current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [KL] KOG4086 Transcriptional regulator SOH1, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst METKWLLSKVPDDKSRFEIELEFVQMLSNPWYLNFLAQHKYFEDEAFLQYLEYMEYWREPEYVKFIIYPTCLHMLTLLKNPQFRNDISRADLSKQVNDEIYYEWLGKGLQQYGSADDATLSQPQQEEDEKKVDVKKENELast
1 -76.000[KL] KOG4086 Transcriptional regulator SOH1  ali  100  1METKWLLSKVPDDKSRFEIELEFVQMLSNPWYLNFLAQHKYFEDEAFLQYLEYMEYWREPEYVKFIIYPTCLHMLTLLKNPQFRNDISRADLSKQVNDEIYYEWLGKGLQQYGSADDATLSQPQQEEDEKKVDVKKENE 139
2 -76.000[R] COG5088 Rad5p-binding protein  ali follow..  100  1METKWLLSKVPDDKSRFEIELEFVQMLSNPWYLNFLAQHKYFEDEAFLQYLEYMEYWREPEYVKFIIYPTCLHMLTLLKNPQFRNDISRADLSKQVNDEIYYEWLGKGLQQYGSADDATLSQPQQEEDEKKVDVKKENE 139
3 -6.750[K] COG3432 Predicted transcriptional regulator  ali follow..  10  32...........RKRGTMEIMFDILRNCEPKCGITRVIYGAGINYVVAQKYLDQLV--TENDRKIYEITEKGKLLRTHIEE........................................................... 106
4 -6.420[O] KOG2090 Metalloendopeptidase family - mitochondrial intermediate peptidase  ali follow..  15  773MSEEGAAKAEEQRQNENAFLLTWIVILIEGII---LAASGFLPEELDKLFVKYVYPVFTPSVVLFVAGTTAYGVLKYIQNEKMKGQ..................................................... 859
5 -6.410[K] KOG3404 G10 protein/predicted nuclear transcription regulator  ali follow..  16  55............QKTRYIFDLFYKRKAYSRELLDICYKEGLADK-------NLLAKWKKQGIGNLC----CLRCIQTRDTNFGTNCICRVPKSKLEVGRII...................................... 132
6 -6.390[E] KOG2348 Urea transporter  ali follow..  13  537.EDEIQQTKKLNRASVISKVAALIITAA-PMY----GTGYIFSKRFFTGWVVVGLIWIFFTVFAVGIFP------------EGRNDIYQ------VVSNMAASIFGRKVNDIVEDEGVVVETISIGSGSKEKVNFEKKD 660
7 -6.230[R] KOG2350 Zn-finger protein joined to JAZF1 (predicted suppressor)  ali follow..  19  38.VPPTAEGQVKLNGHQQEQE-LFLQAFEKPTQIYRYLRNRHETNPIFLN-LSYMKERMSRNNKK........................................................................... 100
8 -5.980[KE] COG3060 Transcriptional regulator of met regulon  ali follow..  26  7................................................EYISYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNN.................................................. 48
9 -5.840[KD] COG5132 Cell cycle control protein, G10 family  ali follow..  21  55............QRSRYIYDLYYKREAISTELYNWLLKQNYADG-------NLIAKWKKPGYEKL.......................................................................... 100
10 -5.650[S] KOG2765 Predicted membrane protein  ali follow..  3...........GRTQRLLLGISILVLVSSSELTKFLYNEANFDKPFFCTYFKTSMF--------------SIYLLVIGILAPWKESCERQNGNYAMMEQNADDENYYSNQAVLGDPTYVPIRSPHLGAGGQSNGTSNSI 121

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.