current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [C] KOG3361 Iron binding protein involved in Fe-S cluster formation, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MFARLANPAHFKPLTGSHITRAAKRLYHPKVIDHYTNPRNVGSMDKSLANVGTGIVGAPACGDVIKLQIQVNDKSGIIENVKFKTFGCGSAIASSSYMTELVRGMSLDEAVKIKNTEIAKELSLPPVKLHCSMLAEDAIKAAIKDYKTKRNPSVLHLast
1 -89.500[C] KOG3361 Iron binding protein involved in Fe-S cluster formation  ali  100  1MFARLANPAHFKPLTGSHITRAAKRLYHPKVIDHYTNPRNVGSMDKSLANVGTGIVGAPACGDVIKLQIQVNDKSGIIENVKFKTFGCGSAIASSSYMTELVRGMSLDEAVKIKNTEIAKELSLPPVKLHCSMLAEDAIKAAIKDYKTKRNPSVLH 156
2 -74.600[C] COG0822 NifU homolog involved in Fe-S cluster formation  ali follow..  66  2.........................AYSDKVIDHYENPRNVGTFDKNDESVGTGMVGAPACGDVMRLQIKVN-DEGIIEDAKFKTYGCGSAIASSSLITEWVKGKSLDDALAIKNSEIAEELELPPVKIHCSILAEDAVKAAVADYRKRQENR... 128
3 -10.200[S] COG1810 Uncharacterized protein conserved in archaea  ali follow..  14  113LIVPVEEPRWCSPGLAKQIREKCDELGLEFAA-----PKPFCNLRPSEEHPTINRIGYPE--------FEIELLEDGKAYVRSRSQPCG----CAYYIGVKLRGFDFSEVKEGKMRELWNVVAEAHHSYPCGYIARHAVNRALGYEGDEDIPE... 273
4 -7.120[R] COG2166 SufE protein probably involved in Fe-S center assembly  ali follow..  33..........................................QLAPLTEQQRHPENLISGCQSQVWIAMTLSAEG----HVIFAGDSAAIVKGLVAVVFILYHDLTPQQIISLDVRPFFADLALTPSRSQGLEAMIRAIRTKVANLSAH....... 140
5 -6.620[S] COG3681 Uncharacterized conserved protein  ali follow..  12  324......................................................................................AATTAAMGAAAGMAWLVDGRYETISMAISSMIGDVSGMIGASNSCAMKVSTSASAAWK............ 383
6 -6.540[J] KOG1698 Mitochondrial/chloroplast ribosomal protein L19  ali follow..  13  136.............................................................GYIVQLKVEVPENKRRVS--IVK--GVVIARRNAGLIRRLVAGVGVESMFPLYS----------PNLRVIKVVDKKKVRRAKLYYLREKVNALKK 221
7 -6.530[O] COG0694 Thioredoxin-like proteins and domains  ali follow..  22  91............................ESVLDAEIRPHNDG-------------------GDLEVIDIQKAEGAAIDVYIRYLGSGCSSGSGATLYAIETILQEELSPNIRVMP......................................... 162
8 -6.160[C] COG2869 Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrC  ali follow..  15  135.............................................................WSVMYGLVSVQPDGNTINGITYETPGLGGEIENPNWASLF-KGKKLFDEQHQPAIRIVKG-EHSIDGLSGATLTGNGVQGTFNY........... 225
9 -5.980[E] COG1760 L-serine deaminase  ali follow..  15  282VTAPTNGACGIIPAVLAYYDKFIREVNANSLARYLLVASAIGSLYKMNASISGAEVG---CQGEV---------------------GVACSMAAAGLA--ELLGASPAQVCIAAEIAMEHNLGLT-VQVPCIERNAIAAVKAV............. 404
10 -5.890[B] KOG4140 Nuclear protein Ataxin-7  ali follow..  11  1MSERAAEPRRAAAAAGGAAAAAARQQQQQQQQQQ-PQPQRQQHPPPPPRRTRPEDGGPGAASTSAAAMATVGERRPLPSPEVMLGQSWNLWVEASKLPGK--EFGKNREVMGLCREDM-PIFGFCPAHVVCNDCNQVVKPQAFQSHYERRHSSS.. 173

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.