current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [T] KOG4252 GTP-binding protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRGSFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLRLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTNKNRNPFSSCSIPLast
1 -94.600[T] KOG4252 GTP-binding protein  ali  100  1MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRGSFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLRLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTNKNRNPFSSCSIP 237
2 -84.000[R] KOG0079 GTP-binding protein H-ray, small G protein superfamily  ali follow..  30  3.GTRDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSENYITTIGVDFKIRTMDINGQRVKLQIWDTAGQERFRTITSTYYRGTHGVVVVYDVTNGESFGNVKRWLQEIENNCDSVQKVLVGNKCEENERRVVLESDARNYAQSMNISFFETSAKEDKNVEPMFTCITSLVLTAKLANPQSASKDQSRTG---GVSLKDNSGSTNQKKKCKCG.......................... 209
3 -83.500[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  32  1MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVGFMIKTVEINGEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLPG----------EGKSISYLTCCN........................... 201
4 -83.400[U] KOG0087 GTPase Rab11/YPT3, small G protein superfamily  ali follow..  30  3.QEDEYDYLFKTVLIGDSGVGKSNLLMRFTRNEFNIESKSTIGVEFATRNIVLDNKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREHADNIVIMLVGNKTDLLHLRAVSTEEAQAFAAENNLSFIETSAMDASNVEEAFQTVLTEIFRIVSNRSLEAGDDGVHPTAGQTLNTMNDLNKKKSSSQCC............................ 214
5 -83.000[U] KOG0098 GTPase Rab2, small G protein superfamily  ali follow..  30  2....SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNNMVIMLIGNKSDLEARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYRKIQEGVFDINNEANGIKLGPQHSPSSPTGGLGGGSGCC............................ 214
6 -83.000[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  29  15.SDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQL---SDQQVPPHQDCAC............................ 220
7 -82.900[TU] KOG0078 GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins  ali follow..  31  1MSTKSYDYLIKLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQHAENVYKILIGNKCDCEDQRQVSFEQGQALADELGVKFLEASAKTNVNVDEAFFTLAREIKKQKIDAENEFSNQANNVDL----------GNDRTVKRCC............................ 200
8 -82.800[U] KOG0086 GTPase Rab4, small G protein superfamily  ali follow..  27  1.MAETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASNIVVILCGNKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDPERMGSGIQYGDASLLRQPRSAQAVAPQPCGC.......................... 213
9 -82.800[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  31  1MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRNERADVIIVLVGNKTDLVEKRQVSIEEGDSKGREYGVMFIETSAKAGFNIKPLFRKIAAALPGMESYSNTKNEDMVD-----VNLKPTSNSSQGDQQGGACSC.......................... 207
10 -82.700[U] KOG0097 GTPase Rab14, small G protein superfamily  ali follow..  28  4.APYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQRLTSEPQPQREGCGC........................... 215
11 -82.400[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  30  1.MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYASNVNKLLVGNKCDLTSQKVVSTETAKAFADELGIPFLETSAKNATNVEEAFMAMTAAIKTRMASQPAGGSKPPT---------VQIRGQPVNQQSGCCSS.......................... 202
12 -82.400[U] KOG0081 GTPase Rab27, small G protein superfamily  ali follow..  26  1MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC............................ 221
13 -81.400[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  29  4TNVDQKSFKFKIVLLGEGCVGKSSLVLRFVENKFSCKHLSTIQASFQNKTVNVEDCQADLHIWDTAGQEKYHALGPIYYRGSNGVLLVFDITDRKSFEKVKNWVLEIKTCLGTAEILIVGNKIDLEEERQVTRQDAEAYAESEGALYMETSAQDNVGISDAFESLTAKMIEHSRTRSTEPPSTNRS-------IRLIDNDEAERSKKCC............................ 206
14 -81.300[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  30  13.NTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDL--------TEPTQPTRNQCCSN.......................... 215
15 -81.000[R] KOG0091 GTPase Rab39, small G protein superfamily  ali follow..  28  1MVEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMDGTQIKLQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIHRPVFALVGCKLDLINHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKSGPNSLDFNLVVAEPEKSSCC............................ 218
16 -79.800[R] KOG0080 GTPase Rab18, small G protein superfamily  ali follow..  31  1.MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCNDIVNMLVGNKIDK-ENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQ------NKGVKLSHREEGQGGGACGGYCS........................... 204
17 -77.000[R] KOG0394 Ras-related GTPase  ali follow..  29  1.MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQAENFPFVLIGNKVDVDDSRVVSEKKAKAWCASKGIPYFETSAKVGTNVEEAFQCIAKDALKSGEEEELYLPDT----------IDVGTSNQQRSTGCEC............................ 206
18 -74.900[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  26  5.AANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVK--AKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALA---PPEVQVDEQLMQQYQQEMEQATA........................... 208
19 -72.600[R] KOG1673 Ras GTPases  ali follow..  17  93SSSDSDLVSLKISLLGDCQTGKTTFVVKYVGDEN-QSFLEMTGLNLMDKTFYVQGVTISFSIWDVGGDERSKDHIPIACKDAVAILFMFDLTSRSTLNSVFGWYSQARKWNKTAIPILIGTKFDDPNLQWTIVTQARAYAKVMNASLFFSSATHNINVNKIFKFILARLFNLPWKIDRNLT........................................................ 278
20 -67.300[R] KOG0083 GTPase Rab26/Rab37, small G protein superfamily  ali follow..  27  462..EDEFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAEDVVIVLIGNKADCSSERQVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGKFNVHDFV-----------RDNTKARSVCAQ.......................... 662
21 -65.100[R] KOG0395 Ras-related GTPase  ali follow..  22  12.LSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIE-DFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSELPMVICGNKNDHGECRQVPTTEAELLSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMS--PALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSKVLREGQARERDKCTI. 265
22 -50.200[R] COG2229 Predicted GTPase  ali follow..  16  4.........NKIIFTGPVGVGKTTAIAAISDEALVQTDATTVAMDYGAISL---DEDTKVHLYGTPGQERFNFMWEILSQGSMGLVLLLDNARTNPLKDLEFFLHSFRGLLEKAPVVVGITKMDIRSQPGIDVYHKYLAKHNLNVPVFEIDARKEDDVKQLVSAMLFSIDPGLE............................................................... 177
23 -47.100[R] KOG0393 Ras-related small GTPase, Rho type  ali follow..  26  4.........IKCVVVGDGAVGKTCLLLSYTTNAFPGEYILTV-FDTYSTNVMVDGRPINLSLWDTAGQDDYDQFRHLSFPQTDVFLVCFALNNPASFENVAKWYPEVSHHCPNTPIILVGTKADLREDQPVSHTQGYVMAKEIKVKYLECSALTQIGLKQVFDEAIRTGLTPPQTPQTRAKKS...................................................... 190
24 -34.600[T] KOG3886 GTP-binding protein  ali follow..  18  33.VLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDLGATILDRIHSLQINSSLGNLVLNLWDCGGQDTFMSQRDNIFRNVEVLIYVFDVESRELEKDMHYYLEAILQNSPDAKIFCLVHKMDLVQEDQKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIVYQLIPNVQQ.............................................................. 247
25 -34.200[S] KOG4273 Uncharacterized conserved protein  ali follow..  16  1.....MESRPGVLVVGSSGVGKRTLLSRLLSVEFEDSSESSSQTEVHGWTINTKYYTADVSVCISHICDEYSLPNLPNSHPLVALVMVFDLSELSTLVALQDWVSHTDINSFDI-LLCIGNKVDRVPHHLAHDEYRRRLSDIDDFGISETEGSSLLGSEDASLDIRGACLEWCSENNIEFIEACASNPDFDKCLSVDGDSQGVER................................ 210
26 -31.300[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  23  21.........MELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVG--FNMRKITRGN--VTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLKPQLAGIPVLVLGNKRDLPDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQSR............................................................... 186
27 -30.200[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  17  15.........IRIVVVGEKGSGKSSLIMAAARNTFHPNIPSLL--PYTNLPSEFFPDRIPATVIDTSSRPEDKGKVVKEVRQADAIVLTFAFDRPETLDRLSKWLPLFRQLEVRVPIIVAGYEVDNKEAYNIEQITSALMKQYREVTSIQWSAQRLDQAKDVLYYAQKAVID.................................................................. 179
28 -29.200[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  18  18.........VRILLLGLDNAGKTTLLKQLASEDIS-HITPTQG--FNIKSVQSQG--FKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELEEKLSCVPVLIFANKQDLLPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK............................................................... 182
29 -29.000[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  16  22.........MRILMLGLDAAGKTTILYKLKLNQSV-VTIPTVG--FNVETVTYKN--IKFNVWDVGGQDKIRPLWRHYFTGTKGLIFVVDSADSNRISEARQELHRIDREMRDCLLLVLANKQDLPSPAQITDVLQLDKLKDRLWNVQPTCALTGDGLLEGLAWLSQNAKLK................................................................. 184
30 -28.800[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  17  18.........MRILILGLDGAGKTTILYRLQVGEVV-TTIPTIG--FNVEQVTYKN--LKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMEEELAGAILVVLANKQDMDTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSR................................................................. 180
31 -28.700[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  18  18.........MRILMVGLDAAGKTTILYKLKLGEIV-TTIPTIG--FNVETVEYKN--ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMEDELRDAVLLVFANKQDLPNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK................................................................. 180
32 -28.600[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  13  17.........LRLLMLGLDNAGKTTILKKFNGEDID-TISPTLG--FNIKTLEHRG--FKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLEERLAGATLLIFANKQDLPSSNAIREALELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFT.............................................................. 182
33 -28.500[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  17  18.........YSILILGLDNAGKTTFLETLKKEYSLAKIQPTVG--QNVATIPVDSKQI-LKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVDEEIEGVPILMLANKQDRQDRMEVQDNKIAEHISARDSRVLPISALTGEGVKDAIEWMIVRLERNKKSR............................................................. 193
34 -28.400[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  20  19.........LRILILGLDGAGKTTILYRLQIGEVV-TTKPTIG--FNVETLSYKN--LKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMEEELQDAALLVFANKQDQPSASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVIKEE................................................................. 181
35 -27.200[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  16  21.........AKILFLGLDNAGKTTLLHMLKDERLV-QHQPTQH--PTSEELSIGK--IKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALDEALATVPFLILGNKIDLTNFTTGKGKVTLGDSGVRPLEVFMCSIVRKMGYGEGFKWLSQYI.................................................................... 192
36 -22.800[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  14  57..........TVLLSGLSGSGKTVLFYQLRDGSSHQGAVTSMEPNEGTFVLTKKGKVKPVHLIDVPGHSRLISKLEEYLPRAAAVVFVVDALERAASEYLYDILTNASVIKNKTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKLRVSRSAISTADIANDFTLGI........................................................................ 221
37 -20.600[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  21  64..........RILLMGLRRSGKSSIQKVVFHKMSPNELESTNKIC--REDVSNSSF-VNFQIWDFPGQIDFFDPTEMIFRGTGALIFVIDSQDDEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDQRANDDLADAGLEKIHLSFYLTSIYDH-SIFEAFSKVVQKLIPQLPT.............................................................. 243
38 -17.700[R] KOG2486 Predicted GTPase  ali follow..  19  137..........EFALVGRSNVGKSSLLNSLVRRKRLALTSKKPG---KTQCINHFRINDKWYLVDLPGKQDWNKFTKDYFLNLVSVFLLVDASIPVK-LEYASWLGQ-----NQVPMTLIFTKCDKRKKKKNGGKKPEANIKEFQ-PWIMTSSVTNQGRDEILLHMAQLRNYWLKH.............................................................. 318
39 -17.700[R] COG1084 Predicted GTPase  ali follow..  18  164..........TVVIAGFPNVGKSTLLRTLTGAEPEVADYPFTTKGIQIGHLERKWK--RIQVIDTPGNNIELQAMVALENIADVIMFIFDASETCGYTLESQ-LYLGIRSVFDIPVVTVFNKMDLAENVKYLEEYINMVED-----PLKVSAFEGRGVSKIIKKLEGLYEKETREAHDN.......................................................... 335
40 -17.600[E] COG4917 Ethanolamine utilization protein  ali follow..  12  3..........RIAFVGSVGAGKTTLFNALQGNYTLARKTQAVEFN-------------DKGDIDTPGHPRWYHALITTLQDVDMLIYVHGANDPES-----RLPAGLLDIGVSKRQIAVISKTDMPDADVAATRKLLLETGFEE-PMFELNSHDPQSVQQLVDYLASLTKQEEAGEKTHHSE....................................................... 159
41 -16.500[R] COG3596 Predicted GTPase  ali follow..  11  40..........VIGIMGKTGAGKSSLCNALFAGE-VSPVSDVAACTRDPLRFRLQIGEHFMTIVDLPGDTEYAALYREQLPRLDLILWLIKADDRALATD-EHFYRQVIGEAYRHKMLFVISQSDKAEPTSGGNILSTEQKQNIS-PVCAVSVRLQWGLRVMAERMIKCLPREPSSPVVA.......................................................... 226
42 -15.600[R] COG0218 Predicted GTPase  ali follow..  18  27..........EIALAGRSNVGKSSFINTMLNRKNLARTSGKPG---KTQLLNFFNIDDKMRFVDVPGREKWGCMIEEYLTTREAVVSLVDLRHDPSADDVQEFLKYY-----EIPVIIVATKADKIPRGKWNKHESKKLNFDPSDDFILFSSVSKAGMDEAWDAILEKL.................................................................... 195
43 -15.200[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  18  34LSEFTPDKIRNFGIVAHVDHGKSTLADRLLEGAVPPGQKQMLGITVKAQTAALRHRGYLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAANQGVQAQTIANFWLAFEK---NIQIIPVINKIDLPGADIKSETQLKNLFEFNPEECLHISAKSGLNVDKVLEAIIDRV.................................................................... 211
44 -15.200[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  18  171...........VLICGYPNVGKSSFMNKVTRAD-----VDVQPYAFTTKSLFVG-KYLRYQVIDTPG-EMCSITALAHLRAAVLFFLDISGSCGYTIAQQAALFHSIKSLFMNKPLVIVCNKTDLMPMENISEEDRKLIEESEEQVLLKMSTLTDEGVMSVKNAACERLLDQRVEAKMKSKKIND.................................................... 365
45 -14.000[R] KOG0410 Predicted GTP binding protein  ali follow..  16  311..........VVSLVGYTNAGKSTLLNQLTGANVLAENRLFATLDPTTRRVQMQNGK-EFLLTDTVG-AAFRA-TLEEIAESSLLVHVVDISHPLAEQQIEAVEKVMSEDVSSIPKLVVWNKVDR-----VDDPQKVKLEAEETGDTICISALTGEGLDDFCNAVHEKLKDSMVW.............................................................. 478
46 -13.800[M] COG0481 Membrane GTPase LepA  ali follow..  17  1.....MKNIRNFSIIAHIDHGKSTLSDRLIQTC-SMDLERERGITIKAQSVTLDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAIEM---NLEVVPILNKIDLPAADP-VAEEIEDIVGIDAMEAVRCSAKTGVGIEDVLEEIVHKI.................................................................... 180
47 -13.700[J] KOG1191 Mitochondrial GTPase  ali follow..  21  354.........LQIAIVGRPNVGKSSLLNAWSERAIVTEVAGTT--DVVEANVTVRG--VPITLLDTAGIRETNDISETAAKVADVIIMAVSAVEGWTEEDTE--DLFGGLLYLKQPMILVMNKIDCAPPGSCDQLEDQRKKEEVFHKSVFTSAVTGQGIEELEDAILEIL.................................................................... 533
48 -13.600[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  16  4........PLIIGVGGPVGAGKTMLIERLTRYLSTKGYSAAITNDIYTEEMCDKHPDLQLLFLESGGD----LSATFSPDLVDFSIYIIDVAQGEKIPRKGGQGMIKSD-------LFIINKVDLAPYVGANVEVMKADTLKSRKDFFVTNLKTDEGLKSVADWIEKRLQLALLEE............................................................. 206
49 -13.500[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  12  335....ELKSIADLGLIGLPNAGKSTILNKISNAKPKIGHWQFTTLSPTIGTVSLGFGQDVFTVADIPGASLDKGMGLEFLR-SNGWVFVLDLSNKNPLNDLQLLIEEVGTLEKTKNILIVCNKVDIDAEKSAKYLQVEKFSKSQEWDCVPISALREKT................................................................................ 499
50 -13.500[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  17  84LDDPDFDAKPMILLVGQYSTGKTTFIRYLLESDFPGRALSGFGNAFLNRCSTLPNQVLEVTIVDTPGIDRFTGVLEWFAERVDRIILLFDAHKLDISDEFKRCIEALAGNEDKIRIVL--NKSDMVDHQQLMRVYGALM.................................................................................................. 271
51 -12.300[R] COG0486 Predicted GTPase  ali follow..  19  228.........MKVVIAGRPNAGKSSLLNALAEAAIVTDIAGTT--DVLREHIHIDG--MPLHIIDTAGLREATDEAWSEIEQADRILLMLDSTEADNQDLEKVRSEFLTKLPSNIPVTIVRNKADLSGENEGIVEQN-------GYTVITLSAKTQQGIALLREHLKQSMGYQTNME............................................................. 394
52 -11.900[R] COG2262 GTPases  ali follow..  24  199..........TVSLVGYTNAGKSTLFNRITEARVYAADQLFATLDPTLRRIDVADVG-ETVLADTVG-AAFKA-TLQETRQATLLLHVIDAADVRVQENIEAVNTVLEEDAHEIPTLLVMNKIDMLEDFEPRIDRDEENKPIR----VWLSAQTGAGIPQLFQALTERLSGEVAQ.............................................................. 367
53 -11.800[P] COG0370 Fe2+ transport system protein B  ali follow..  14  4.........NTYCILGNPNTGKTSLFNALTGSY--EYVGNWSGVTVEKKVGTLRSKTGKL-IYDLNPISRDETVVTRFLEKFDCMLNIVDSSQIERNLNLTVQLLEY-----GAPVVMGLNMIDVAAGRGIHLN-IQNLAKKLRIPILPVVARSGKGTEDILSTLSEKHVAPAI............................................................... 166
54 -11.700[J] COG3276 Selenocysteine-specific translation elongation factor  ali follow..  13  1............MIIVTSG-GKTALLKALTTAHLPEEKKRGMTIDLGYAYLPLENKVLGF---DVPGHEKFLSNMLAGLGGVHYAMLIVAADEVQTKEHL-----AILRQLQFHEIIVVITKADRTNSESLIQTIKQDYSFLRNANYFVTSAETGQGISELRHYLANLAELADTQK............................................................. 169
55 -11.600[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  15  2.....IENLRNIAIIAHVDHGKTTLVDKLLKLS-SNDQEKERGITILAKNTAIKWNGYNINIVDTPGHADFGGEVERVMSMVDSVLLVVDAQDGPMPQTRFVTQKAFKAGLRPIVVV---NKIDRPGARP-VIDQIFDLFDNLGATDEQLDFPIVYASA.............................................................................. 167
56 -11.300[R] COG1160 Predicted GTPases  ali follow..  15  5..........VVALVGRPNVGKSTLFNRLTRTR-DALVADFPGLTRDRKYGHAHIAGYDFIVIDTGGEEKMAEQSLLAIDEADIVLFLVDA--RAGLTAADIGIANYLRQRQNKITVVVANKTDGIDADSHCAE----FYQLGLGEIEQIAASQGRGVTQLMEQVLAPFAEKMENADEND......................................................... 175
57 -11.000[R] COG1159 GTPase  ali follow..  15  1MSTDKTYCGF-IAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGI-HTEGPYQAIYVDTPGNRLMNKAASSSIGDVELVIFVVEGTRWTPDDEM---LNKLRD--GKAPVILAVNKVDNVQEKVDLLPHLQFLASQMNFLIVPISAETGMNVDTIAGIVRKHL.................................................................... 173
58 -10.700[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  17  183...........VTIMGHVDHGKTTLLDKFRKTQVAAVETGGITQHIGAFLVSLPSGE-KITFLDTPGHAAFSAMRA---RGAQ-VVLVVDGVMKQTVESIQH------AKDAQVPIILAVNKCDKAE---ADPEKVKKELLAYDVQAVPVSALTGDNLMALAEATV....................................................................... 339
59 -10.600[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  18  67IGEVLSRRHMKVAFFGRTSSGKSSVINAMLDKVLPSGIGHITNCFLSVEYLMTEGSDEKLVLVDSPGTTELDSWIDKFCLDADVFVLVANSESTLM-NTEKHFFHKVNEWLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVLEAQNRIFFVSAKEVLSARKQKAQG.......................................................... 298
60 -10.500[J] KOG0468 U5 snRNP-specific protein  ali follow..  16  124.LMDTPPLIRNVALVGHLHHGKTTFVDCLIRQTHPQFETMEEGCSIKATPVTLKQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQE---RQAITVCINKID................................................................................................................. 263
61 -10.200[R] COG0536 Predicted GTPase  ali follow..  19  149..AHDLILELKSMLVGFPSAGKSSLISVMSAAKFT-TLQPNLGV--------VNVGHETFTMADVPGASEGKGLGLDFLRHIERTSVLVHVVDRDPISDIEALEAELAAYQSALPRLVVLNKADVPEAEELAEFLKEDIEKQFGWPVFIISAVARKGLDPLKYKLLEIVQDARKKRPKEKAES...................................................... 354
62 -10.100[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  10  7.......FVRTVAILGGESSGKSTLVNKLAN-IFNTTSAWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTDFVTTQAFGREHPFVQALIDEYRFDLVILLERSLGSSVDRKEFQNLLVEMLEENNIEFVRVEEEDYDSRFLRCVELVREMMGEQR............................................................... 187
63 -10.100[J] KOG0469 Elongation factor 2  ali follow..  13  12.LMDRKRNIRNMSVIAHVDHGKSTLTDSLVSKA-TRKDEQERCITIKSTAISLKYNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAE---RIKPVLFMNKMDLQLGAEELFQTFQRIVENINVIIATYGDDDGPMGPIMVDPSIGNVG................................................................... 224
64 -10.000[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  20  19MIAQQHKSLLRFLTCGSVDDGKSTLIGRLLVDGLQAEREQGITIDVAYRYFSTEKR--KFIIADTPGHEQYTRNMATGASTCELAILLID-ARKGVLDQTRRHSFISTLLGIKHLVVAI-NKMDLVDYSEETFTRAGQLPGNLDIRFVPLSALEGDNVAS............................................................................. 215
65 -9.980[J] KOG0458 Elongation factor 1 alpha  ali follow..  15  168.........LSFVVLGHVDAGKSTLMGRWIMDQTNEERERGVTVSICTSHFSTHRA--NFTIVDAPGHRDFVPNAIMGISQADMAILCVD-CSTNAFESGFDLDGQTKEHM----LIIAMNKMDNVDWSQQRFEEIKS--FEDNINWVPISGFSGEGVYK............................................................................. 361
66 -9.950[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  17  42.........INIGTIGHVAHGKSTVVKAISTVRFKNELERNITIKLGYANAKI-RLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQ-NKIDLVKERQAKYEQILAFVQGTGAPIIPISAQLKYNIEVVCEYIVKKI.................................................................... 243
67 -9.890[J] COG4108 Peptide chain release factor RF-3  ali follow..  13  8.YFGEVSKRRTFAIISHPDAGKTTITEKVLLFGRAIQVAGTVGISVTTSVMQFPYGDCLVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDAAKGVEDRTRKLM----VTRLRDTPIVTFMNKLDREIRDPMELMDEVENELKIACSPITWPIGCGKEFKGVYHIHRDETI................................................................... 193
68 -9.810[DZ] COG5019 Septin family protein  ali follow..  15  94.......FNFNVLVLGESGSGKSTLVNTLLNRDVGVNPEPTVMINSSAVEIVENGISLQLNVIDTPGEGRYDQNPRSTIQDPRVHACIFFIQTGHAISAME--LRVMLALHEKVNIIPIIAKADTLTDDELNKEMILRDIQYHNIRIFFPPTYETDDPES............................................................................. 284
69 -9.470[J] COG0532 Translation initiation factor 2 (IF-2; GTPase)  ali follow..  20  448...........VTIMGHVDHGKTTLLDRFRESRVTEGEAGGITQHIGAYQIKANGKKITF---DTPGHEAFTSMRA---RGAS-TILVVDGVMPQTIEAINH------SKAAGVPIIVAINKIDKPGANPQRVTQPVAWDPENGSEFVEISAKFNQNLDELLDTVL....................................................................... 605
70 -9.380[J] KOG0459 Polypeptide release factor 3  ali follow..  18  93VAEANKKRHLNVVFIGHVDAGKSTIGGQYIMDTNEEERLKGKTVEVGRAHFETEST--RFTILDAPGHKSYVPNMISGASQADIGVLVIS-ARKGEFETGYERGGQTREHV----LIVVVNKMDDPTQKMVPFLKASGYNTKKDVVFLPISGLMGKNMDQ............................................................................. 298
71 -9.380[R] COG1163 Predicted GTPase  ali follow..  12  67..........SVGFVGFPSVGKSTLLSKLTGTEFT-TLVTVPGV--------IRYKGAKIQMLDLPG-RGRGKQVIAVARTCNLLFIILDVNKPHHKQIIEKELEGVGIRLNKTPPDILIKKKEKGGISITNTVPLTHLGNDEIRAVMSEYRINSAEIAFRCDATVDDLIDVLEAS............................................................. 238
72 -9.370[DTZ] KOG1547 Septin CDC10 and related P-loop GTPases  ali follow..  17  279.......FEFNIMVVGQSGLGKSTLINTLFKSKIEERIPKTIEIKSITHDIEEKGVRMKLTVIDTPGQEEVNINRKKRIPDTRVHCCLYFIPTGHSLRPLD--IEFMKRLSKVVNIVPVIAKADTLTLEERVKQRITADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMI................................................................... 477
73 -9.360[F] COG1618 Predicted nucleotide kinase  ali follow..  15  3.IEGKEKTMLRIAVTGSPGVGKSTVVAKTAEKLAEKPGFKIGG--IRTAEIRKEGHREGFSIRDLATGKKYHVNLDDLERIGANAVRNALACDLVVIDEIGPMELISQSFVSAVEEVLESDKPVLA---VLHHSSRHPLAQRFGFEVLTVDKGNRDELPEKITNRFLRKLG.................................................................. 184
74 -9.350[DZU] KOG2655 Septin family protein (P-loop GTPase)  ali follow..  15  34.......FEFTLMVVGESGLGKSTLVNSLFLTDLIEKQKQTVKLEASTVEIEERGVKLRLTVVDTPGDEQYERLNRRNIVDNRIHCCFYFISFGHGLKPLD--VEFMKKLHSKVNIVPVIAKADCLTKKEILKCRIMQEIESHGIKIYPLPDCDSDEDED............................................................................. 221
75 -9.350[P] COG3709 Uncharacterized component of phosphonate metabolism  ali follow..  13  18...........IVIVGPSGAGKDTLM-DYAAAQLSGRPGFHFTRRVITRSCDAGGEN-----HDAVSMHEFNQLEDAKY--EAGDVVIANGSRSA--------LPHFGTAFSRLKVVNIVARPDVLARRLEQRESRDDILRRLERSSLAVAVDNSGAIEDAGKTIMQVLQQSAGSSQ............................................................ 198

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 5 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.