current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [J] KOG3191 Predicted N6-DNA-methyltransferase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst MSPQKVSQKCKKPMSMPTPQYRLQAIRAHDVYEPAEDTFLLIDAIEKDIKEIRSRDPKLVLEIGCGSGVVSTFVNQALGGNVTSVATDLNPHALDVTLETAKLNDIKIDVVRTDLFAGLENLLGKVDVLLFNPPYVPTDEEPKSNIELTYAGGRTGRSTLDRLLPRVPELLSPRGVFYLVALHSNDIPALLKEHSEQMTVSVSMERRCGIEHLYILKFVMKENNVKAAPLAEIELast
1 -94.600[J] KOG3191 Predicted N6-DNA-methyltransferase  ali  100  1MSPQKVSQKCKKPMSMPTPQYRLQAIRAHDVYEPAEDTFLLIDAIEKDIKEIRSRDPKLVLEIGCGSGVVSTFVNQALGGNVTSVATDLNPHALDVTLETAKLNDIKIDVVRTDLFAGLENLLGKVDVLLFNPPYVPTDEEPKSNIELTYAGGRTGRSTLDRLLPRVPELLSPRGVFYLVALHSNDIPALLKEHSEQMTVSVSMERRCGIEHLYILKFVMKENNVKAAPLAEIE 234
2 -62.600[R] KOG2904 Predicted methyltransferase  ali follow..  22  148......RIEKRRPFQYVVGWRDLVLCVEEGVLIPRPETELIVDMVEELVTRDEWFKKDIWADLGTGSGAIAIGIAKVLGSRGRVIATDLSPVAIAVAGHNVQRYSLMIEVREGSWFEPLKDLEGKLVGLVSNPPYIPSDEVGRHEPKLALDGGIDGTDSLFHLCHGASRMLQPGGFFVFETNGEKQSKMIVDYMMTCFSDLKIVSDFAGINRFVTGF................. 375
3 -59.500[J] COG2890 Methylase of polypeptide chain release factors  ali follow..  17  84VIKRINDRTPVAYLTNKAWFCGLEFFVDSRVLVPRSPIGELIQNR---FEPWLTEEPTRIMDLCTGSGCIAIACANAFP-EAEVDAIDISVDALNVAEQNIQDHGLQVFPIRSDLFRDLPQ--EQYDLIVTNPPYVDQEDMDRHEPELGLAAGSDGLKLARRILANAPLYLKENGILVCEVGNSMV-HMMEQYPHIPFTWLEFENGGHGVFLLTREQLIDCAADFAL....... 311
4 -40.400[J] COG2263 Predicted RNA methylase  ali follow..  14  1.....MKQRKLEMLLEEVEGFSSPELELEQYQTPSPLAAEILHFAYMQGD-----LDESVQDLGCGTGILAIGAKLL--GARKVVGYDTDPKALEVARKNAERLGVEVEFVCSDIKK----VSGHVKTTLMNPPFGARVKGRRTSEVIYSIHNRGSLAFIQKFIKPAVITHSYVAKFPLKRTFDFHQKEREIIEVEIYR................................... 192
5 -35.700[S] KOG2912 Predicted DNA methylase  ali follow..  12  30..............AILDRDYSLRVEFPENRLCPMVPNRAYIHDLLSSTSGQKDKKRIIGLDIGTGASCIYPLLGCRMY-SYDFVGTEIDKFSFETAKSNILQNNMQIKIVLRSKQDCLLPDMEEFTFVMCNPPFYEHEEDFINFKEMVTEGGE--VGFANKILTESKKRKGIQWYTCMFGKKSSVPAVVDKLREQNISNYGIYELALGKTKRWIICWSFQAMRPHNELIRPSS 268
6 -31.200[R] COG4123 Predicted O-methyltransferase  ali follow..  17  20.....................DIKIIQNREVFSYSVDSVLLSRFP-------RFPKKGLIVDFCAGNGAVGLFASTR--TQAQILSVEIQERLADMAERSVRLNGLQMQVICDDLKNMPAHIGSKVDMILCNPPYFKVNPYSNLNESEHYLLARHEITTLEEICRSAQSILKSNGRLAMVHRPDRLLDILDTLKRHNLAPKRVYPKREKEANMLLIEAIKDGSTSGFKVLPPL. 229
7 -29.600[J] KOG3420 Predicted RNA methylase  ali follow..  15  23...............................LEQYATSSELAVSMMEMIDETIGFEGKKLIDIGCGCGMLMTTAATMYEL-ETVLGVDIDDEALKICSRNLETAEVRCELLQADILDPESDLRGTFDVAVINPPF----------------GTKNNAGIDMQFVQIGLQMVRPGGSVFSLHKSSTRDYILKNAKKWDGVGAECCKQKAVDIAVDLIHFKKLDS........... 214
8 -28.200[J] COG2813 16S RNA G1207 methylase RsmC  ali follow..  14  189..NEPQLADAPQTVSWKLEGTDWTIHNHANVFSRTG-ARFFMQHL-------PENLEGEIVDLGCGNGVIGLTLLDKNP-QAKVVFVDESPMAVASSRLNVETNMPRCEFMINNALSGVEP--FRFNAVLCNPPF---------------QQHALTDNVAWEMFHHARRCLKINGELYIVANRHLDYFHKLKKIFGN------CTTIATNNKFVVLKAVKLGRR.......... 387
9 -25.400[H] COG2242 Precorrin-6B methylase 2  ali follow..  11  39..................GITDGLFERLPGIPLSKREVRLLI------ISALQLKEESIIWDIGAGTGTIPVELALLCP-RSRIVAVERDEEVAGLIRRNCERFGVNVTVHEGSAPDCLPQLIAHPTHICIE-----------------------GGRPIKQILQETWAHLAPGGRLVAANNLESLYGISETLSELQVRNVEVVQAGVNRLEKR.................... 206
10 -23.200[R] KOG1271 Methyltransferases  ali follow..  17  58......................................................KEASRVLDLGCGNGMFLVGLANE-GFTGDLTGVDYSPKAVELAQNIAEDNKLSITYKVADLTQ-PQNELGQFDVVHDKGTY-----------DAVSLCPDNAKEKRALYLDTVEKLLRTADSLFVITSCNWTEDELVDSFAEKFVKYYTIPTPT--NVVTSIVFKRKKE........... 219
11 -21.400[R] KOG2899 Predicted methyltransferase  ali follow..  18  98............................................LDVLGTQPDLFRNKQLLDIGCNSGHLSIQIARKFEV-KSLVGLDIDRGLINDAQKTVSHLKVHGNYVLED--VLLEIERPQFDVILCL--WIHLN----------------CDSGLKQAFRRMYLQLRPGGKLILE...................................................... 232
12 -21.200[J] COG2264 Ribosomal protein L11 methylase  ali follow..  20  130..............................MLDPHPTTALCLEWLDSLD-----LQDKTVIDFGCGSGILAIAALKL--GAKSAVGIDIDPQAILASRNNAEQNGVRLQLFLSEDKP----ADLKADVVVAN------------------------AGPLKELYPVIRQLVKPNGVLGLSGILATQASSVCDAYAQSFVLEPVEER............................ 282
13 -20.700[R] COG4106 Trans-aconitate methyltransferase  ali follow..  15  12.....................................EDERTRPARDLLAQVPLERVLNGYDLGCGPGNSTELLTDRYG-VNVITGIDSDDDMLEKAADRLP----NTNFGKADLAT---KPAQKADLLYAN--WVPDHL---------------------AVLSQLMDQLESGGVLAVQMPDNLQEPTHIAMHET...................................... 144
14 -20.700[R] COG1568 Predicted methyltransferases  ali follow..  13  125...................................DQAYVTPETTVARVILMHTRENKEIFVLGDDDL-TSVALMLSGLPK-RIAVLDIDERLIKFIEKVADELGYDIEIFTFDLRKPLPDALHKFDTFITDPPETIKAIRAFVGRGIATLKGPRCAGYFDKWREIQRLLINEFNVVITDI..................................................... 282
15 -20.600[R] KOG2361 Predicted methyltransferase  ali follow..  17  89......................................................SGKSVILEVGCGAGNTIFPLIATYP-DIFVYACDFSPRAVELVKAHDEYTETRVCAFACDLTGDGLDKPSSVDIVTM--SAVSPEK-------------------MSSVLQNIRKVLKPNGCILF....................................................... 198
16 -19.200[L] COG0742 N6-adenine-specific methylase  ali follow..  11  2...KKPNHSGSGQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETLFNWLA--PVIVDAQCLDCFAGSGALGLEALSR--YAAGATLIEMDRAVSQQLIKNLATLKANARVVNSNAMSFLAQKGTPHNIVFVDPPF--------------------RRGLLEETINLLEDWLADETLIYVESEVENGLPTVPA------NWSLHREKVAGQVAYRLYQREAQGESDAD....... 198
17 -19.200[A] KOG1975 mRNA cap methyltransferase  ali follow..  17  151..........................................NAIKYMLIDKYTKPGDVVLELGCGKGGDLRKYGAA--GISQFIGIDISNASIQEAHKRYRSMRYQVVLITGDCFGPFPDCRFPCDIVSTQ--AFETEEK------------------ARRALLNVAKSLKIGGHFFGTI..................................................... 283
18 -19.100[J] COG1889 Fibrillarin-like rRNA methylase  ali follow..  11  58...................................PYRSKLAAAILNGLKLVPIKEGTHILYLGAASGTTPSHISDIVGENGLIYSVEFSPRVFREFMEKLVDQGRNVVPILGDARFPYQYAHYVKGVDVVYIDVAQPAQA-------------------KILADNADYFLKPGGHVMLVIKAMSIKQEINTLKERGFDILETVHLEPYDTAHAMVIAKKR............. 235
19 -18.900[H] COG2227 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase  ali follow..  17  25.................................EFKPLHDINPLRVNWIDERAGLAGKKVLDIGCGGGILSEAMAQR---GASVTGIDMGEAPLAVARLHQLESGVAVDYRQITAEQMAEEMPGQFDVVTCLEEHVPDPA---------------------SVIRACHRLVKPGGQVFLSTINRNPKAYLFAVIGAEYILQLLPRGTHDFRKFI.................... 183
20 -18.800[R] COG3129 Predicted SAM-dependent methyltransferase  ali follow..  13  85..............ALLAHFYAVANWDIPD--VPGRADYIHHLADLLAEASGTIPANASILDIGVGANCIYPLIGVHEYG--RFTGSETSSQALSSAQAIISANPLRRQKESGAIFNGIIHKNEQYDATLCNPPFHDSAAAARQQQELWCEGGE--VTFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRLTDVGAVKVVKKEMAQGQKQSRFIAWTFMNDEQRRRFVNRQR 335
21 -18.800[R] COG2521 Predicted archaeal methyltransferase  ali follow..  13  81..............IAADRFYKLCVFNRGWAPTLMIDGITMHSVLENLTSRKVERAWGRVFECCTGLGYTAIEALKK--GARHVITVEVDPHVLTLASLNPYSRGLAVDVILGDCYAFVQTVRDSIDFIIHDPPRLSHATQRLYS---------------EALYREFYRILKRGGGVFHYVSQSGTKGVAERLRRVGFAVEKIKE............................. 269
22 -18.700[R] KOG1541 Predicted protein carboxyl methylase  ali follow..  18  34..........................................KMTLRALELLNLQPCSFILDIGCGSGLSGEILTQE--GDHVWCGLDISPSMLATGLSRE----LEGDLMLQDMGTGIPFRAGSFDAAISI--WLCNADTSYNDPK----------QRLMRFFNTLYAALKKGGKFVAQF..................................................... 158
23 -18.300[I] COG3963 Phospholipid N-methyltransferase  ali follow..  12  1.MALNLKQRLEQKFEEEIRFFKGMVSQPKKVGAIVPTSSITAKKMASVIN---PHSGLPVLELGPGTGVITKAILARGIKPESLTAIEYSTDFYNQLLRSYP----GVNFVNGDAFD--EHKGQMFDSVISAVPMLNFPM-----------------AARIKLLDELLKRVPHGRPVV........................................................ 157
24 -18.200[R] COG1092 Predicted SAM-dependent methyltransferases  ali follow..  17  216...............................IVGGHKTGFYLDQRDSRFQSMKYVKEKEVLNCFSYTGGFGLYALK--GGAKRVINADVSQPALDTAKFNAELNGFRAVFLNADVFKLLREYRDRFDVVVMDPPKFAESKAQ-----------DGACRGYKDINMLAMQILNPGGTLLT....................................................... 359
25 -18.200[R] COG3897 Predicted methyltransferase  ali follow..  21  58...................................AGGQGLARYILDHPESVCGKR---VLDFASGSGLVAIAAAKA--GAAKVLAADIDPWTETAIRLNAALNGVDIGFTGLDLVGK----PVDADVLLAGDVFYDR-------------------AFADLLVPWFVELTEKGMIVLVGDPGRAYLPKERLRAEATYQVPVTRA............................. 199
26 -17.600[J] COG2519 tRNA(1-methyladenosine) methyltransferase and related methyltransferases  ali follow..  18  66....................YLDKMKRGPQIVHPKDAALIV--------AYAGISPGDFIVEAGVGSGALTLFLANIVGPEGRVVSYEIREDFAKLAWENIKWAGFRVTIKLKDIYEGIEEENVDHVILDLPQPE--------------------------RVVEHAAKALKPGGFFVAYTPCSNQVMRLHEKLRE...................................... 209
27 -17.000[H] KOG1270 Methyltransferases  ali follow..  11  73.........................................LLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRL---GASVIGIDPVDENIKTAQCHKSFDPVRIEYRVCSLEEIVEETAETFDAVVA--EHVIDLE---------------------TFLQCCCQVLKPGGSLFITTINKTQLSYALGIVFSEQIAGIVPKGTHTWEKFV-LESILESNGLSVQTVVGM. 248
28 -17.000[A] KOG2793 Putative N2,N2-dimethylguanosine tRNA methyltransferase  ali follow..  14  69.......................................................RRRRGIELGTGCGVAGMAFYLL--GLTEIVLTDI-APVMPALKHNLKRNSLKTSIVYWNNRDQISALKPPFDLVIADVVYIE--------------------ESVGQLVTAMELLVADDGAVLLQIRSPEADKLFWELCDIVFKIEKVPHEHLAYEETDVYIFRKKVKKNEA....... 230
29 -16.700[J] KOG2915 tRNA(1-methyladenosine) methyltransferase, subunit GCD14  ali follow..  16  199...QILRSSFGKQYMLRRP-YVVLMKRGTAITFPK-DINMILSMM-------DINPGDTVLEAGSGSGGMSLFLSKAVGSQGRVISFEVRKDHHDLAKKNYKHWRDNVDFIHKDISGATEDIKSLFDAVALDML---------------------------VTLPVFYPHLKHGGVCAVYVVNITQVIELLD---------GIRTCELALSCEKISEVIVRDWLVCLAKQK... 401
30 -16.500[L] KOG2671 Putative RNA methylase  ali follow..  12  199............................PTAMDAE--AFLMANQA-------KATSGKLVYDPFVGTGSILVSAARF---GAMTMGADIDIRVVRDGRGPDCNVWSNVALLRMDNNV--SGLKEIFDAIICDPPYGVRAGGRKSGGRKILRGTVD-VECVHDLLHLAARMLVMKGRLVFFF-RDETGSEVKFPEHPCFKLVAVSEQILSSRVLLTMVKVEPYSEEVEE...... 423
31 -16.400[H] COG2226 Methylase involved in ubiquinone/menaquinone biosynthesis  ali follow..  13  26............................AHVFHSVASKYDVMNDLMSTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVGETGKVILADINDSMLKMGREKLRNIGVNVEYVQAN-AEALPFPDNTFDCITIS--------------------GLRNVTEKEKALRSMFRVLKPGGRLLVL...................................................... 169
32 -16.300[R] KOG2920 Predicted methyltransferase  ali follow..  19  170...................................ECTFDLLAYFTKAKVKFAGKK---VLDLGCGSGLLGITAFKG--GSKEIHFQDYNSMVIDVTLPNVVANLYKCRFFSGEWVLSSEKLFVKYDLILTSE-YNP--------------------DYYSNLHQTFLRLLSKNGRVLLASVGGGVHLFQKFVEERDVFKTRILKIIDEGLKRFIIEITFKFPG.......... 372
33 -16.200[L] COG1041 Predicted DNA modification methylase  ali follow..  11  163............................PIALPPR--ARAMVNL---------TKATREVLDPFMGTGGMLIEAGLI---GLKVYGLDIREDMVEGAKINLEYYGIRYVVKVGDATKEEVFPGKTFEAVATDPPYGNSTTLPM-----------DRNELYKRSLESIHSVLE--GRLAIAFPADFDARDVAESIGFKVLGRFYQRVHSSLSRFYVMEV................ 329
34 -15.900[R] KOG3115 Methyltransferase-like protein  ali follow..  14  74.................................................FDVESNKKVEIVDIGCGYGGLTVALGPQFP-DTLVLGMEIRMQVSDYLKEKIQALRYNISVLRMNCQKFLPNFFEKGQLFCFPDPHFKARKHKN-------------RIITSTLASEYAYFIRPHGTLYTITDVEELHVWMAQHLDA...................................... 223
35 -15.600[R] COG4798 Predicted methyltransferase  ali follow..  13  101..............................................EILAMAELKPGDTVVDYIMGGGYFTRIISGAVGPQGVVYAYQPAEFIRFAARYGESLKAVNSKPLDGPITAL--DLPDNVDAVITVQNY--------------MHLKPFPTDTAAKANAEIFKSLKPGGVFLVILHRIDIAAVKQEVEAAGFKLEVFDPAIRGKTDQFILKFRKPK............ 298
36 -15.300[IR] KOG1269 SAM-dependent methyltransferases  ali follow..  15  61..EEDRARRIDGYKSVVNSYYDLATDLYEYGWSQSYKGEAFAQSIARHAYRMGIKPGSRVLDVGCGVGGPAREITEFTG--CNLVGLNNNDYQISRCNNYAVKRNLKQVFVKGD-FMHMPFEDNTFDYVYAIEATVHAPS-------------------LEGVYGEIFRVLKPGGVFGV....................................................... 227
37 -15.200[J] COG2265 SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase  ali follow..  13  170.....................DFRYRQIEGGFT--QPNAAVCQKMLEWACGAAEGLGGDLLELYCGNGNFTLPLSEKFE---RVLATEISKTSVGAAQWNIEANGINIKIARLSAEEFTEAYTGKFSTIFVDPP-------------------RAGID------ETLKLVSQFDNIIYISCNPETLRANLDTLVEERAALFDQFPFTHHIESGVLLK................. 358
38 -15.200[R] KOG1331 Predicted methyltransferase  ali follow..  14  6..ENVEQEYVHSIYSRLATYQQKEHKPSSPRIWPRVRQFV-----------DQQSAGSIILDVGCGEA-------KYTSQKSHVIGFDTCSEVLSSSKKD------DIDLCLADAIN-IPIRDDSVDAILN---HLATTARRR------------------QVLQECSRCLRIGGQMLIYA..................................................... 143
39 -15.200[Q] KOG1663 O-methyltransferase  ali follow..  19  72..............................IMTTSADEGQFLNMLIKLV------NAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAGVKIDFREGPALPVLDEIHGTYDFI-----FVDADKDN-----------------YINYHKRLIDLVKIGGVIGY....................................................... 200
40 -15.000[S] COG1255 Uncharacterized protein conserved in archaea  ali follow..  10  1.........................................MIEVAEFIAREV--KKGKVIEVGIGFYTIAKRLKEL---GFDVLAIDINKDAVVNAKNS------GLNAEVDDIFNPNISLYMGAKAIYS---RPTPE--------------------MMNYILKISKAVKVPAYIVPLTGDPVP................................................ 113
41 -15.000[R] KOG3010 Methyltransferase  ali follow..  17  15...............................ARPRYPID-WFKKIAARTQ-----DHKFAWDVGTGNGQAAIGLVEHYE---NVVATDINEAQLQRAIKHSRISYHHTPTISEDEMVDLLGGENSVDLIVAAQAV------------------------LNVFYNVAKRVLRKEGGLIAV...................................................... 135
42 -14.800[R] COG4076 Predicted RNA methylase  ali follow..  21  11......................................NLLGDHERLAAEAISSRARGLTYDLGAGSGILSFFASE---YADRVIAIERDPKIAACAGENLSGLD-NVSVVNEDALH----EFSAADTIICE-----------------MLDTALIDEEQVPVLRRALKFLRNDGTVI........................................................ 128
43 -14.800[V] COG0286 Type I restriction-modification system methyltransferase subunit  ali follow..  21  162.............................EYYTPRAVTKFIVDRI-------KPQLGEIVFDPACGTGGFLTAAIDYIRQQRTIRGTEKKPLPFNLCVTNLILNGID-SAEHDNTLAR-YSPHERVDVIITNPPF---GGMEEDGIEDNFPATFRTRETADLFLVLIAHLLKEGGRGAIVL..................................................... 318
44 -14.600[R] COG4122 Predicted O-methyltransferase  ali follow..  16  56...................................................VQLLGAKKTLEVGVFTGYSSLIVALALPAEGKLVACDINEEFTAIAQRYWQKAGVKIDLYLAPALETLDKLAETFDFA-----FIDADKSN-----------------YDNYYERSLQLIRSGGVIAIDNVLWSGKVADPEIQDNRTQKIRAFNHKLLQDQRITLSLIPIGDGLTLVRKN... 220
45 -14.600[H] KOG1540 Ubiquinone biosynthesis methyltransferase COQ5  ali follow..  15  68............................GDVFSSVANRYDLMNDVMSAGKRPNSTTPLNFIDVAGGSGDIAFGLLDHAESESTMDIVDINPDMLKEGEKRAMEQGKRVRFLVSNGEKLEEIDSDSKDIY-------------------TVSFGIRNFTDIQKGLNTAYRVLKPGGIFYCLEFSKIENPLMDFAYQQWAKVLPVMGSMIANDY...................... 258
46 -14.600[O] COG2518 Protein-L-isoaspartate carboxylmethyltransferase  ali follow..  16  10MIEQQIRPWDVLDLDVLDLLAIVK----REQYVPEADMEIPLPVEARVLQELAVRKHEDVLEVGAGSGYMAALLAHRGR---HVTTVDIAPELVAFARDNLARNGVNVDVVQGDAGQGWGN--SLYDVICVS-------------------------GSVPAVPESLLAQLKVGGRLSIFVGSAPVMEAQLITRVSE..................................... 189
47 -14.500[R] COG0220 Predicted S-adenosylmethionine-dependent methyltransferase  ali follow..  19  30...............................................RWSERFGNDHPIHIEVGCGKGAFITGMAALHP-EINYIAIDMQLSVLSYALDKAIEADLNVQMMLVDLSEYFADGEIDQVYLNFSDPWPKGRHEKR-------------RLTYKSFLATYEKILRPEGEIHFKTDNRGLFEYSLVSLAN...................................... 168
48 -14.400[R] KOG2940 Predicted methyltransferase  ali follow..  14  83........................................VADNLLDRLEDCK-KSFPTAFCLGGSLGAVKRLLRGRGG-IEKLIMMDTSYDMIKSCRDASLDNSIETSYFVGD-EEFLPVKESSVDLIISS---------------LGLHWTND----LPGSMIQCKLALKPDGLFLAAILGGETLKELRIACTL...................................... 219
49 -14.400[QR] COG0500 SAM-dependent methyltransferases  ali follow..  13  99........................................AKNYCDEITERLELNDNSFVVEIASNDGYL---LQHFLPKNIPILGIEPAANVARTAIAKG---PTLVDFFGSRLALEMIGEGRKADLIIGNNVLAQVPDLND-------------------FVRGMQLLLKPEGLLRWNS..................................................... 215
50 -14.400[V] COG1002 Type II restriction enzyme, methylase subunits  ali follow..  12  206IIGWIYQDYIAPKKDKVFADLKKNIKISKELFTPHWIVRYLVENSLGRLLKINSPEELKICDPACGSGHMLVYAFDLL--THNLFGIEIDKRAGELAGLSGNLSHLSTHQKVLQALKQADYLSPKYHVVIANPPYMGNKGMNNRLKTFLQNNYADVKDLFSAFIVRNTELAFPKGQLGFMSPFV.................................................. 528
51 -14.300[R] KOG2730 Methylase  ali follow..  14  360...........................DQGIIMDREGWFSVTPEAIAEADRVVRNNVSVVVDAFTGVGGNAIQFALR----AHVIAIDMDPVRLKCARENARVYGVYIDFICADFFDVAATWQAKVDAVFLSPPWGGPSYLKAKEFDLATGCCPNGIDIFDVSLKICPN-------IAYFLPRNTKVSQLVELATKAKSRMEIEQSALNSK-VYYGKLAYREELSNSSKT.... 566
52 -14.200[A] KOG3045 Predicted RNA methylase involved in rRNA processing  ali follow..  14  142LASKLQSELLGGRFRYINELYSTTSRKAEALFRKDSSAF--LNRIIKTIKKIP--KTAIIGDFGCGEGKLAQSVPN------KVYSMDLVAARSDIIACNI---------------TDTPLQARTLDVAVYCLSLMGTD--------------------LNEFFLEANRVLKLHGTVYIAEIQSRFQDVREFVRCLNACGFDLNKKDVAVNYFYFFQFKKMRHVPKNTKMKAF. 348
53 -14.100[J] KOG2539 Mitochondrial/chloroplast ribosome small subunit component  ali follow..  15  184...................................APNYAEITRTLEEFNTIPDFQPETVLDFGSGAGAGFWAIQNKWPDVKEITMVDLSDAMMKFSMDEASQNGRPFVHNNVNFRRHLPSLNTTYDVVLAH--RVLCE----------IGSSETRLQLIESLWKRTNRFL-----ILIESSQTGAFGGLLEARD....................................... 335
54 -13.800[E] COG0421 Spermidine synthase  ali follow..  16  39......GKSKYQDVLVFESETYGHVLVLDGAIQATERDEFSYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREVVKH-ECVEEAILCDIDEDVIKVSKQSAGFNHPKVKVHIGDGFKFLQDYQNTFDVIITDSS------------------GPAEALFQKPYFQLLSDALRGGGVITTQAEC................................................... 204
55 -13.800[R] COG4262 Predicted spermidine synthase with an N-terminal membrane domain  ali follow..  12  239......ISSPYQRLVVTRWKDDLRLYINGNLQFSSRDEYRYHEALV-LPALESVRGARRVLVLGGGDGLALRQILKY-PQVEHVTLVDLDPRMTSLFSHQHAFSDPRVTVVNADAGQWLQTAADMFDVAIVDFP----------------SNFSIGKLYSVPFYRLLSRHVADTGLVVIQATSPYFAPRSYWCVDATLKEA................................. 425
56 -13.700[R] COG4976 Predicted methyltransferase (contains TPR repeat)  ali follow..  12  147..........................................................HVTDLGCGTGLFGERIRDR---ADFLEGFDLSANMLAKAEAKGVYDRLDLSLAPEDSGVFGALEQRRADLVSAADVLMYLGN-------------------LEGVFVIADRLLAPGGLFAFSVEDACGADGFVLRPSLRYASIASLCKESGLSMIATERTIIRRDAGEPVA..... 302
57 -13.700[D] KOG2360 Proliferation-associated nucleolar protein (NOL1)  ali follow..  206............................SKRFILQNKATCLAAELLA------PPSGATVLDMCAAPGMKTVHICNVMQNKGCIYSVEQDHVRYNTLCEITKDAGCDVKPILGDALNLTPERFPDVEYILVDPS-CSGSGMQNRMTVCDEPKEDKRLQKLIKILSHAMGAFPNVKRIAYSLWKEENEQVVQRCLQLN-NVLYCQPDSDLTDGIFLALFEKRREGEKD....... 433
58 -13.300[R] KOG2497 Predicted methyltransferase  ali follow..  16  153...................................PSSLFLSEFVLSFPELFANKA---CFEVGSGVGMVGICLAHVKAKE--VILTDGDLLTLSNMKLNLERNHVKCTHLPWETASESELSQYRPDIVLADVIYDP--------------------SCLPHLLRVLVALLKNPP........................................................... 286
59 -13.300[OKT] KOG1499 Protein arginine N-methyltransferase PRMT1 and related enzymes  ali follow..  23  226.......................GNDIHFLMLNDSVRTEGYRDFVYHNKHIFAGK---TVLDVGCGTGILSMFCAKA--GAKKVYAVDNSDII-QMAISNAFENGLAITFIRGKI-EDISLPVGKVDIIISEW-YALTFE-----------------SMIDSVLVARDRFLAPSGIMA........................................................ 359
60 -13.200[M] COG2230 Cyclopropane fatty acid synthase and related methyltransferases  ali follow..  20  130..ISRSSSNIKSHYDLSGELYDLPDKQYSCAYFDPPNATL-LAKKRHIAAKMLVKEGDKVLDIGCGWGGMGLYLARHLK--ANVTGVTLSEEQHAIANQRARDEGLRAKFELTD----YRNINDKFDRLVS----VGMFEH--------------GVGHFAEYFQHVARLMKPDGVFLLHA..................................................... 293
61 -13.100[J] COG0144 tRNA and rRNA cytosine-C5-methylases  ali follow..  11  233............................QGWWIVQDASAQLVGHLLD------PQPGEVIIDACAAPGGKTTHIAELMKDEGKVWAGDRTASRLRKLKENAQRLNLHIEICIGD-SRNLPQFYDVADRVLLDAP-CSGLGTLHRHADARWRQTPESVQELKELLAHTSKFVKVGGVLVYATCTLHPAENEEVITE....................................... 396
62 -12.900[O] KOG1661 Protein-L-isoaspartate(D-aspartate) O-methyltransferase  ali follow..  13  62.............................HLSAPCIYSEVM--------EALKLQPGLSFLNLGSGTGYLSTMVGLILGPFGINHGIELHSDVVEYAKEKLESFIKEPAFVVGNCLQIASD-SHQYDRIYC------------------------GAGVQKDHENYMKILLKVGGILVMPIEDQ.................................................. 194
63 -12.800[E] KOG1562 Spermidine synthase  ali follow..  17  67.............LVFESTTYGNVLVLDGIVQATERDEFSYQEMLA-HLPMFAHPDPKRVLIIGGGDGGILREVLKH-ESVEKVTMCEIDEMVIDVAKKSCGFSHPKLDLFCGDGFEFLKNHKNEFDVIITDDPVGPAESL-----------------FGQSYYELLRDALKEDGILSSQGEC................................................... 224
64 -12.600[L] COG3392 Adenine-specific DNA methylase  ali follow..  15  10........................................LIPFIKENIHAVAGHSGAIFCDLFAGTGIVGRTFKKA---VNKVISNDLEYYSFVLNQAHFDVSLNANEVYQQDSNDLIGK--ISGDILYLDPPYNARQYGANYHLLNTIAAYKSSFCSRFQILNAFENLIKKARFKYIFLSYNNEETEIKNILKKYGAYSLVTKAVHTKECLHVLI................. 328
65 -12.600[E] KOG2352 Predicted spermine/spermidine synthase  ali follow..  16  444...........................................AISPQQPLAKNDAQCKMAVLGLGGGLLTAYLVRHFK-KAHVTAVELDPEVLKIANSSFPHSDARIDVVIQDALIHLQETEEKYDVIFVDPSAFLTPE----------------------ALGNMKNSVKEQGMISLNLVTRDSEKSIKKNIAEYFPTLYTVLSFEDVNEIIIGLKTPKNTIKPVVPQKLIN 632
66 -12.500[A] KOG0820 Ribosomal RNA adenine dimethylase  ali follow..  17  38.......................................ILKNIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAK---KVVACELDPRLVAELHKRVQGTPVKLQVLVGDV---LKTDLPFFDTCVANLPYQISSPFVFKLLLHR-------REFALRLVAKPGD--KLYCRLSINTQLLARVDHLMKVGKNNFKNPPPPINFQEWDGLVRITFVRKNKTLSAA...... 241
67 -12.400[D] KOG0822 Protein kinase inhibitor  ali follow..  11  370.....................NLDSGVYNTFEQDQIKYDVYGEAVVGALKDLGADKTVVIYLLGGGRGPIGTKILKSEREKVKLYIVEKNPNAIVTLKYNVRTWKRRVTIIESDMRS--DRGFEQPDIIVSE-----------------LLGSFGDNELSPECLDGVTGFLKPTTISI........................................................ 528
68 -12.300[A] KOG1122 tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2)  ali follow..  10  363............................AGHYMLQGASSMLPVMALA------PQEHERILDMCCAPGGKTSYMAQLMKNTGVILANDANAERLKSVVGNLHRLGVTNTIISHYDGRQFPKVVGGFDRVLLDAP-CSGTGVISKDPAVKTNKDEKDIELLLSAIDSVNATSKTGGYLVYSITVEENEWVVDYALKKR-STRRFYPHTHNMDGFFIAKFKKFSNSIPQSQTGNSE 600
69 -12.300[J] COG0030 Dimethyladenosine transferase (rRNA methylation)  ali follow..  14  32.......................................ILKNVAQGIVDKADLKQSDTVLEVGPGTGNLTVRMLEKAR---KVIAVEMDPRMAAEITKRVQGTP-KLQVVLGDV---IKTDLPYFDVCVSNTPYQISSPLVFKLLQQR-------REFALRLVARPGD--PLYCRLSANVQMWAHVKHIMKVGKNNFKNPPPPLAFEEWDGLLRIVFLRKNKTIGAC...... 235
70 -12.200[S] KOG4174 Uncharacterized conserved protein  ali follow..  14  55......................................................EKNNRFLLLGEGNFSFAFSLLLHHVSEGFVLATSYSKEDLKQKYPDAAEYISKIEINGGKVMHEIDATKQKFDTIFWNFPHSGKGIKDQDR--------LDNQKMLLAFFKASKFLLSEKGVIVITLAETK................................................. 190
71 -12.100[M] COG0357 Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division  ali follow..  39.............................NLTSVRDPNEMLVRHILDSIVVAPYLQGERFIDVGTGPGLPGIPLSIVRP-EAHFTLLDSLGKRVRFLRQVQHELKLENIEPVQSRVEEFPS-EPPFDGVISR-----------------------AFASLNDMVSWCHHLPGEQGRFYALKGQMPEDEIALLPEEYQVESVVKLQVPALDGERHLVVIKANK............ 206
72 -12.100[V] COG3510 Cephalosporin hydroxylase  ali follow..  11  68............................................MWNYQEILSELQPSLVIEFGTRYGGSAVYFANIMRQPFKVLTVDNSHKALDPRARREP----DVLFVESS-IQRLKNEYPGKIFAILD--------------------SDHSMNHVLAEMKLLRPLLSAGDYLVVE-GPYEAIEAYEDEFPNDYKHDAERENKFGWTSAPNGFLIRN............. 245
73 -12.000[K] KOG0919 C-5 cytosine-specific DNA methylase  ali follow..  13  2........................................................PLIVSSSIMIHAKLIYTFEDAQLDGQIVAALDVNTVANAVYAHNYGSNLVKTRNIQSLSVKEVTK--LQANMLLMSPPCQP----------HTRQGLQRDTEALTHLCGLIPECQELEYILM-FESSQARNQFIESLERSGFHWREFILTPTQFYRYYCIARKGAD............ 170
74 -12.000[R] COG2520 Predicted methyltransferase  ali follow..  15  125......................................................LPGESVLIPFAGVGPFVLPSAGK---GAAVCAIEINPDACACLKENVRLNRLQVTVIQGDAEYILSHPENGFDRAIVPTPYDMDH-----------------------FLGEVSGNVRKEGKIHFYTFKTDSQILGLIEEYGNMGFEVECGNVAPGVSRWVFDLLKK............. 282
75 -11.900[J] KOG1253 tRNA methyltransferase  ali follow..  16  196...........................VTTQDGPKEAAKTAYESARR------ELKPPRVLEALSASGLRALRYAREVEGIGQVVALDNDPASVEACQRNIKFNGLMVESHLTDARVHMLSHPKDFDVVDLD-PY--------------------GAPS--IFLDSAVQSVADGGLLMCTATDMAVLCGANGEVCYSKYGSYPLKGKYCHERILLASIESHANR.......... 370

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 3 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.