current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [R] KOG2981 Protein involved in autophagocytosis during starvation, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310
# Score Template Links and tools%idFirst MVLSQKLHEAFKGTVERITGPRTISAFKEKGVLSVSEFVLAGDNLVSKCPTWSWESGDASKRKPYLPSDKQFLITRNVPCLRRAASVAEDYEAAGGEVLVDDEDNDGWLATHGKPKGKEEDNLPSMDALDINEKNTIQSIPTYFGGEEDDDIPDMEEFDEADNVVENDPATLQSTYLVAHEPDDDNILRTRTYDLSITYDKYYQTPRVWLTGYDESRMLLQPELVMEDVSQDHARKTVTIEDHPHLPGKHASVHPCRHGAVMKKIIDVLMSRGVEPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLGSSSTLast
1 -138.000[R] KOG2981 Protein involved in autophagocytosis during starvation  ali  100  1MVLSQKLHEAFKGTVERITGPRTISAFKEKGVLSVSEFVLAGDNLVSKCPTWSWESGDASKRKPYLPSDKQFLITRNVPCLRRAASVAEDYEAAGGEVLVDDEDNDGWLATHGKPKGKEEDNLPSMDALDINEKNTIQSIPTYFGGEEDDDIPDMEEFDEADNVVENDPATLQSTYLVAHEPDDDNILRTRTYDLSITYDKYYQTPRVWLTGYDESRMLLQPELVMEDVSQDHARKTVTIEDHPHLPGKHASVHPCRHGAVMKKIIDVLMSRGVEPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLGSSST 311
2 -64.100[S] KOG4741 Uncharacterized conserved protein  ali follow..  12  1..........................MEEDEFIGEKTFQRYCAEFIKHSDSWEWRPSKDCSDGYMCKIHFQI---------------------------------------------------------------------------KNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKN---VNYITSWLSIVGPV---VGLNLPLSYAKATSQD 215
3 -7.440[R] COG2249 Putative NADPH-quinone reductase (modulator of drug activity B)  ali follow..  17  19.ALNLTLTNVAADFLRESGHQVKITTVDQGYDIESEENYLWADTIIYQMPAW-WMG---------EPW-KKYI.............................................................................................................................................................................................................................................. 82
4 -6.720[R] COG1881 Phospholipid-binding protein  ali follow..  18  1..MQRSLRHLLVHGRRQLMTFSLISPVFADGQPIPQKYTRFGENLF---PPLKWTG---------TPEAQSFALIVEDP........................................................................................................................................................................................................................................ 66
5 -6.440[DK] KOG4333 Nuclear DEAF-1 related transcriptional regulator (suppressin) and related SAND domain proteins  ali follow..  14  102.................SKAILLWKKFVCPGIISPKHFVHLAGK--STLKDWKRAIRLGGIMLRKM--DSGQI.............................................................................................................................................................................................................................................. 165
6 -6.240[G] KOG4123 Putative alpha 1,2 mannosyltransferase  ali follow..  13  33..........................VPQLGYVHPDEFFQSVEVMTGDH-TWEFNNSLPVRS......................................................................................................................................................................................................................................................... 74
7 -6.080[R] COG5562 Phage envelope protein  ali follow..  15  74....................IKEAALLHICGKSTFREYCGAG----------RWVTDVNHNKRSYYAIDNTLLYIEDVENNKPL................................................................................................................................................................................................................................... 133
8 -5.840[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  4......................................................KLALKRRGKDSEPTNEVVASSEASENEEEEEDLLQAVKDPGEDSTDDEGIDQEYHSDSSEELQFESDEEGNYLGRKQSSSAEEDEESSDEEDNEEEESTDGEEVEDEEKDSKSKQTDDKPSGSGAASKKALTAELPKRDSSKPEYQDS-NIPMHWYDEYKHIGYDWDAKKIIKPPQGDQIDEFLRKIEDP---------------DFWRTVKDPLTGQDVRLTDED-----IALIKRI................... 233
9 -5.780[J] KOG3435 Mitochondrial/chloroplast ribosomal protein L54/L37  ali follow..  14  29..................PKASNLSKEIKSSMVVSANTLKDGLDPKSDHPDYLWHLLDKRPALSELRRKKRFVKLDTRARIKENHSIKA.............................................................................................................................................................................................................................. 113
10 -5.700[S] KOG0858 Predicted membrane protein  ali follow..  16  1MDAGVWYRSLPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWR.................................................................................................................................................................................................................................................................. 53

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.