current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: VFG011429(gi:17987394) (acpXL) acyl carrier protein [LPS (CVF383)] [Brucella melitensis bv. 1 str. 16M], from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
# Score Template Links and tools%idFirst MSSTFDKVADIIAETSEIDRDTITPESHTIDDLGIDSLDFLDIVFAIDKAFGIKIPLEQWTQEVNEGKVPTEEYFVLKNLCAKIDELVAAKKGLast
1 -53.600 VFG011429(gi:17987394) (acpXL) acyl carrier protein [LPS (CVF383)] [Brucella melitensis bv. 1 str. 16M]  ali  100  1MSSTFDKVADIIAETSEIDRDTITPESHTIDDLGIDSLDFLDIVFAIDKAFGIKIPLEQWTQEVNEGKVPTEEYFVLKNLCAKIDELVAAKKG 93
2 -44.800 VFG011430(gi:17987758) (acpXL) acyl carrier protein [LPS (CVF383)] [Brucella melitensis bv. 1 str. 16M]  ali follow..  32  1MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAAETILTVGDAVKFIDKASA............... 78
3 -43.900 VFG002445(gi:53722548) (bapB) acyl carrier protein [Bsa T3SS (VF0428)] [Burkholderia pseudomallei K96243]  ali follow..  15  9DAAALAAAKTLLAGMLGVPEAQIAPPQRLLDDLAMDSLELIELAMELDERWNIRLDRARLAEVATVADVAALLGAAARA.............. 87
4 -43.300 VFG021800(gi:15608484) (mbtL) Acyl carrier protein (ACP) MbtL [mycobactin (IA031)] [Mycobacterium tuberculosis H37Rv]  ali follow..  21  27PSTVSTTLLSILRDDLNIDLTRVTPDARLVDDVGLDSVAFAVGMVAIEERLGVALSEEELLTCDTVGELEAAIAAKYRD.............. 105
5 -33.700 VFG005770(gi:22536832) (acpC) acyl carrier protein AcpC [Beta-hemolysin/cytolysin (CVF171)] [Streptococcus agalactiae 2603V/R]  ali follow..  12  14RQEVVDEIKGILIDSLMLDDLIMNDQPLFGRGLELDSIDALELSIGISTTFGVELNDDDISILSSVNRLADFVIENSEDIDDQAK........ 101
6 -10.300 VFG000363(gi:16122159) (irp2) yersiniabactin biosynthetic protein Irp2 [Yersiniabactin (VF0136)] [Yersinia pestis CO92]  ali follow..  11  18.AADYQQLRERLIQELNLTPQQLHEESNLI-QAGLDSIRLMRWLHWFRK-NGYRLTLRELYAAPTLAAWNQLMLSRSPE.............. 93
7 -9.510 VFG016058(gi:15597620) (pvdL) peptide synthase PvdL [pyoverdine (IA001)] [Pseudomonas aeruginosa PAO1]  ali follow..  13  584.DELLARIGEIWKARLGVA--QVAPRDHFF-LLGGNSIGAAQVVAQVRDSLGVALDLRQLFEAPTLQAFSATVARQLAAGLPAEAPMAHLPRG 672
8 -9.110 VFG001822(gi:15609518) (mbtD) Polyketide synthetase MbtD (polyketide synthase) [Mycobactin (VF0299)] [Mycobacterium tuberculosis H37Rv]  ali follow..  14  915.LTIVDAVRTQLAAVLGIPQAGEVNLQESLFDLGVDSMLALDLRNRLKRSIGATVSLATLMGDITGDGLVAKLEDADERSHTAQKVDISRD.. 1004
9 -8.820 VFG001403(gi:15609520) (mbtB) Phenyloxazoline synthase MbtB (phenyloxazoline synthetase) [Mycobactin (VF0299)] [Mycobacterium tuberculosis H37Rv]  ali follow..  12 1060.TVLQRALRRIVADILGRANDAVGVHDDFF-ALGGDSVLATQVVAGIRRWLDPSLMVADMFAARTIAALAQLLTGREAN.............. 1137
10 -7.470 VFG000161(gi:15597595) (pvdD) pyoverdine synthetase D [Pyoverdine (VF0094)] [Pseudomonas aeruginosa PAO1]  ali follow..  12 1022.SELEQRIAAIWSEILGVE--RVGLDDNFF-ELGGHSLLATRVISRVRQEQQLDASLKALFERPVLEAFAQGLERTTDA.............. 1096

FFAS is supported by the NIH grant R01-GM087218-01
1 2 2 3 4 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.