11.200[O] COG0068 Hydrogenase maturation factor  ali follow..  12  98TEITPDAATCPECQREIFDPFSRFYRYTNCTHCG-----------------------------RLSIIRAIPYDRCNTSMSAFVMCPECEDSYHDVENRRFHAQPVA------CHTCG....... 183
28 -11.100[R] KOG3183 Predicted Zn-finger protein  ali follow..  12  15VDYCKQIDFCDRCLQVYPKGNRGDVTVVICPLCAKGVRLNPDEDPNITKHVNTDCDPSNYEKAVKKKKCPVPRCRELLTFSNTIKCRDCSIDHC---------LKHRFGPDHSCSG......... 139
29 -11.000[S] KOG4623 Uncharacterized conserved protein  ali follow..  14  43.........CWFCNGNVRVPYQDRNS-WTCPSCEQ--DYNRDITSQRDCSLGSQKNSSKGSSSICANSYYSDVLTAQPPAPKNGLCDQCNEAQSQFEPKNESRFDQELKVYFRCSSCERHVNK.. 176
30 -10.800[S] COG5349 Uncharacterized protein conserved in bacteria  ali follow..  31  20....................................................................................CCPRCGEGKLFQGFLKLAPA---------CDQCGLDYGFAD 51
31 -10.800[S] COG2995 Uncharacterized paraquat-inducible protein A  ali follow..  20  4HHHAAKHILCPQCDMLVALPRLSHGQKAACPRCGATLTTEWDAPRQRPT............................................................................ 52
32 -10.700[K] COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains  ali follow..  21  2....................................................................................HCPFCAAVDTKVIDSRLVSDGSQVRRRRQCLDCNERFTTFE 42
33 -10.400[R] COG1779 C4-type Zn-finger protein  ali follow..  21  2.............................................................................NQQDMKIDCPVCGGERCMTAVTRVEK-GEIMESVLICERCNYRSTD.. 50
34 -10.400[S] COG4640 Predicted membrane protein  ali follow..  15  1......MKSCPKCGQQAQDDVQ-------CTQCGHKFDSRQALYRKSTDEDIQTNNIKMRKMV.............................................................. 51
35 -10.300[J] COG1499 NMD protein affecting ribosome stability and mRNA decay  ali follow..  12  1MAGRDAKIPCPFCGR-HPLVKVKETRVLRCRYCGALFISGAIERIEASQSYDGLTARVVVKGSPHPSIEPRLFTYVLTFEYVYDICNSCREMLSRREVLQIRGYPRGIE................ 154
36 -10.300[R] KOG3399 Predicted Yippee-type zinc-binding protein  ali follow..  5...........TRSKTFQAYLPSCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKY............. 105
37 -10.200[S] COG4306 Uncharacterized protein conserved in bacteria  ali follow..  14  1MGTYRAAQICTNTTAADQKHELWEA----CSHSG---------------------------------------------EATILQYPKCSASDDYVEGVLGFGGDYEPPTF--CNNCGSRFPWAE 82
38 -10.100[D] KOG2186 Cell growth-regulating nucleolar protein  ali follow..  13  2......VWFCDDCGENLKKPRLPRH-KFSCIDCGNMFGQVS--HYHNQCITEAEKYGPMVRSNGESSKQKHDFDINAELFNSQWFCSLCNATMTCEQDYFAHYVGLSNDYPWFCSLCDINATSEQ 167
39 -10.000[TZR] KOG1704 FOG: LIM domain  ali follow..  15  203........FCAQCNDVLADQK-QRANKPVCLKC--------------------------------------------HSSSSTFSCTTCRLSFSSDTPHMSQGDLHASAECFCCCVCSKN..... 275
40 -10.000[J] COG2023 RNase P subunit RPR2  ali follow..  27  68.....................................................................................CKRCHTFLIPGVNARVRRTKRMPHVVITCLECGYIMR... 105
41 -10.000[S] COG3880 Uncharacterized protein with conserved CXXC pairs  ali follow..  13  1.......MICQECHEFTKVVNGEKIEVHICEQCAKENSDSYGISANQGFSIH----NLLSGLLNMDSSFQNAGTQMFSHSEQISACPKCGMTFQQFRKIGR----------FGCSECYKTFHSN. 109
42 -9.990[J] KOG2613 NMD protein affecting ribosome stability and mRNA decay  ali follow..  10  1MEFTPIDLLCCNCGT-ITQGIPREANISFCRNCERFLQPPGDASFIWTEPHSRRIRIKLTVQGEAMTNTIIQQTFEVEYIVIAMQCPDCARSYTTNTWTVQIRQKVPHKR............... 169
43 -9.750[R] COG1326 Uncharacterized archaeal Zn-finger protein  ali follow..  22  2..............................................................................IREIEIECPSCSPQEEVTHEVLKEGQS----PLVRCMECGQVHP... 41
44 -9.720[L] COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain  ali follow..  18  9.........CNECKG----KGYRVKSYKICSACH-----------------GTGFRSTEDIKDHFKGVSNSARQRFDLEDSHEVPCEVCRGK-----EVEVRE---------TCPTCGGKGEVNI 90
45 -9.690[Q] COG4647 Acetone carboxylase, gamma subunit  ali follow..  12  59.............GPHLFVVQDAQKKWVIKCSCGHAFCAPE-----ENWKLHANIYVRDTAEKMEEVYPKLLASDTHWQVYREYICPDCG----ILLDVEAPTPWYP.................. 143
46 -9.640[R] COG5236 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  10  64.........CVICARKLTYVSLTPCHHKTCHICGFRQRAEEVMFTDRIDGDISDKYNFCEKNEKYGINFTSEEVATETLNLLKFFCPLSVCDFGSFKKYNEHKSEHNRMICLICATHKHAFPCE. 197
47 -9.640[S] KOG3214 Uncharacterized Zn ribbon-containing protein  ali follow..  20  3...............................................................KRKAKAKVKPKRRAPPLDTTFTCLFCNHEKSVSCSLDKQSG----VGNLHCKICGQSHQ... 57
48 -9.640[R] KOG2703 C4-type Zn-finger protein  ali follow..  12  238.....................................STKTAYVPNGTIGATAGHRAIAQSNSTDISDNLFRYSAPEEVMTFPSTCGACTEPETRMFVTKIPYFQEVIVMASTCDSCGYRNSE.. 324
49 -9.340[R] COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain  ali follow..  15  348.............GHVIFAVRDGKGDEIDC--AAFEPTKNFRVLARRLLLGDQIFLSGSVTSGTLNIEKMQVKELVLLYREENPKCPECGK----------HMKSAGQGQGFRCKKCGTRASS.. 445
50 -9.300[S] COG1655 Uncharacterized protein conserved in bacteria  ali follow..  13  2.................................................................RKEEEKKTSINDLLYDKTVNCPVCNTTFKARTVKTSAIRILKKDTVWLCPICGYAAMKSD 76
51 -9.300[O] KOG1814 Predicted E3 ubiquitin ligase  ali follow..  12  257YENDSNIIFCPFCQGPS--KRDPGQKLAICQKCDFAFMYLNYQENEPEKALELEKRYGKRIIDRLVEQVKNDEEAEKWVLLNGQRCPTCDERIDGCCHMNCLCGTH-------CFLCGAYLMEQN 404
52 -9.290[S] COG1656 Uncharacterized conserved protein  ali follow..  24  108....................................................................................RCPICNGVLEPVDKEAVRDR-RVVDKFYVCTRCGKVYWEGA 153
53 -9.240[S] KOG3277 Uncharacterized conserved protein  ali follow..  14  6..................................................VSALYRASRSFSETVPRLSATPLGKQEPQLSLSYTCKVCNSREGP--KTFAKSSYEKGVVIVTCSGCHNH..... 73
54 -9.160[S] COG4530 Uncharacterized protein conserved in bacteria  ali follow..  13  7....GTKRIDPETGRKFY---DLNRDPIVSPYTGKSYPLSFFEETSVAKVLEKEEEEDVKEVDTENTEVELVSLEEADDEASG.......................................... 82
55 -9.140[S] COG5636 Uncharacterized conserved protein, contains Zn-ribbon-like motif  ali follow..  19  196.........CKNC------------------TCGLREMEEH----------ESSKTSAQLEAVKLTDTTEVDFTEKLKSKNAVSSCGNCYLGDA-----------------FRCSGC........ 258
56 -9.140[R] COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain  ali follow..  20  1................................................................................MNNKGCIKCGSTEAGQKEIATTGTQHNRFLVVYCKNCGYS..... 48
57 -9.130[S] COG4260 Putative virion core protein (lumpy skin disease virus)  ali follow..  24  331.NTKNTGKFCSNCGQ-------------------------------------------------------AKPSATPVMPELNMACNECGAV----------NLANGVPKF--CPECGKPFVAKA 388
58 -9.040[T] KOG1701 Focal adhesion adaptor protein Paxillin and related LIM proteins  ali follow..  13  416.........CARCGECTAMDQVFHVDCFTCIICNNKLRGQPFYAVEKKAYCEPCYINTLE------------------------QCNVCSKPIMERILRATGKAYHPH---FTCVMCHRSLDGIP 513
59 -9.030[U] KOG2034 Vacuolar sorting protein PEP3/VPS18  ali follow..  11  834.AVIDRDEECGVCKRKILMMSGDFRAPFYVFPCGHSFHAQCLITHVTSCAHEEQAEHILDLQKQLTLLGSETRRDINGNRSDASECPFCGELMINEITLPFIKPEDSQYS--------TSWDLRS 980

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.