current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [K] COG3682 Predicted transcriptional regulator, from VFDB

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# E-value Template Links and tools%idFirst MHITAAEAHVMEALWRRSPLSADELVAEVGAAQSWGEATVKTLINRLLKKKAIKSERAEGKHGYRPLVDRSAYVQAESQGLLDRLFDGQLAPLISHFAQHRPLKPDEVAKLKKLIDEMGELast
1 9.000e-46UniRef50_A0A1I4ITQ6 BlaI family transcriptional regulator, penicillinase repressor n=2 Tax=Paenibacillus TaxID=44249 RepID=A0A1I4ITQ6_9BACL  ali  31  6.RISDSEWEIMRIIWTKSPCTANDVIELLNDNTNWKPNTVKTFISRLVKKNVVSFKEDGRSYYYYPLVSEQECLKAESQSFLKRIYGGALKPMLVNFIEDETLSPEDIAELKRLLNDKQ. 124
2 4.000e-45UniRef50_A0A231RR20 Transcriptional regulator n=5 Tax=Bacteria TaxID=2 RepID=A0A231RR20_9BACL  ali  35  7..ISDAEWDIMRIVWQASPLTAADIISRLSGTKSWKPKTVKTLIGRLVQKGALGFSKDGREYAYFPLVNEEECVREASRSFLDRIYGGALKPMMVHFLESGKLSPDDIKELKDLLREKE. 123
3 3.000e-43UniRef50_R5EH92 Penicillinase repressor n=1 Tax=Firmicutes bacterium CAG:110 TaxID=1263000 RepID=R5EH92_9FIRM  ali  30  6.QISDAEFEVMDIIWKYAPISTNEITDRLAKTKDWSPKTIYTMLSRLEKKGVIVHEKESRVFVYTPCVKKDDYLAAESRTLADRFFDGAMKQMVVSFLDQKDLTPEDLDELQSILDKKR. 123
4 4.000e-43UniRef50_A0A142X3K4 Penicillinase repressor n=5 Tax=Planctomycetaceae TaxID=126 RepID=A0A142X3K4_9PLAN  ali  33  5VELSDAEWQVMNLIWERHPITAQDVIGTLAEPCRWSPATVRTMLHRLVKKGALHFTPEGNRYWYRAAVRRADCVRKAARSFLDRVFSGEAAPLLAHFVRTAKFTPDELAELRRLLDQQE. 123
5 3.000e-42UniRef50_A0A142WTY2 Penicillinase repressor n=1 Tax=Planctomyces sp. SH-PL14 TaxID=1632864 RepID=A0A142WTY2_9PLAN  ali  29  5LQISDAEWDVMERVWADGPCAAGDVIKSLRETHDWNHSTIRTLLARLVEKGALAYDVDGARYIYRAAVSRADCVRREGRSFLEKAFGGDVAALLAHFVEDASLDRDQVEQLRQLLAQKR. 123
6 6.000e-42UniRef50_A0A290QBJ7 CopY/TcrY family copper transport repressor n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A290QBJ7_9BACT  ali  30  4.KISSAEWEVMNVVWDRHPITALEVFSALPNDKEWAQKTVNTFLTRLVDKGVLGTTKEGKANVYSPLMAREECVQVESASFLQRVFQGAAGSLVLHFCENSNLTAEEITELERLLKSKK. 121
7 7.000e-42UniRef50_A0A2E0R2P3 Uncharacterized protein n=1 Tax=Verrucomicrobiales bacterium TaxID=2026801 RepID=A0A2E0R2P3_9BACT  ali  31  7.RISDAEWTVMRIFWEKGELGVGDVIDALAGETDWAPRTIQTLIRRLHQKGALSHKKSGRGFLYSPAVDEADCEHAASRSFLGSVFGGELAPFLANFLERESLNPEELEKLKRIVDE... 122
8 7.000e-42UniRef50_A0A2E4Z9H8 Transcriptional regulator n=1 Tax=Idiomarinaceae bacterium TaxID=1898113 RepID=A0A2E4Z9H8_9GAMM  ali  30  2IEISNAELEVMKVLWQEAPLPAIAIVERLQNTSDWQAKTIKTMLSRLVQKGALDYQQQGRAYLYHPTITEQDYQRHAGKNFVKRLFSGKVAPLVASFAATDNLSDDDIRELKALLDKLEQ 121
9 1.000e-41UniRef50_C0Z9N2 Putative penicillinase repressor n=15 Tax=Bacillales TaxID=1385 RepID=C0Z9N2_BREBN  ali  29  6.RISDAEWEIMKVIWEKSPATAADVIHALRDNKTWKDNTIKTLLSRLLQKGILTYEQVNRVYYYSPVLTEEECKRQERQSFLQRVYGGALKPMLVHFLKEEKLSSQEIDELKKILSEKE. 123
10 2.000e-41UniRef50_C8W112 Transcriptional repressor, CopY family n=35 Tax=root TaxID=1 RepID=C8W112_DESAS  ali  35  5.KISDSEWEVMKVIWKSSPLTSEEIIASLSEKKDWSPQTIKTFINRLLKKGAIGYEKTSRSYVYYPTISEKECVLAESKNFIERVYDGAAAMFFANFIEEKALSEEEIAKLKNLLEGKK. 122
11 3.000e-41UniRef50_A0A074MGC5 CopY family transcriptional repressor n=26 Tax=Proteobacteria TaxID=1224 RepID=A0A074MGC5_9SPHN  ali  40  15.RISDAEHAVMEALWTRGTLTAAEVCDAVCETRDWSLATVKTLLSRLVQKGAIATRPDGRRYLYSPKIARADYVGGESRRLVDRLFGGRPASLFAHLAEAEALSEDDLEEIEALLKEMR. 132
12 3.000e-41UniRef50_A0A1M3PKI8 CopY family transcriptional repressor n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1M3PKI8_9SPHN  ali  42  4.RISDAEHAVMEVLWRRAPLTATEVSEALEEDRDWSLQTVKTLLARLVGKKVVAHEADGRRYLYRPLVVRDAYVAHESQRLVDRLFGGRVTPLVAHLAETQQLSDQDIAEIEALLKALK. 121
13 5.000e-41UniRef50_A0A0J1IDL5 Penicillinase repressor n=565 Tax=Bacteria TaxID=2 RepID=A0A0J1IDL5_9FIRM  ali  36  6.KISEAEWEVMKIFWSRDPCTANEVVEALGDSCDWKPNTVKTLISRLVKKEALGFKEEHRIYFYYPLVTGDECVRAETESFVKRVFGGALKPMLVTFLRDEELSEDEIQELKRILEERQ. 124
14 5.000e-41UniRef50_A0A059FQF9 BlaI/MecI/CopY family transcriptional regulator n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A059FQF9_9RHOB  ali  35  1MKISAAELDVMGVLWERPGIAASDVHDALGAEKDWTSRTVKTLLARLVEKGAVVTTEDGRRYLYFPAIDEDSYKAKAAGQFIDRVFSGRAAPLVAHLADSRGLTKQDIAELEKLLGDLK. 119
15 6.000e-41UniRef50_A0A2V2FR35 Uncharacterized protein n=1 Tax=Subdoligranulum variabile TaxID=214851 RepID=A0A2V2FR35_9FIRM  ali  31  23..ISESEWRIMKIVWADAPLTLPEILDR-AKDTGWSKTTVQTYLARLVKKGALTTHRQGKGYLYAPAVSERDCQLAESRSFLQRVYDGSLSRMVLGFVDSGRLSQEELRELKRLIDQ... 136
16 7.000e-41UniRef50_F7RXZ2 Putative transcriptional regulator n=3 Tax=Alteromonadales TaxID=135622 RepID=F7RXZ2_9GAMM  ali  33  2VEVSNAELRVMQVLWQRSPQTAQEIVGQLQQDFDWHEKTIKTMLSRLTQKNALTYTQQGRSYLYSPAISEKAYQEKASKSFVQRLFSGNVTPLVAHFAEKGELSDKDISELKALIEKLED 121
17 9.000e-41UniRef50_A0A173X6Q4 Regulatory protein BlaI n=15 Tax=Firmicutes TaxID=1239 RepID=A0A173X6Q4_9FIRM  ali  28  6.QISEAEYEVMKVIWKYAPISTNDITDKLLHTTSWNPRTIQTLIKRLSDKSAISYEKKGRMFVYSPVISQEEYRKHESSSFLKKFFNGHISDMVSAFVDSDELSADDIKELQDILN.... 120
18 1.000e-40UniRef50_UPI0009FA95B2 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Fuerstia marisgermanicae TaxID=1891926 RepID=UPI0009FA95B2  ali  24  59VKLGGRQLSVMRVLWEHGEATVAEVQQFLDTDPPLAYSTVATVLSRMERKGLIAHRTKDRQYCYRPVVSKDGAGQSLVGELVDRVFGGSPAELVNHLLASDQIDKDELERIKELIEHAK. 178
19 1.000e-40UniRef50_UPI0009465DE2 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Mariniblastus fucicola TaxID=980251 RepID=UPI0009465DE2  ali  32  6..ISNAEWQVMNIIWDTQPTTASEIIKQLTQTTEWTPATIRTFLHRLVKKGALNFEEDGNRYLYRAAITRHSTVKHASRSFLTSVFDGQSGPLLTHFVKASQLSAEDIQKLKSLLEQKE. 122
20 1.000e-40UniRef50_A0A248TH24 Transcriptional regulator n=4 Tax=Bacillales TaxID=1385 RepID=A0A248TH24_9BACI  ali  25  7.NISESEWAIMNVLWDHSPRTANDIIQSLQKNTDWKPKTIRTLLDRLVQKSVVAVDKSQKVYTFSPLYSQEECQKAETQSFIQRIYGGTLKSMLVHFIQDDKLSDKDIKELRSILNEKPE 125
21 1.000e-40UniRef50_B4SL97 Transcriptional repressor, CopY family n=24 Tax=Proteobacteria TaxID=1224 RepID=B4SL97_STRM5  ali  22  8.NPTPAEQAILDILWDKGEASVRDVADVLGQQKPVAYTTVLTMFNVLAKKGFVSHRQEGRAYIYHATLSREQARRQALDHLLHQFFDGSPNVLAQHLVDEREIDRNELQALQQRVSDAR. 125
22 2.000e-40UniRef50_B2A1U7 Transcriptional repressor, CopY family n=1 Tax=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) TaxID=457  ali  29  7.KISDSEWEVMEVLWDDSPIPSSAIIERLQPQTDWKPKTIHTLISRLVKKGVVGVEKNTTRYLYYPLLSKEECRLTETETFLEKVYNGSVSMLVANFIKQDRLSQQEINELKKLLDD... 122
23 4.000e-40UniRef50_A0A1M6MZ57 BlaI family transcriptional regulator, penicillinase repressor n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1M6MZ57_9FIRM  ali  31  7..ISESEWRVMKIVWSNSPQTLPEILDRLKE-TGWSKTTIQTYLARLVKKGALTTKRQGKGYLYYPAVSESECQLAESRSFLSRVYDGSLSKMVMGFVKNGNLSSDELHELKSLIEQQE. 122
24 4.000e-40UniRef50_A0A2A8HSC4 CopY family transcriptional repressor n=3 Tax=Sphingomonadaceae TaxID=41297 RepID=A0A2A8HSC4_9SPHN  ali  41  10.RISEAEYAVMDVLWKHSPLSASDVCDKVCGERGWSLATVKTLLSRLVAKQALATQPEGKRFLYSPLIARADYVGTESRRLVDRLFGGRAAPLFAHLAQTEALTSDDIAEIEALLQELKQ 128
25 6.000e-40UniRef50_G2ISF9 BlaI family transcriptional regulator n=5 Tax=root TaxID=1 RepID=G2ISF9_9SPHN  ali  42  4.RISDAEHAVMEVLWRRSPLTAIEVSEALADERDWSLQTVKTLLARLVSKDVIAHEADGRRYLYRPLVERESYVTHESRRLVDRLFGGQISPLVAHLAETQQLSDKDIAEIEALLKALK. 121
26 6.000e-40UniRef50_A0A140AT94 Penicillinase repressor n=11 Tax=Firmicutes TaxID=1239 RepID=A0A140AT94_CLOBO  ali  31  6.KISETEWKVMKIIWSNPYITANEVIDILDDYVEWKPKTVKTLLNRLLNKGAIHFEKEGREYKYYPLVSEDECIREENKSFLDKVYNGAFKTMIANFIEEQNLTKEDIDDLKKLLEK... 121
27 6.000e-40UniRef50_UPI0009E7E972 BlaI/MecI/CopY family transcriptional regulator n=2 Tax=Terrabacteria group TaxID=1783272 RepID=UPI0009E7E972  ali  20  4VKISDAEYEIMEIIWDIGEVTTADIIDRLGKDNPWKHTTILTLAKRLVDKNVLKVRKESRVNYYSPTISKDEYKSYQADDFIEDMYDGSIKSLVASLYNNKKIDKEDIEELKDWIRR... 121
28 7.000e-40UniRef50_A0A1M4TK30 BlaI family transcriptional regulator, penicillinase repressor n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1M4TK30_9FIRM  ali  27  6.KISNSEWDVMEILWEKNPLSSKEIIEKAGQKRDWKPTTIKTLISRLVDKNILSYEKIGKSYYYYPLLKKEECISVTSNKFINKFYKGELKAMLASFIEEYELSNEDINELKEILDKKK. 123
29 7.000e-40UniRef50_U5QJL0 CopY family transcriptional regulator n=16 Tax=root TaxID=1 RepID=U5QJL0_9CYAN  ali  25  9..LTEAELRLMEVLWQRGEATVAEVVEALPKRLALAYSTVLTTMRILEQKGYVRHTEEGRAYVYHPLIDRNQARRSAVQYVVSRFFNNSPELLMLNILENEAIDADELERLKAMIKNAQE 126
30 8.000e-40UniRef50_A0A1P8WH45 Regulatory protein BlaI n=1 Tax=Fuerstia marisgermanicae TaxID=1891926 RepID=A0A1P8WH45_9PLAN  ali  25  1MKLGGRQLSVMRVLWEHGEATVAEVQQFLDTDPPLAYSTVATVLSRMERKGLIAHRTKDRQYCYRPVVSKDGAGQSLVGELVDRVFGGSPAELVNHLLASDQIDKDELERIKELIEHAK. 120
31 8.000e-40UniRef50_A0A1S8LI04 Penicillinase repressor n=7 Tax=Clostridiales TaxID=186802 RepID=A0A1S8LI04_9CLOT  ali  31  3.NISDSEWKVMKVIWSKPPMLASEIIEKLSEETDWNPKTIHTLIRRLVTKGVLKAEKEKNYYSYYPLVSEEECVQAETKTFLEKCFEGSFNVMISNFIKGDKLSDKEIDELEKLLESKK. 120
32 8.000e-40UniRef50_A0A2W4KD26 Uncharacterized protein n=1 Tax=Caldicoprobacter oshimai TaxID=551788 RepID=A0A2W4KD26_9FIRM  ali  28  4VKISDSELKIMQVLWDNNPIFSSDIVKALAD-TGWDPKTIHTFLRRLVSKGIVKATKKGTFYEYTPLISRDEYVIKESKSFLNKIFNGSLSNMVYKFVNEGELSADEYQRLKDLLE.... 118
33 1.000e-39UniRef50_Q188R8 Transcriptional regulator, Penicillinase repressor n=28 Tax=Firmicutes TaxID=1239 RepID=Q188R8_PEPD6  ali  29  6.HISEAEYQVMKIIWKYAPISTTEVIEKLVETSTWSPKTIQTMLLRLVKKGALTYEKNSRVFVYTPLVKEEEYVATESSSFLNRFYNGTLNSMVLNFLENDKLSEDDIEELREILNKR.. 122
34 1.000e-39UniRef50_A0A1U7CJ00 Penicillinase repressor n=1 Tax=Paludisphaera borealis TaxID=1387353 RepID=A0A1U7CJ00_9BACT  ali  24  14..PSQAQLAIMQVVWDRGEATVADVWKTLAEARPVARNTIQTMMTRLEEKGWLRSTAEGRAFLYRAARTREQVLGGMVKRLLDSAFGGSAEGLILTLLKERGVSPDEAKRIRKMID.... 127
35 1.000e-39UniRef50_A0A2T6DKC3 Uncharacterized protein n=1 Tax=Opitutaceae bacterium EW11 TaxID=2161865 RepID=A0A2T6DKC3_9BACT  ali  32  5.RISSAEWEVMNVVWSKHPIAASEVFSALPPEREWKLKTVNTFLARLVEKGVLGVEREGKANVYRPLLKREECVEAEGDSFLQRVFQGAAGSLVVHFCERADLSRDEIAELEAILKAKK. 122
36 2.000e-39UniRef50_A0A0N1B323 CopY family transcriptional repressor n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A0N1B323_9PROT  ali  41  3.RISDAEAAVMDVLWTDSPLTAQQVVKRVPSERGWSANTVKTLLARLVAKRAVAHEPDGGRYLYRPLMARGDYVAGESRRLVDRFFGGQVTLLVAHLAEREALGPAEIAEIEALLKNLK. 120
37 2.000e-39UniRef50_A0A2E1VS80 Transcriptional regulator n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2E1VS80_9BACT  ali  41  6.RISDAEWLVMEAIWGQAPRSAGQIAEEVGPANEWSEATVKTMLARLVKKGALDFERDGKRYLYRAAVPREACVRSEAREFQERMFGGRTSPLLAWFVKESPLSDTEIEELRALLDEK.. 122
38 2.000e-39UniRef50_A0A140DME2 Penicillinase repressor n=42 Tax=Firmicutes TaxID=1239 RepID=A0A140DME2_CLOBE  ali  28  6.KISEAEWEVMKIVWTDSPRTSNQIIEALEDTKDWKPKTIKTLISRLVSKNALGFKEEGRKYLYYPIVNENECIRAENQTFLSKVYNGAIKNMLVSFIKESDLSKEDIDDLKRILDER.. 122
39 2.000e-39UniRef50_A0A0Q8XQX3 CopY family transcriptional repressor n=6 Tax=Sphingomonadaceae TaxID=41297 RepID=A0A0Q8XQX3_9SPHN  ali  42  4.RISDAEHAVMEVLWEESPLTAQEVAERVPAERDWSANTVKTLLGRLLAKSIIAHEEDGRRYRYRPLVARSDYVVGESRRFMDRLFGGKLTPLVAHLAERDAITDQDIAEIEALLKDLK. 121
40 3.000e-39UniRef50_A0A143WW49 Penicillinase repressor n=1 Tax=Clostridiales bacterium CHKCI006 TaxID=1780379 RepID=A0A143WW49_9FIRM  ali  30  6.KISQAEYIVMDVIWDEGPLSTPEIVARLQDFHDWSPKTIHTLLVRLEKKGAITHTRQSRTYVYAACLDRKTYLDQQTHSFLERFYHGRLPKLVSYLVDEKKLSQEDIEALSELVEKAK. 123
41 3.000e-39UniRef50_A0A1V6JSS0 Penicillinase repressor n=2 Tax=PVC group TaxID=1783257 RepID=A0A1V6JSS0_9BACT  ali  25  8.RLGDLQLRLMQSLWARGEASVAEVHATLPDDANLAYTTVATMLRKMEARGLVRHRVEGRTFIYSAAVAEEQVSGGMAEHVLDRLFGGSVEALVSHLLTRREVSRDELARLRKLIAER.. 124
42 5.000e-39UniRef50_A0A1A7UM77 Copper transport repressor, CopY/TcrY family n=6 Tax=Enterococcus TaxID=1350 RepID=A0A1A7UM77_ENTFC  ali  29  5IKITDAELKIMEFVWKNSPVDSTEIVRAFEKDEEWSPNTIRTLLVRLEQKGVIDHTKAGRVYVYHAIIPRDYFVKQESQKFISKFFDGKVSEFLSNFVADESIDEKEIDELRNLLDKRR. 123
43 5.000e-39UniRef50_A0A257UCA1 BlaI family transcriptional regulator n=1 Tax=Planctomycetia bacterium 21-64-5 TaxID=1970542 RepID=A0A257UCA1_9BACT  ali  24  5.RLGRVQLVIMQVLWERGRATAREITDAINRREPIAHSTVQTLLRGLEEKGAVSHEAQERTFVFFPLVEEQEFKQSATRDVLERVFGGSASGLVAHLLKNENVSREEIEEIRKLINRR.. 121
44 5.000e-39UniRef50_A0A2V5VJT4 BlaI/MecI/CopY family transcriptional regulator n=2 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5VJT4_9BACT  ali  32  12.QISDAELVVMKVVWEKAPVTANQAVEALARQQHWKPKTIHTLLRRLVQKGAVDFDKKGREHRFRPLVNSADYAHAASRSFLRRFFDGEVAPFLACFLEWEKLSRQEIQELRRILDGKQ. 129
45 5.000e-39UniRef50_A0A1H2DS60 BlaI family transcriptional regulator, penicillinase repressor n=2 Tax=Verrucomicrobium sp. GAS474 TaxID=1882831 RepID=A0A1H2DS60  ali  37  35.KISEAEWEVMKIVWRTGGATAQQVHEALFPGKGWQEATVKTLLNRLFRKRLLKAERNGRAYLYRPLLTEAECRAAEADSFLARIFDGSLSPLLAHFVASKKLSEREIAELETIL..... 151
46 5.000e-39UniRef50_A0A0D3VHB4 Beta-lactamase n=2 Tax=Paenibacillus sp. IHBB 10380 TaxID=1566358 RepID=A0A0D3VHB4_9BACL  ali  25  7..ISDSEWEVMRAIWHRGEMTAAEVIDSIADEMDWSPKTVRTLLSRLVSKNVLAIKQETRPFVYYPLVSEAACQSAVTKSFFKRIYNGTFKHFLVNFVEEGELSQQDIDSLKQILQEKE. 123
47 6.000e-39UniRef50_UPI0005951CE2 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Verrucomicrobiae bacterium DG1235 TaxID=382464 RepID=UPI0005951CE2  ali  29  6.KISDAEWEVMKVVWDHAPMTATEVLDRLPHEQ-WKQKTVNTFLARLEQKGVIESKREGRANVYSCLLSEGECRRTEGSHFLSKVFRGKVAPMMLHFIENEELSDGELDELRAILDRK.. 121
48 6.000e-39UniRef50_A0A1I5RDJ2 Transcriptional repressor, CopY family n=1 Tax=Oscillibacter sp. PC13 TaxID=1855299 RepID=A0A1I5RDJ2_9FIRM  ali  27  3INLSDSEWKLMNRLWDGAPLTIMELTAALREDTGWSKNTVITMLSRLEAKSAVRHEEGGRAKRYFPAVNREDAALTETENFLDKVYGGSLGLMMSAMVESRALSEADIAELSAILEKA.. 120
49 6.000e-39UniRef50_A0A2P7PZ51 Uncharacterized protein n=1 Tax=Peptostreptococcus russellii TaxID=215200 RepID=A0A2P7PZ51_9FIRM  ali  23  7.NISDAELEVMNILWEKDSATSRELSSILEKKKDWKNTTVKTLLSRLVDKGFLGTEKVSNYFVYSALISKESTLEYLTRNFNSNICSKSVADVIYQLINDNDLSSDDISRLENLLKKK.. 123
50 6.000e-39UniRef50_UPI000B4477C3 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Paenibacillus donghaensis TaxID=414771 RepID=UPI000B4477C3  ali  35  6.HITEAECEVMKLLWEKEPLSANEIIIKLKQQMQWSDQTIKTFLNRLHNKKAIRFEKSGRNYIYYPLVSHDEYLQTENRSFLDRVYNGAVGLMCAKFLQEEQLSEKDIEELQQLLENKK. 123
51 8.000e-39UniRef50_A0A1W2F768 Predicted transcriptional regulator n=12 Tax=Bacteria TaxID=2 RepID=A0A1W2F768_9SPHI  ali  21  8.RPTESELEILQILWDKGNCTVREVHEILEKSKDAGYTTTLKLMQIMHEKGLVARDTSSKTHIYRALVNQEKTQQHLVNKMIDNVFNGSAARMVMQALGNHKASKDEIDSIKKYLDEL.. 124
52 8.000e-39UniRef50_A0A1V5ZTQ4 Transcriptional repressor CopY n=3 Tax=Bacteria TaxID=2 RepID=A0A1V5ZTQ4_9BACT  ali  24  9.KLTELESVIMDAVWELGQATVRDVQEHLQAARPMARNTVLTMMGILRDKGFLVSTREGRADVYRPTVSRNQMSRHSLSEVLDRFFGGSAFALVSQLLDSGDVGTEEIEAIRKEINRR.. 125
53 9.000e-39UniRef50_C6XYH3 Penicillinase repressor n=9 Tax=Pedobacter TaxID=84567 RepID=C6XYH3_PEDHD  ali  25  6..LTKAEEQLMQIIWQIEKGFVKDVMDYLPEPKP-AYNTVSTIIRILETKGFIGHEAFGKSHQYYPLISREDYKRHATEKLLDNYFENSVESMFSFFVKEEKLDLSDVDEILKMINKIK. 121
54 1.000e-38UniRef50_A0A062UQW4 Beta-lactamase n=17 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A062UQW4_9RHOB  ali  30  1MKISAAELEVLSVLWEQPGIAASDVHEALANDKDWTSRTVKTLLSRLVEKGAVSTQEDGRRYLYIPAIDEESYKAKAAGQFIDRVFSGRAAPLVAYLADSRGLTSQDIEDLEKLLGDLK. 119
55 1.000e-38UniRef50_B9XGT9 Transcriptional repressor, CopY family n=3 Tax=Bacteria TaxID=2 RepID=B9XGT9_PEDPL  ali  30  17..ISESEWKVMKVIWGMPPQPASQIIEALSDE-DWHPNTIKTLLSRLHKKKAVGIQKDKNHYLYFATVSEADSVQVESESFLSRVFGGSVKPLLMHFVDKQKLSSSDLEELRKMLKQKQ. 132
56 1.000e-38UniRef50_A0A1Y4S4F0 Transcriptional regulator n=1 Tax=Flavonifractor sp. An135 TaxID=1965558 RepID=A0A1Y4S4F0_9FIRM  ali  23  3VHLSDSEWKLMDALWSGNGSTITELTRAMAPDTGWSKNTIITMLARLESKGAVTHTEEGRAKRYAPLLSRSDAQRTATEQFLGKVYGGSLGLMMSAMVRGRALSQQDIDELASILEQAKE 122
57 1.000e-38UniRef50_A0A0N8Q6B9 Penicillinase repressor n=91 Tax=root TaxID=1 RepID=A0A0N8Q6B9_9GAMM  ali  34  2IELSKAEFDVLDALWINYPATASQIIERLSDDKQWHEKTIKTLLGRLVKKGALTFEKDGRQYIYTPCMERADYTLKESKNFIERFFSGRIAPLVSGFAKSEQLSQQDINELKKVIDDWE. 120
58 1.000e-38UniRef50_A0A258AUM2 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium 12-59-8 TaxID=1970608 RepID=A0A258AUM2_9BACT  ali  27  12.KISDAEWTVMNVFWQRGTSTLAEVVKDLEGRLHWKPRTVQSLIRRLTDKGALAFEAVGREFRYSPAVAQDQCQHEESRSFLDRVFNGRLTPFVAGLMDREDVSQDDLDALREVLNQAE. 129
59 2.000e-38UniRef50_A0A265UVQ5 CopY family transcriptional repressor n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A265UVQ5_9FLAO  ali  26  3.QLTKAEEEIMQALWQLKKANVKSVIEILPNPKP-AYNTVSTIIRILESKGFVDYEKQGKGHIYFPLVKKEAYSNQSINKLVDNYFQGSFKSMVSFFVQKNDVDAKDIEGLLKEINQNK. 119
60 2.000e-38UniRef50_U2DAL6 Transcriptional regulator, BlaI/MecI/CopY family n=4 Tax=Clostridiales TaxID=186802 RepID=U2DAL6_9FIRM  ali  30  5INVTDAELEIMKVIWRKSKVTAKEISEALEESIKWSPSTVKTLLGRLCSKGIISFNKKGKEYYYFSLVSKENYSIEESKSFLDKLFNGSLNLMLLNFVKNKKISKEEAEELRKILGEVE. 123
61 2.000e-38UniRef50_A0A1G0ZKX1 Transcriptional regulator n=1 Tax=Lentisphaerae bacterium GWF2_52_8 TaxID=1798575 RepID=A0A1G0ZKX1_9BACT  ali  33  6.KISDAEWEVMREIWEQPGITANEIVAKFAGRKDWSPHTIRSLANRLVKKGAVGYAVQGKHYCFLPLVSKEECIHKESQSFLDRIFDGELSPLFAHFVKSKQISRKELEELKRILTETE. 123
62 2.000e-38UniRef50_A0A1B6YEL0 BlaI family transcriptional regulator n=26 Tax=Bacteria TaxID=2 RepID=A0A1B6YEL0_9BACT  ali  16  8..LGESEMEILHHVWELGEATVAEVQELILKKRKIAYTTVMTIMKNLNDKGFLKYRKQGVTYVYSAAIEPENVQSSLISNLINKVFKGSPSALVQTLVKGENLSEDELKAIRNMIDNMED 125
63 2.000e-38UniRef50_A0A254WJN6 Uncharacterized protein n=1 Tax=cyanobacterium TDX16 TaxID=1503470 RepID=A0A254WJN6_9CYAN  ali  24  29..LGDAELEVLKVLWDEGPATVRDVMNVLHDRKKVAYTTVLTFLSRLEQKELVASDKSGLAYVYKPLVSRDKITRNRLKTLVKQLYNGAAGPLVLQLIKTQRFTPDEIDALQDLIKRLD. 146
64 2.000e-38UniRef50_A0A1F4R4F7 Uncharacterized protein n=1 Tax=candidate division KSB1 bacterium RBG_16_48_16 TaxID=1798559 RepID=A0A1F4R4F7_9BACT  ali  30  1MKFSDAEWQLMNALWQKYPATAREVMEHIPNGNTWAYTTVKTMLTRLIEKNAISETKQGNTSVYQPLVSQQSARKSALQGLVDKVLGGAVEPIMHFLIEEKKLSKKDRQKLIELLEEMDE 120
65 3.000e-38UniRef50_A0A258AI14 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium 12-59-8 TaxID=1970608 RepID=A0A258AI14_9BACT  ali  28  63.KISDAEWTVMNVFWQRGTSTLAEVVKDLEGRLHWKPRTVQSLIRRLADKGALGVEAVGREFRYSPAVAQDQCQHEESRSFLDRVFNGRLTPFVAGLMEREDVTQDDLAALREVLNQAE. 180
66 3.000e-38UniRef50_A0A1Q4F071 Transcriptional regulator n=7 Tax=Bacteria TaxID=2 RepID=A0A1Q4F071_9SPHI  ali  20  7VKPTESELEILRVLWSKESATVREVHEALAASKDVGYTTTLKLMQIMHEKGLVSRDDSSKTHIYKALVSREKTQKHLLGKMIDNLFAGSPAQLVMQALGNHKTSRDELDEIQDLLNTLK. 125
67 4.000e-38UniRef50_I9CBT9 Putative transcriptional regulator n=171 Tax=Proteobacteria TaxID=1224 RepID=I9CBT9_9SPHN  ali  43  10.RISEAEHAVMEALWQRSPLTAQEVCEEVCGPRGWSLATVKTLLSRLVTKQAVGTEPDGKRFLYSPRIERADYLGTESRRLMDRLFGGRAAPLFAHLAQAEALSEDDLSEIEALLKELR. 127
68 4.000e-38UniRef50_D4ZBP9 Penicillinase repressor n=58 Tax=Proteobacteria TaxID=1224 RepID=D4ZBP9_SHEVD  ali  42  7.EISNSELAVLNALWESSPMSSSEVVEKLTRSNEWHEKTVKTLLNRLVKKQAIGFQKQGRAYLYSPLIDQSEYQIKQSQSFVERLFAGRVAPLVAGFAKQNKLSAEDIAELKSLIDNWQE 125
69 4.000e-38UniRef50_A0A1H8BHX5 Predicted transcriptional regulator n=2 Tax=Hydrogenoanaerobacterium saccharovorans TaxID=474960 RepID=A0A1H8BHX5_9FIRM  ali  21  3.KISKSEMELMQIIWEHAPITSGEILERLPLGRDWKNTTVLTFLSRLAEKGMVQVEKQGKANVYKALVSEKSYRGKETVSFLEDVHGGSVKSFMASLVDSNELTQQEIDELKDWLSKR.. 120
70 5.000e-38UniRef50_A0A1Z9IBF2 Uncharacterized protein n=1 Tax=Opitutales bacterium TMED158 TaxID=1986794 RepID=A0A1Z9IBF2_9BACT  ali  32  6.RISDAEWEVMKVLWDHEPMTAVEVLALLPHDQ-WKQKTVNTFLVRLEGKGVIASKRIGRANVYHSALSESECRRMEGSQFLSKVFRGEVAPMMLHFIENEDLSSSDIDELKRLLDEK.. 121
71 5.000e-38UniRef50_A0A1Y3SJ49 Transcriptional regulator n=7 Tax=Clostridiales TaxID=186802 RepID=A0A1Y3SJ49_9FIRM  ali  22  7.RLPDSELELMQIIWDKEPVTRPEIEEALANTHPLAPTTILTFLTRLCDKGFLQLERRGKVNYYTPIITRKDYLAQASRGVLDQLFGGSVAALVTSLVDAG-VSREDLEELRRMLEEGR. 124
72 6.000e-38UniRef50_A0A1S8LWU9 Penicillinase repressor n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1S8LWU9_9CLOT  ali  32  3.NISDSEWKVMRVVWSKSPILASEIIEEVIKDTEWNPKTIHTLIRRLVKKGVLRAEKEKTYYSYYPAVSKEECVQEETKTFLEKCFGGSFNVMLSNFINGDRLSDDEINELEKLLENKK. 120
73 6.000e-38UniRef50_A0A2K4ZIT5 Penicillinase repressor n=14 Tax=Firmicutes TaxID=1239 RepID=A0A2K4ZIT5_9FIRM  ali  29  6.QISEAEFEVMKIIWKHAPISTNEITEKLTQTTKWSPKTIQTLIKRLVTKGALSYEKQSRVFVYTPLIEEKEYIGQESHSFLERYYDGDITAMLSAYIEDAKLSESEIDTLRSLLAK... 121
74 7.000e-38UniRef50_A0A220WAV5 Penicillinase repressor n=128 Tax=root TaxID=1 RepID=A0A220WAV5_9SPHN  ali  38  4.RISDAEHAVMEVLWKRAPLTAMEVAEQVVAEKDWSLQTVKTLLSRLAAKAVVGTELDGRRFLYSPLVERDDYLTGVSRNFVDRLFGGKVTPLVAHLAEADELSADDIREIEELLRELK. 121
75 7.000e-38UniRef50_A0A2V8GI59 Transcriptional regulator n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8GI59_9BACT  ali  22  8.RPTDAELAILCVLWERGPSTVRQVHDVLGRERPAAYTTALKLLQIMAEKGLVDRDERDRTHVYRARLSEEQTQRQLVRDLLDRAFGGSATKLVMQALAARRASADELREIRRMIDGAR. 125
76 7.000e-38UniRef50_G2FZC6 Penicillinase repressor domain protein n=2 Tax=Desulfosporosinus sp. OT TaxID=913865 RepID=G2FZC6_9FIRM  ali  31  56.QISDAEWLVMKVLWNESPLGSSDVIKELKGTTDWKPKTIKTLLSRLVSKNAVAYDVGSRGYSYYPLVSENECAKEEARSFLGRVYNGSLNLLVKNFIENKELSTEEIEELKKLLEDK.. 172
77 8.000e-38UniRef50_A0A2V8BEA8 BlaI/MecI/CopY family transcriptional regulator n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8BEA8_9BACT  ali  42  1MKISDAESKVLEVIWSQGPLSADEVVAAMNNDCDWSAGTIRTFLTRLVKKKALAATPDGRRYLYRPLIRREDYVHEQSRNLIDRLFGGRIAPFITQFSERQDLSGDEIEELKRLI..... 116
78 8.000e-38UniRef50_A0A0M6YS32 Regulatory protein BlaI n=2 Tax=Labrenzia alba TaxID=311410 RepID=A0A0M6YS32_9RHOB  ali  28  6..LSAAETEVMLALWEIGSGSVADIQKALKPERDIAYTTVATLLSRMEAKGAVSSKKAGRSYIFSPLATKADFQQNKLSGLVQQFFEGRPSSLASHFIKTNSFSDQELTELRLLLDQKE. 122
79 8.000e-38UniRef50_A0A142X1Y8 Penicillinase repressor n=2 Tax=Planctomycetaceae TaxID=126 RepID=A0A142X1Y8_9PLAN  ali  22  4IRASEVESQILGLLWEHGPSSVRDIQERLADGKARAYTTVLTTMQVMEKKGLLSHDREGLAHIYRPLVSRDDIAQPAVRTLVRNLFGGDATKVVQTLIDSQDLSEADLKEIRRMINEA.. 121
80 9.000e-38UniRef50_Q12RQ8 Transcriptional repressor, CopY family n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=Q12RQ8_SHEDO  ali  22  8.QLTDSEQSIMEVLWQKGEASVRDIADALSEDKASAYTTVQTMCKILVEKGYAEFRKEGKAFIYAPTMTQKEARQGALASLLNRFFGGSPEVLAQHLMQETDIELKDLAALQRQIDASKD 126
81 9.000e-38UniRef50_UPI0005505706 BlaI/MecI/CopY family transcriptional regulator n=2 Tax=Caulobacter TaxID=75 RepID=UPI0005505706  ali  36  3.RIGESEQLVMEVLWAEAPLTAAEVAARVDPAREWNGSTIKTMLARLVAKGVLDHEEDGRRYLYRPRISRADYASRESGRLLARLFDGRAGALVAHLAEHQQLSDQDIEDLDALLKQLR. 120
82 9.000e-38UniRef50_A0A1M5UG39 Predicted transcriptional regulator n=20 Tax=Firmicutes TaxID=1239 RepID=A0A1M5UG39_9FIRM  ali  20  7.RLPDSELEIMKIIWDAGRVTSVQVLDRLRNKRDWKTTSVLTFLSRLADKGFLSVERQGKTNIYQALVDEQDYLEKESKSFLEKLCGNSLKTFVASLYDGKAISENDLRELRQYINEK.. 124
83 1.000e-37UniRef50_A0A1L8TTL4 Uracil phosphoribosyltransferase n=41 Tax=Enterococcaceae TaxID=81852 RepID=A0A1L8TTL4_ENTGA  ali  25  16IKISDSEWEIMRVIWTLGKSDAQEVTALLSESKDWKTATVKTLLGRLVKKGVLRTETQGKKFVYYPLVSEDATIQSATESLFSHICAKKIGQTLAEMIRESELTNEDLAMLEEALAQKE. 134
84 1.000e-37UniRef50_A0A0K0XV05 CopY family transcriptional repressor n=1 Tax=Wenzhouxiangella marina TaxID=1579979 RepID=A0A0K0XV05_9GAMM  ali  35  6..ITESERLIMEAVWASSPRTSAEIVTAVMQNEDWSPKTVHTLIGRLVKKGMLRREGEGRSYQYEACISRDEYVRSKSRGLVETLFRGRVAPLVAAFAEDEAISREDLDELRAVLDEFE. 122
85 1.000e-37UniRef50_M7NR80 Methicillin resistance regulatory protein mecI n=75 Tax=Bacteroidetes TaxID=976 RepID=M7NR80_9BACT  ali  27  3.ELTKAEEQVMQLLWQQEKAFVKDLVAAMPEPKP-AYNTVSTIVRILETKGFVAHQAYGKTHEYYPLITKDDYRSFYLKSMVSTYFGGSFQKLVSFFAKDNDLDVQELEELMK....... 113
86 1.000e-37UniRef50_P06555 Penicillinase repressor n=198 Tax=Bacteria TaxID=2 RepID=BLAI_BACLI  ali  27  6.QISDAELEVMKVIWKHSSINTNEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGRVFVYTPNIDESDYIEVKSHSFLNRFYNGTLNSMVLNFLENDQLSGEEINELYQILEEHK. 123
87 1.000e-37UniRef50_A0A1G7G123 Predicted transcriptional regulator n=2 Tax=Dyadobacter soli TaxID=659014 RepID=A0A1G7G123_9BACT  ali  25  8..LTRAEAEIMKILWQLGKAFVKDILAQMADPKP-AYTTVATFVRILEKKEMVAHKTYGNTHEYYPLVSEADYRKHEAKQLVENYFENSVTSLVSFFLNDSALTESDLDDLAAFIEKKR. 123
88 1.000e-37UniRef50_A0A1G2Z0K4 Uncharacterized protein n=7 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G2Z0K4_9BACT  ali  31  1MKLTEAEWQIMNALWQKHPATARQIMDRLPAGVNWAYTTIKTMLTRLVEKKALGEVKQSNTSVYEPLVSQQKARLSAFRSLLDQAFDGAIGPLVHFLAEEKQLTAKEREELAKILE.... 116
89 1.000e-37UniRef50_A0A2W4SFJ4 BlaI family transcriptional regulator n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4SFJ4_9FIRM  ali  23  39..LGPLEADVMRLVWEKGEVQVEDVHQALLRDREIAYTTVMTVMSRLAAKGLLTRRKQGRAYLYRAALPREELAESTLQEWSRRFFGGRIVPAISFLLGSERLTPEEVAELRRLVERLE. 155
90 1.000e-37UniRef50_C4IEZ4 Penicillinase repressor n=100 Tax=Firmicutes TaxID=1239 RepID=C4IEZ4_CLOBU  ali  33  6.KISESEWEVMKLLWNKSPLTSEEIICSLSEDKKWTKQTVKTFIIRLTKKSAIGYEKEGRIYKYYPLVDEKDCRKYENKSFLQKVYSGSLGVLLSNFLEEESLSTNEIEELERILKEKKE 124
91 1.000e-37UniRef50_A0A146G1H5 BlaI family transcriptional regulator, penicillinase repressor n=4 Tax=Verrucomicrobia TaxID=74201 RepID=A0A146G1H5_9BACT  ali  38  2IQISEAEWQVMEVLWAHPGRNGREVAVAL-KNTGWTEATVKTLLNRLLKKKALRHEQTDRHYTYFPAVQRTECQQREAVNFLRRVFGGSPVPLVAHFLENQKLTEAELAELRRLLDRHDD 121
92 1.000e-37UniRef50_Q67NY1 BlaI family transcriptional regulator n=5 Tax=Firmicutes TaxID=1239 RepID=Q67NY1_SYMTH  ali  22  12..LGPLEADIMRLVWEKGEVQVDDIHQALLRDREIAYTTVMTVMSRLAAKGLLTRRKHGRAYLYRAALPREEMAESTLHEWSRRFFGGRILPAVSFLLGSERLTPEEVAELRRLVERLE. 128
93 2.000e-37UniRef50_A0A2G0CEV0 Transcriptional regulator n=1 Tax=Lewinella marina TaxID=438751 RepID=A0A2G0CEV0_9BACT  ali  24  3.RLARREAQLMEVLWKLKRAFVREIIDELPEPKPH-YNTVSTMVKILEEKGFVSHEKVGNAYRFFPVIAEEEYQKKAVDDVVRRFFDNSPMKLVNYFAREQQLDAAELERLVRLIKEK.. 118
94 2.000e-37UniRef50_A0A1M4T5C1 Copper transport repressor, CopY/TcrY family n=14 Tax=Carnobacteriaceae TaxID=186828 RepID=A0A1M4T5C1_9LACT  ali  23  7IQISEAEREIMRVVWANLSVTSREIIDILEDKMDWKESTIKTLIGRLVDKNILNTKKEGRKFIYSANVSEETTIQGYADDILSNVCNTHHGSVIGQFIEDAKLSTSDIEELIKLLEEK.. 124
95 2.000e-37UniRef50_D2QZW1 Transcriptional repressor, CopY family n=4 Tax=root TaxID=1 RepID=D2QZW1_PIRSD  ali  22  8.QPTPAELEVLKVIWNRGASTVREVMDVLNEERPRAYTSVMSLLNVMADKGLLRRIAQGRAFLYEAAVDRQSALQQMVGDLLGRVFEGSTRELVAHMLDQSNPSREELDEIRKAIREYQQ 126
96 2.000e-37UniRef50_H8MTQ5 Putative transcriptional regulator n=1 Tax=Corallococcus coralloides (strain ATCC 25202 / DSM 2259 / NBRC 100086 / M2) TaxID=1144275  ali  24  13..LTPVELELMQLVWRLGEVSVADVLAALPPERKLAYTSVSTVLRILEQKGVVQSRKEGRGHLYSARLSREAYEAQSVRHLVATVFDGTPSSLVARLVEAVPLSAEEVEQIRKLLGRK.. 128
97 2.000e-37UniRef50_A0A1Z8XJF4 Uncharacterized protein n=3 Tax=Verrucomicrobia TaxID=74201 RepID=A0A1Z8XJF4_9BACT  ali  34  6.RISDSEWEVMKALWDHEPMTAVEVLARLPHDQ-WKQKTVNTFLVRLEAKGVITSKRVGRANVYRTFHTERECRRFEGSQFLSKVFRGQVAPMMLHFIENAELSESDIDKLKKLLDDR.. 121
98 2.000e-37UniRef50_A0A2T6E216 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Opitutaceae bacterium EW11 TaxID=2161865 RepID=A0A2T6E216_9BACT  ali  35  17.ELTAAEWEVMKVVWERQPCSAGDVQEALKAERGWAYSTVKTTMDRLAKKGVLALKRVRNVQLFEARITRTDAARGEIRRLLDRAFDGAVAPMVNHLVAHEKLAPGELAALRRLIESAE. 134
99 2.000e-37UniRef50_A0A1G2W7M7 BlaI/MecI/CopY family transcriptional regulator n=2 Tax=Caulobacteraceae TaxID=76892 RepID=A0A1G2W7M7_9CAUL  ali  55  1MKISGAESQIMEALWRKGPLTPDGIVDEVGEAHGWAPGTVKTLITRLLRKKAIEGRREAEGYLYRPLLSRTDYVQSESQSLVDRLFDGEVAPLVAHFAEHRALTPKDIQVLKKLISDLED 120
100 2.000e-37UniRef50_G9RYS8 Uncharacterized protein n=4 Tax=Ruminococcaceae TaxID=541000 RepID=G9RYS8_9FIRM  ali  26  1MKLSAAEYEIMECVWALGPVSGMDIMRALGQEKGWKQPTVLTFLSRLVEKGLLETEKRGKLRSYTAAMTREAYKNSETRDFLAQLYGGSVQNLVACMADGGGIPPEELEALRVWLKERE. 120
101 2.000e-37UniRef50_A0A1J4TR14 Transcriptional regulator n=7 Tax=Bacteroidetes TaxID=976 RepID=A0A1J4TR14_9FLAO  ali  22  3.KLTQKEEELMQVLWQLDKAFVKDVVAELPEPKPH-YNTVSTVIRKMEDKGFVSHQSFGTTFQYFPLISKEAYFKQFMTNTIHNYFDNSYKNVVSFLAQEEKISVAELKEIIQLIENK.. 118
102 2.000e-37UniRef50_L0DH19 Putative transcriptional regulator n=4 Tax=Planctomycetes TaxID=203682 RepID=L0DH19_SINAD  ali  22  5.RPSELELQVLAVLWDRGPSSVRGVQEALPDGKDRAYTTVLSVLQVMEKKGLIGHSPQGQAHVYHTLVKRGQVLRPMMRELVRNVFGGSPARALQSLLDGSKLDADELAQIRQVIQDAE. 122
103 2.000e-37UniRef50_UPI000B36454F BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Intestinibacillus massiliensis TaxID=1871029 RepID=UPI000B36454F  ali  32  6.KITESEWGVMDALWQRPGSTTAEVAEALAD-TGWNRNTVHTFLTRLEGKGYVHAGAGGAPHRYYPSAAREDCVRAETEGFVQRVFRGSAGQLVRTFLRDERLSEDEVAELRALLDSA.. 121
104 2.000e-37UniRef50_A0A1Q7V9U3 Uncharacterized protein n=11 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7V9U3_9BACT  ali  19  9.RFTEAELELMDILWDSGVCTVQGVIDRLPPSRPLAYTTVQTVLNVLHRKGGVRRRLRDRAYHYEAAISRFDAASTALGDLVHKLFGGSAEQVVLAMVKSRQLSPQKLSELRNLVADAD. 126
105 2.000e-37UniRef50_F6DQH1 Penicillinase repressor n=1 Tax=Desulfotomaculum ruminis (strain ATCC 23193 / DSM 2154 / NCIB 8452 / DL) TaxID=696281 RepID=F6DQH1_DE  ali  30  6.QISNAEWEVMRILWDKAPIKAAEVIKTLQETKDWKPKTIKTLIRRLLDKGVIGHTANGNAYVYHVLIEEKEYLDRETDTFLNKLYQGSIRHFMLNFVQEKELSREEVAELIKILENSK. 123
106 2.000e-37UniRef50_A0A0N0M093 MarR family transcriptional regulator n=19 Tax=Proteobacteria TaxID=1224 RepID=A0A0N0M093_9GAMM  ali  21  8.QLTDGEQSIMEVLWKNGEASVRDITDELSKEKQTAYTTTQTLCKILAEKGYADFRKEGKAFIYIPKITQKEARQSALTSMLNKFFGGSPKVLAQHLMQETDIDLDDLEALQRKVDQSKD 126
107 3.000e-37UniRef50_A0A0X8F9S9 CopY/TcrY family copper transport repressor n=3 Tax=Aerococcus TaxID=1375 RepID=A0A0X8F9S9_9LACT  ali  25  10...SPAEWQIMRVIWAQKEASSRYIIDCLAEAMAWKDSTIKTLIRRLVDKGWLAKEKQGRSYIYRAQVSQEEASRLELKTIFDNLCQCQAGELIVQCIEDNPLSQDMIDRIQEALDKK.. 124
108 3.000e-37UniRef50_A0A1C5THD6 Regulatory protein BlaI n=106 Tax=root TaxID=1 RepID=A0A1C5THD6_9BACE  ali  24  3.KLTYQEEEAMRFIWHLGPCFVKEIVARYDEPKP-PYTTVASIVNNLKRKGYLKAEKFGNTYRYTPLVGKEEYTRNSVGNLVRNYFANSYKEMVSFFAKEQKISKDELNEIIDLIEKRKD 120
109 4.000e-37UniRef50_A0A239EMQ4 Transcriptional repressor, CopY family n=3 Tax=Acidobacteria TaxID=57723 RepID=A0A239EMQ4_9BACT  ali  25  7ITLTEAELRLMNILWQRGESAVQELVDALPAGQGLAYTSVLTTIRILEKKGYVQHRQVGRAFLYLPTVAEHEASRSEVRHVLQRFFGNSRERLLLTLIGDEEITAEELERLRQAI..... 121
110 4.000e-37UniRef50_A0A1Q6W5T6 BlaI family transcriptional regulator n=10 Tax=unclassified Gemmatimonadetes TaxID=234665 RepID=A0A1Q6W5T6_9BACT  ali  20  6.QLTELQLAILRVLWDKGEATVQDIWEALHAERGLAQTTVATMLSRLERRGVVTRRAQSRQYHYRAAVTEREVQHSMVGELTERLFDGDVTALVQHLLSGQDVSPGDIAKIRDMIERVE. 123
111 4.000e-37UniRef50_Q2S3B3 Transcriptional regulator, BlaI/MecI/CopY family n=10 Tax=Bacteria TaxID=2 RepID=Q2S3B3_SALRD  ali  21  8.HLGETEMEVLHHVWDLGEATVADVRERILEDRDVAYTTVMTVLKTLAEKDYLDYHKEGRSYVYQPAEDPDAVQHSLLRRLMDKVFQGSPSALVQTLVRREDLSDDEREEIKALIDALDE 126
112 4.000e-37UniRef50_A0A257FQN2 BlaI/MecI/CopY family transcriptional regulator n=12 Tax=Proteobacteria TaxID=1224 RepID=A0A257FQN2_9BURK  ali  43  12ISISDAEAQVMEVLWQRHPQGADEIAEALADRQDWQLATIKTLVNRLFTKGAISAEKDGRRYLYSPLLRREDWLSSQSLGLIDRLFQGRLTPLVAHFSAQRKLSAAELKALKQLIQDYE. 130
113 4.000e-37UniRef50_A0A1Z5SEZ0 Transcriptional regulator n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1Z5SEZ0_9BACT  ali  27  8..LTKAEEEIMQALWQLEHAFVKDIVDLLPAPKPH-YNTVSTIIKILCDKGFVGYESFGKSNRYHPLIQKDEYSKKTMKQFVSKYFDGSFAGMLSFFAQEKDIT---VQELEAILKELKQ 121
114 5.000e-37UniRef50_A0A2A5ANA4 CopY family transcriptional repressor n=2 Tax=SAR86 cluster bacterium TaxID=2030880 RepID=A0A2A5ANA4_9GAMM  ali  32  1MKLTNSEMQVLNVLWLDSPLTVGQIIERVQQQSEWHANTIKTLLTRLTGKQAVSRHKDGRRFFYTADVSREEIVSIEADGFLKKFFNGQMAPLIAHFAERKELSEADIAEIETILKELK. 119
115 5.000e-37UniRef50_A0A1S6IQ55 Transcriptional repressor CopY n=2 Tax=Jeotgalibaca dankookensis TaxID=708126 RepID=A0A1S6IQ55_9LACT  ali  20  7VKITEAEWEIMRVIWTNQPATSRFITEVLSEQMNWKSATVKTLIGRLVEKGFVSTKKQGKKYLYSAMISEEDSINALATDVFEHICATKVGATLANQIEQATLSRDDIQLIEDILQKKKE 126
116 5.000e-37UniRef50_A0A2V5MQC5 BlaI family transcriptional regulator n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5MQC5_9BACT  ali  22  48.RLGDLQLKIMKLLWERREATVAEVHQTVARERDLAYTTVATMLRKMEARNLVAHREEGRSFVYRAIVPSDDVTRGMADHLIERLFEGSMADMVSHLLTTHEVSREELSKLEKLIAERK. 165
117 6.000e-37UniRef50_A0A0S8HHF8 Uncharacterized protein n=1 Tax=Phycisphaerae bacterium SM23_33 TaxID=1703412 RepID=A0A0S8HHF8_9BACT  ali  26  5..LGQLQLQVMEIVWRLGRATVAEAHEVLAGSRKIAYTTVLTTMRALERRGMVRHERAGKAYLYEPLVSRADYAASSVHRLVDDLFDGSREKLLCHLLGADRISRAELARIRRMIRGRQE 122
118 6.000e-37UniRef50_A0A225DHJ3 Transcriptional repressor, BlaI/MecI family n=4 Tax=Planctomycetales TaxID=112 RepID=A0A225DHJ3_9BACT  ali  24  15..LSEAQLEIMHIAWDSPEVTVTDVWSVLSKRRSVARNTVLTLMDRLEKKGWLTRRADGQTHYYAAAVPRKSTLGTVVHRLVDAAFAGSAEALVLALLEGRGVSDDEAKRIRKLIDEAR. 131
119 7.000e-37UniRef50_A0A1N6G3S8 Predicted transcriptional regulator n=38 Tax=Bacteroidetes TaxID=976 RepID=A0A1N6G3S8_9BACT  ali  22  10.ELTKSEEHIMQILWKLGNAFVKDIIEEMEDPKP-PYTTVSSVVRILEAKGFVSHKAYGKTHEYSPLISKEQYRKGSIQRMVKYYFDDKTSNLLSFLMQEKKLSKKELQELQQFIDQQKQ 127
120 7.000e-37UniRef50_A0A2N2DC88 CopY family transcriptional regulator n=1 Tax=Firmicutes bacterium HGW-Firmicutes-14 TaxID=2013775 RepID=A0A2N2DC88_9FIRM  ali  23  7..LGPLEADIMQVVWERQKVTVQDVFEVLSEERSIAYNTIMTVMSRLAQKGILTRAKSGRSFVYSPTTTKSEVAKGMLQYIIDKIFKGSKAPVFSHLLEDADLSKEEVAYLEELVKGKK. 123
121 7.000e-37UniRef50_C5BT31 Transcriptional repressor, CopY family n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=C5BT31_TERTT  ali  17  2ITPTQAELEILNILWKSGEARVPDVHALLSQQKDIGYTTTLKAMQVMEQKGLLQRRREGRSHVYAPAIAEDATKNTLLSRFVESTFDGSRSRMVMQLLGSQAVSPEELAEIRNFLQNLEE 121
122 7.000e-37UniRef50_G2EAK1 Penicillinase repressor family protein n=5 Tax=Flavobacteriaceae TaxID=49546 RepID=G2EAK1_9FLAO  ali  25  6.QLTKAEEEIMQVLWQLEKAPVKDIIAELPEPKP-AYNTVSTIVRILESKGFVDYEKQGKGHVYFPIVKKQDYSNQSINSLVDNYFQGSFKSMVSFFMQKNDIS---LQELESVLNE... 117
123 8.000e-37UniRef50_A0A0N8Q507 Penicillinase repressor n=6 Tax=Alteromonadales TaxID=135622 RepID=A0A0N8Q507_9GAMM  ali  28  1MKLSDFELDVMQLMWQHEPCTAAQLHQLLSQNKEVAYTTVKTIIDRLEKKGAVERDKQGRAIVYRSKVQQSTLSSQETPSFMQRFFGGNSRSLIAHFIKEEELNEDDIHYLQELLKKKK. 120
124 8.000e-37UniRef50_F0SG39 Transcriptional repressor, CopY family n=5 Tax=Planctomycetaceae TaxID=126 RepID=F0SG39_RUBBR  ali  28  4VTISDAEWQVMNVIWQGESMGAQEVIHVLQQDHDWAPSTIKSMLHRLTRKQVLVADMQGNRYVYRARVKRSDCVRKEGRSFMQRVFAGEPVSLLAHFLKDSQLTADEIADLRRILDEQE. 122
125 9.000e-37UniRef50_A0A0S8KPT1 Uncharacterized protein n=6 Tax=root TaxID=1 RepID=A0A0S8KPT1_9BACT  ali  23  9..MSPTETEILRLVWELNEATVQQIRDQLPADRKVAYNTVQTLLCRLERKGYLKHHLKGRAHVFSPSVKSQEVIKTTVRDFLGRLFGGDPKPLVQFLAEDGKLDEEDIKRLRELI..... 121
126 9.000e-37UniRef50_A0A0B8T2B1 Penicillinase repressor n=26 Tax=Bacteroidetes TaxID=976 RepID=A0A0B8T2B1_9SPHI  ali  20  6.ELTKAEEQIMQELWELRGGFVKDVIANLSDPKP-AYNTVSTILRILENKGFVAHESFGKSHRYFPKISKEDYKKLITGKLLHNYFGNSATSMLSFFLEEKKMDVNELDEIMQIINKNR. 122
127 9.000e-37UniRef50_A0A2A2WJK6 Transcriptional regulator n=4 Tax=Planctomycetaceae TaxID=126 RepID=A0A2A2WJK6_9PLAN  ali  24  24.QITKCEAEVMDVVWERERVTVNDVVDAI--DRDLAYTTVMTTLRILEEKGIVRREKVGRAYTYSAAVTREEVRHGMIHELTDRLFGGSVQSLVLSLLNSDSISPEDI............ 129
128 9.000e-37UniRef50_A0A2G2L215 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Kangiella sp. TaxID=1920245 RepID=A0A2G2L215_9GAMM  ali  34  1MQISDSEKLIMDSLWNSSPKTAKQIIENLDPALNWADKTAKSLINRLLKKEAISFNKQGREYLYFPLLEREDYIENATDSFVNRVFNGSVSSLVAAFAKKEKLSEHELSELKQLIKEIE. 119
129 1.000e-36UniRef50_A0A2S0KQG6 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Victivallales bacterium CCUG 44730 TaxID=2094242 RepID=A0A2S0KQG6_9BACT :  ali  42  13VQITEAELEVMKLLWDHSPQSAPELAAKLAERRQWAATTVKTLIARLAKKQALEQSYRGRVSFCRPLIGREEYTEQESDSFLSRFFGGAPAEMISFFVEKRKLSDEDFDTLKKLIAEAE. 131
130 1.000e-36UniRef50_A0A165HFH2 Penicillinase repressor n=3 Tax=Wohlfahrtiimonas TaxID=582472 RepID=A0A165HFH2_9GAMM  ali  22  4IKITKTEWEVMRVLWTQGECLSNEVISVLSEKHDWKPSTVKTLISRLAKKGYVGKHADGNRYRYYPTISEKESLQRTRAELAHHICSTKMGKYIAALIEENPLSHQDVELIAAAVQQKR. 122
131 1.000e-36UniRef50_A0A192WWZ0 Transcriptional regulator n=1 Tax=Acidobacteria bacterium Mor1 TaxID=1660251 RepID=A0A192WWZ0_9BACT  ali  20  13..LTDVELELMTVLWQTGEATVRDVLEQLPANRQLAYTSVSTVLRILEKKKLVQTRKDGKAHLYAPAVSKTDYESRSVRDLVDKVFDGTPSAMVMRLLDDEGMSAEELREIQARLKER.. 128
132 1.000e-36UniRef50_A0A2V8B7F0 CopY family transcriptional regulator n=4 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8B7F0_9BACT  ali  27  8..LTTQELAIMKVVWRLGHATVRDVYHALLENRHIAYTTVMTMMNVLETKGYLKKEKHDRAYRYRPTRPQRTVISSMVREFVNRVFDGAPRPLLLHLVKDNRLTSKEREDLSKLIDETNE 125
133 1.000e-36UniRef50_A0A2G2JZ63 MarR family transcriptional regulator n=1 Tax=Blastopirellula sp. TaxID=2024826 RepID=A0A2G2JZ63_9PLAN  ali  24  9..LTDGELRLMQVIWRLGSATVRDVVVELEKKDKVAYNTVQTMLRILEEKGYLSHEKLGRSFVYSPIVERQNARSAALKKLLANFFDDSPQSLLVNLIEDEELDVADIQKLKGLISQSK. 125
134 1.000e-36UniRef50_A0A1F2T5Y6 Uncharacterized protein n=2 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1F2T5Y6_9BACT  ali  26  9..LTDAELRIMRVLWERKRATVGDVVECLAGTHRPAYNTVLTTLGILERKSYVTHEKHGRAFAYLPTVDRSEARHSALSQVLNRFFDDSPRLLVLDLLGHERTDADELRRVRELIE.... 122
135 1.000e-36UniRef50_A0A161R9P7 Penicillinase repressor n=11 Tax=Firmicutes TaxID=1239 RepID=A0A161R9P7_9FIRM  ali  30  6.QISEAELEVMKVLWELKQATSSQIIEKLTKVKVWKPKTIQTLLNRLVAKGAVKAEKSSKAFVYSPIIDETEYKAFASRSFLDKVFNGSLSLMVTSFVRGQKLSVEEIERLKKLLED... 122
136 2.000e-36UniRef50_Q02A97 Transcriptional repressor, CopY family n=19 Tax=Acidobacteria TaxID=57723 RepID=Q02A97_SOLUE  ali  22  8..LTEQELEIMKIVWERESATVRDVYETLLEQRKVAYTTVMTMMKILEQKKYLKKTQADRAYVYRPTEPKGKVIGDMVRDFVNRVFNGSAEPLLVHLVEEHDLSPEELDEIARI...... 119
137 2.000e-36UniRef50_A0A146G8F4 BlaI family transcriptional regulator, penicillinase repressor n=1 Tax=Terrimicrobium sacchariphilum TaxID=690879 RepID=A0A146G8F  ali  24  8..ISDSEWLVASEVWAEEGLTAADIADRLASRTHWKQKTINTFLARLVAKGVLAARPDGRAFRYHAGIPKEQCVRQESESFLKRVFGGAVAPMLAHFCETQDLSPEEIDTLRDILKRK.. 123
138 2.000e-36UniRef50_A0A2A5B238 Uncharacterized protein n=1 Tax=SAR86 cluster bacterium TaxID=2030880 RepID=A0A2A5B238_9GAMM  ali  26  4LQISDAEWEILKVIWDISPATVNDISDMLVESKQWHPKTVRTMLNRMVNKGVLDKTNEQGMYQYFPLHDKEELIKQASESFLERVFNGALTPMVAHLVKQRPLTSQERKELLDILND... 120
139 2.000e-36UniRef50_A0A1Y4LFZ7 Transcriptional regulator n=9 Tax=Clostridiales TaxID=186802 RepID=A0A1Y4LFZ7_9FIRM  ali  25  6..LTNSEWYVLDCLWERAPQTVTQLVPILKEKVGWAKSTTITTLRRMEDKGLVRVEVQGRAKHYFPAVEREKAARQETRSFLDRVYQGSVGLMVSSMAREKALTKEEIEELYAILKEAE. 122
140 2.000e-36UniRef50_A0A225DAK6 Transcriptional repressor, BlaI/MecI family n=2 Tax=Fimbriiglobus ruber TaxID=1908690 RepID=A0A225DAK6_9BACT  ali  32  1..........MQVVWERKEATAAEVIAALTETTGWQHRTVRTLLARLVAKGVLAAEADGNRYLYRPLVSRRTCVREEGHSFLKKVFGGDATELLVHFVRGADISPAQIEELKRLLDEK.. 108
141 2.000e-36UniRef50_A0A1H3WWE4 Predicted transcriptional regulator n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1H3WWE4_9BACT  ali  17  54IRPTDSELEILSVLWEKGPCTVREVHDVLSQTKDAGYTTTLKLMQIMHDKSLLHRDTSSKTHIYTAAVSQEKTQQQLLEKMIDTVFGGSASQLVMQALGQHSSSEEELNKIKAYLADIE. 172
142 2.000e-36UniRef50_A0A1M6Q0I7 BlaI family transcriptional regulator, penicillinase repressor n=2 Tax=Anaerocolumna TaxID=1843210 RepID=A0A1M6Q0I7_9FIRM  ali  25  6.RMGNAEAEIMKILWKREPATSSEILKALKDRMEWSRSTTLTLLRRLVEKGFVTCEKKE-IFYYTAFVSEEEYKHYQTRNFIERIYDGSVKNLISALCRGNSLSEKDIEELQDYLKQEAE 125
143 2.000e-36UniRef50_A0A174CS29 Regulatory protein BlaI n=7 Tax=Bacteroidales TaxID=171549 RepID=A0A174CS29_9BACT  ali  24  7.ELTRGEEEIMQILWRLGDAVVNEIIAQTKEPRP-KYTTVATFLKILENKGFVNHTPEGKSHRYYPAVSREEYARGVMSSVLSSYFDGSLAQMVSFFSRHEDISVTEMEEILQIMQNAR. 123
144 2.000e-36UniRef50_A0A1I2IIF4 Predicted transcriptional regulator n=2 Tax=Xanthomonadales TaxID=135614 RepID=A0A1I2IIF4_9GAMM  ali  51  1MSISEAEAVVMDVLWRQAPRSAEDILAELGPTQGWQEGTVKSLLNRLLKKKAVKAERDGRRYLYAPRLTREQYVSQESKGLIDRLFDGRIAPLVAHFSEQRKLSRRDVADLRKLLEELDD 120
145 2.000e-36UniRef50_UPI000C7771D8 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Anaerotruncus sp. AT3 TaxID=1673720 RepID=UPI000C7771D8  ali  24  3.RLSDSEFTIMQEIWSRGPVTAGGLVEAFSERRGWKIQTVSTFLTRLVDKGMLTCEKHGGQNLYRVAVSEADYRAGETRDFLREVHGGSVQSFFAALGSPGSLSGAEIEELRRWLD.... 118
146 2.000e-36UniRef50_A0A2P2F6F4 Uncharacterized protein n=3 Tax=unclassified Clostridiales TaxID=186813 RepID=A0A2P2F6F4_9FIRM  ali  27  3.KLTDSEWKVLEALWAGGPQHLGQILGALAPETGWSRTTVHTYLTRMAAKGLVSMDQSSPR-RYAAIPSRETCAARERRDLVDRVYDGSAGQLVAAFVKDGSLSPQEREELRRLLDEME. 119
147 2.000e-36UniRef50_A0A1U7CWF9 Transcriptional regulator BlaI n=3 Tax=PVC group TaxID=1783257 RepID=A0A1U7CWF9_9BACT  ali  19  5.RPSELELQVLGVLWDRGPSPVREILEAMPDGKDRAYTTILSVLQVLEKKGLVRHTRLGQANVYHPKHKRGQVLGPMMKDLLRNAFGGSPARALQSLLDGADVRPGDLEEIRKVIAQAE. 122
148 3.000e-36UniRef50_A0A1H9JJF0 Predicted transcriptional regulator n=1 Tax=Lewinella agarilytica TaxID=478744 RepID=A0A1H9JJF0_9BACT  ali  21  3.KLAKREAQIMQALWKLERGFVKDIIELLPDPKPH-YNSVSTMVKLLKDKGFVGFEKQGNAYCFFPIVSKEEYQSKAVGDVVEGFFDGSPLKLVNFFAKEQKLSEADVERLLKMIKNQK. 119
149 3.000e-36UniRef50_A0A0P9FLH2 Penicillinase repressor n=9 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0P9FLH2_9GAMM  ali  39  1MDISNSEFEVLQALWRVHPADAQTVVDELNKEKEWHEKTVKTLLGRMVKKGAISFEKNGRSYIYSPVLEIEAYQVQESESLIERLFNGRIAPLVTGFAKNKNLSKQDIDELKHLIDKWE. 119
150 3.000e-36UniRef50_A0A2E9JEU2 Penicillinase repressor n=2 Tax=unclassified Gammaproteobacteria TaxID=118884 RepID=A0A2E9JEU2_9GAMM  ali  20  12..LSRAQLEVMEVIWDLGEAGVADVTTALNKQRPIARNTVRTLMQRTEEKGWLKHRVEGRSFLYSAIVPREESLGHRVMDMVDKACGGNPEKLMMALMDYRGLTEDESTRIRKMLDDAK. 128
151 3.000e-36UniRef50_A0A178INR4 Uncharacterized protein n=3 Tax=Opitutaceae TaxID=134623 RepID=A0A178INR4_9BACT  ali  30  1..........MKVIWKSGPCTAQVVIDALSGPNEWTVSTIKTLLGRLLAKGALSHEKNGKAFVYAAVHGEADYRAAEADSFLDRFFDGALSPLFAHFASTRKLRKRDIDEIEQILRASK. 109
152 3.000e-36UniRef50_N1Z4W4 Uncharacterized protein n=1 Tax=Clostridium sp. ASF356 TaxID=97138 RepID=N1Z4W4_9CLOT  ali  21  3.KISDAEMEIMKIIWNNNPLTSKQIIELIPNNQ-WKTTTVLTLLSRLVDKGFLKAERKGRNHLYSYILSYKEYSKLCSKKLINKFYQGSFKNFFAALYADNEISQEDLYELREMLNKRED 121
153 4.000e-36UniRef50_F2JMV4 Transcriptional repressor, CopY family n=2 Tax=Cellulosilyticum lentocellum TaxID=29360 RepID=F2JMV4_CELLD  ali  35  4.NITEAEWKIMHVLWELSPLSLKEIIEELKKEKAWSNTTVRTLIVRLMEKGFIDADKTTSTFKYYPLVQKEECQIKEAKNLINTVFEGSMGMLVTAFAKRGKLTEKEQEELRKLIDKIEE 122
154 4.000e-36UniRef50_A0A2D8CKN0 BlaI family transcriptional regulator n=5 Tax=Balneolaceae TaxID=1813606 RepID=A0A2D8CKN0_9BACT  ali  18  8..LGESEMEILHHVWGMGEATVAQVQEEILKTRKVAYTTVMTIMKNLNDKGYLKYRKDGVTYVYSARKKPQDVQSSLVSGMIDKVFKGSTSALVQTLVKGENLSEGELKELRDMIDDMEE 125
155 4.000e-36UniRef50_Q02CV3 Transcriptional repressor, CopY family n=8 Tax=cellular organisms TaxID=131567 RepID=Q02CV3_SOLUE  ali  27  11..LTPLELQIMNVLWETGPSNVQSVQLNL-KGRELAYTTVQTMLNVLHRKGKVKRLLKDRTYIYRPVLSRQKAVSQAVGEMLDRFFGGSADGLVLNLVETRQLTPEKLARIQELIDRPKE 127
156 4.000e-36UniRef50_A0A0F7PV25 Uracil phosphoribosyltransferase n=30 Tax=Lactobacillus TaxID=1578 RepID=A0A0F7PV25_9LACO  ali  19  7VEISNAEWDVMRVIWALGETTSRQIIEALSDRRQWKPATTKTLIGRLVAKGYVGTRRKGRAYIYYPIIKEQQTINEQILTSFGNICQMHVGQTLATVLNNVELSKDDIKKLESILE.... 122
157 4.000e-36UniRef50_A0A1M7QR61 BlaI family transcriptional regulator, penicillinase repressor n=29 Tax=Bacillales TaxID=1385 RepID=A0A1M7QR61_9BACI  ali  28  7..ISESEWEVLKVLWKKAPLTANEIISTLAVETDWKPKTVRTLLDRLTKKEVIGVHRDQRVYTFYPLYSQDECQRAKAKSFVKRFYDGTLQSMLVQFIQDEDLSENEIRELRSILDKKE. 123
158 4.000e-36UniRef50_UPI000420580A BlaI/MecI/CopY family transcriptional regulator n=2 Tax=Cytophagaceae TaxID=89373 RepID=UPI000420580A  ali  26  6..LTRAEAEIMKILWKLQKAFVKEILAQMPDPKP-AYNTVATFIKILEKKNIVSHITYGSTHQYFPLITEEEYKRHEVEQLMGNYFENSAANLVSFFFNDKKLNANELDEIMEFVKK... 119
159 4.000e-36UniRef50_A0A1H2AWK2 Predicted transcriptional regulator n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1H2AWK2_9SPHI  ali  15  3IKPTESELEILQIIWEKGQCTVRDVHEVLAKTKDAGYTTTLKLMQIMHDKGLVERDTSAKTHLYKALITREQAQNTALDKIISTVFKGSTSQLIMQALSSNKSSKAELDMIKDYLDKLE. 121
160 4.000e-36UniRef50_A0A2E0X5W9 Transcriptional regulator n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E0X5W9_9PLAN  ali  26  4.NPTDRELEALKVLWSRGEATVREICDAMNDAAELAYTTVLSLLQVMEQKGLVNHRRDGKAYVYLPLIERDRTFRDLTGGFLDRVFDGAVSDYPVHALESRDLSADELSELEAMIAAAKE 123
161 5.000e-36UniRef50_B8L3Z8 Beta-lactamase (Penicillinase) repressor n=435 Tax=cellular organisms TaxID=131567 RepID=B8L3Z8_9GAMM  ali  49  4..ISEAEAVVMEVLWQQAPRSADEVVAALAH-RDWAEPTIKTLLNRLLTKGAIAAERDGRRYLYRPLLQRQAWVEAQSQDFIGRVFEGRVAPLVAHFSERGRLSAQDIAELKKLIQELD. 119
162 5.000e-36UniRef50_A0A2D5Z4Y8 Transcriptional regulator n=1 Tax=Phycisphaeraceae bacterium TaxID=2026777 RepID=A0A2D5Z4Y8_9BACT  ali  23  9..PTAAELTILTVLWEHGPCSVREVADALSKTHPTGYTTKLKLLQVMLSKGLVSRDDSNRAHRYTASVSRNRVQRHVVRSMIDRAFGGSARNLVMHLLRSRELTDEEIDEARRMLRD... 123
163 5.000e-36UniRef50_A0A2P8D5Y5 Putative transcriptional regulator n=18 Tax=Bacteria TaxID=2 RepID=A0A2P8D5Y5_9BACT  ali  17  4IKPTESELEILNVIWEKGAATVREVHEVLEKQKPSGYTTTLKLMQIMFEKDLLLREASGKTHIYRAAIGKEAVQGQIVQRMIDNVFSGSAAQLVMQALGNSSTSAEELDEIRKYLKSL.. 121
164 5.000e-36UniRef50_UPI000830960B BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Anaerotruncus rubiinfantis TaxID=1720200 RepID=UPI000830960B  ali  27  3.KLSDSELAIMQHIWRARPVTAGGLVGAFCESRGWKIQTVNTFLTRLTEKGFLTVRKQGHQNLYSVTVSEAQYRAAETRSFLDEIHGGSVQSLMAALYQSDGLTADDVAELKRWLSER.. 120
165 5.000e-36UniRef50_A0A192WXI1 Uncharacterized protein n=1 Tax=Acidobacteria bacterium Mor1 TaxID=1660251 RepID=A0A192WXI1_9BACT  ali  24  9..LTEAEQRVMEVLWDLPEASVRDVVDRLSEERPLAYNTVQTVLGILYRKNYVEFRREGRAHIYRAVVSRPEAQREAFDNLVTRFFGGSKNAFARYLVEEGQVDARELSRLKGLARKSR. 125
166 5.000e-36UniRef50_A0A0J1IR55 Beta-lactamase repressor n=4 Tax=Firmicutes TaxID=1239 RepID=A0A0J1IR55_BACCI  ali  27  6.QISEGEYEVMKVVWNYEPISTPEIVEKVLKNSDWKPNTIHTMLVRLVKKKVLQTRKDGRAFIYTSLVKENEYVEQKSKSFLKQFFGGTLNSMVLNFIENEQLSKEDISELKSILAERD. 123
167 5.000e-36UniRef50_A0A2D9KJP8 CopY family transcriptional repressor n=3 Tax=Alteromonadaceae TaxID=72275 RepID=A0A2D9KJP8_9ALTE  ali  34  5IDISEAEYEVMLVLWNKPELTSKLILENL--DKAWQLTTLNTLLNRLVKKQVVAYTKSGREYIYHPLVAKEHYVEQESQDFVQKLFGGSLSPLVAHFSKSQKLQQKDIDALKKLIEEWED 122
168 6.000e-36UniRef50_A6DMV4 Methicillin resistance regulatory protein MecI n=8 Tax=PVC group TaxID=1783257 RepID=A6DMV4_9BACT  ali  36  9.NLSESEWTVMEVLWEQSPQTAKDVKIALEEPKQWAINTVRTLLTRLVNKGALETDNQSGVTTFKPLISHENCIRAESQSFLKRIFGGSSMPLLVHFSQNADLSEDDVEELKKILDE... 125
169 6.000e-36UniRef50_UPI00082F5752 BlaI/MecI/CopY family transcriptional regulator n=2 Tax=Bacillus TaxID=55087 RepID=UPI00082F5752  ali  27  6.QISEAEFEVMKVIWTYEPISTPEIVEKLSKKSDWKPNTIHTMLARLVKKSALHARKDGRMFIYTSLVEKHEYVEQKSKSFLKQFFGGTLNSMVLNLIENDQLSNEDITELKKILRDKKE 126
170 6.000e-36UniRef50_A0A1H0D2F3 Copper transport repressor, CopY/TcrY family n=3 Tax=Bacilli TaxID=91061 RepID=A0A1H0D2F3_9BACI  ali  27  8.KITDAEWEVMRVAWAHDRVTSKEIINVLEQKMDWKPATTKTFIGRLVKKGMLHTETEGKKYIYSVNVSESEITKRNLNEFLERMCDKEVGNTIVHLISKAPLSFKDIENLEKILERKK. 125
171 6.000e-36UniRef50_A0A1X3BWV0 Uracil phosphoribosyltransferase n=70 Tax=Bacteria TaxID=2 RepID=A0A1X3BWV0_ENTFL  ali  26  9..ITDAEWEVMRVIWTQGKTTSREVHTLLNEKKEWKSTTVKTLLSRLTDKGLVGTEKVGNKYIYYPLVEERRSVETVADELLAKVCSRKVGSVVETILTESQLSYDDLDRLEELLKEKR. 125
172 7.000e-36UniRef50_A0A1Y4AEQ8 Penicillinase repressor n=2 Tax=Alistipes TaxID=239759 RepID=A0A1Y4AEQ8_9BACT  ali  26  14..LTRGEEEIMQILWQLGEATVNEVIACTREPHP-KYTTVATFLKILENKGFVGHTAESKSHRYHPLVAKESYARNVMQSMLGSYFNGSLAQMVSFFSQHEQISIKEMEEILEI...... 124
173 7.000e-36UniRef50_A0A177RG13 Uncharacterized protein n=2 Tax=Verrucomicrobiaceae TaxID=203557 RepID=A0A177RG13_9BACT  ali  37  21..ISEAEWALMELLWESSPRTSAELCTALERTRRWKRATVMTLLSRLISKNAVSTEGEGRRWNYIAAVPRASCVAQETRGFLDRLFKGALLPMVAHCIEHQKLSTQELADLRALLDQAK. 137
174 7.000e-36UniRef50_A0A1U7CUW2 Penicillinase repressor n=3 Tax=Planctomycetales TaxID=112 RepID=A0A1U7CUW2_9BACT  ali  25  9....KSELEVARIVWDLGVATVRQVLDALPVERGLDFKTVQTYLRRLEAKGYLETRREGRSNVYRPIIRPDQVVGEVTDDFLNRLFDGQVLPLFQHLVNDRGLSDVEIRQLRELLDRLED 124
175 7.000e-36UniRef50_A0A1G2WA86 BlaI/MecI/CopY family transcriptional regulator n=34 Tax=Caulobacterales TaxID=204458 RepID=A0A1G2WA86_9CAUL  ali  64  3.KISGAESQVMEALWARGPLTAEEIFQAVGPAQDWGEATVKTLINRLLKKKALKSERAGGRALYKPIVTREDYVTGESQGLLDRLFGGQVAPLVAHYARHRDLSAAEVARLKSLIAELE. 120
176 8.000e-36UniRef50_A0A239JWD8 Predicted transcriptional regulator n=1 Tax=Pontibacter ummariensis TaxID=1610492 RepID=A0A239JWD8_9BACT  ali  22  3.KLGKREEQIMQAVWHLEKAFIKDIIDELPEPKPH-YNTVATMVKILTEKGFLSAEKIGNTYQYTPLVPLAEYRKQDVATIKSKYFGNSFTRMISHFAREEKLSDEEIDELVRIIKSQR. 119
177 8.000e-36UniRef50_A0A142WZ09 Methicillin resistance regulatory protein MecI n=2 Tax=Planctomycetaceae TaxID=126 RepID=A0A142WZ09_9PLAN  ali  24  10..LSEAQWEIMNLVWDRGECSVADVWKVLQERRGVARNTVQTLMIRLKEKGWLSAREVDGAFLFTPTVSRDCSQQSTVQRLIETVFNGSAEGLVLSLLHGGALSTGEVERLRRLIARKKE 129
178 8.000e-36UniRef50_C7RA84 Transcriptional repressor, CopY family n=5 Tax=Proteobacteria TaxID=1224 RepID=C7RA84_KANKD  ali  33  3IRVSEAEKNVMDILWQESPLTSTEVVERL-QTQDWSEKTVKTFLNRLVKKRVVTFQKEGRRYLYSPAIERDEFLADESESFLDKVFKGNMKELLATFVDNKQLSKDELDYLKGLLSDKE. 120
179 9.000e-36UniRef50_A0A099KQ05 Transcriptional repressor, CopY family n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A099KQ05_COLPS  ali  23  8.QLTDSEQSIMEILWKKEQASVREITDTLSEEKTTAYTTVQTMCKILADKGYADFHKEGKAFIYTPKITQKDARKGALTSLLNKFFGGSPEVLAQHLMQETDIELDDLAALQKEIDRSDD 126
180 9.000e-36UniRef50_A0A1Q3N4D9 Transcriptional regulator n=13 Tax=Bacteroidetes TaxID=976 RepID=A0A1Q3N4D9_9BACT  ali  20  3.HLTAQEEEIMLVIWKQGKVFVKEIIAYL--RTDIPYTTIASTVKNLEKKGYVQSEKMGNAFRYFPAIPQDDYKKTFMKEVVEDYFQNSYKQLVNFFVREKKLTAAELQEIIKMIEQNKD 119
181 1.000e-35UniRef50_A0A2P1PPA5 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Ahniella affigens TaxID=2021234 RepID=A0A2P1PPA5_9GAMM  ali  36  1MELPDSELAVMDLLWAEAPRTSEGLIAALQDARGWQPSTVKTLLARLVRRGAVRAERDARRFSYSPLWEREQYLNQATGNFLDTLFGGQVTPMLAHLSQHRALKPEERDALSKLLKDLE. 119
182 1.000e-35UniRef50_A0A2D6JIV9 Transcriptional regulator n=1 Tax=Bdellovibrionaceae bacterium TaxID=2026715 RepID=A0A2D6JIV9_9PROT  ali  30  11..LTKTELELMNLLWDLGEGSVRDVMAALPQDRDLAYTSVSTILRILEKKEFLKSRKESKTHIYTPLVQKESYEVKETGSLLNNLFSGSGLSLVKCLIDNDQLSEDEMESLKKMIEEK.. 126
183 1.000e-35UniRef50_A0A0Q8CTR6 MarR family transcriptional regulator n=3 Tax=Xanthomonadaceae TaxID=32033 RepID=A0A0Q8CTR6_9GAMM  ali  24  10...TEAEQAILEVLWELGEASVREVANALARQKPVAYTTVLTMLGILHKKELVTFRQEGRAFIYRPALTKADVRERALSHLMTQLFDGSPEALALHLIENHDVDPGKIAALRDKIRAAR. 125
184 1.000e-35UniRef50_A0A174RR32 BlaI family transcriptional regulator n=16 Tax=Firmicutes TaxID=1239 RepID=A0A174RR32_9FIRM  ali  31  1MKLSDKEWRVLNALWVAPELALGAVVDALRPDTGWSRSTVLTYLTRMEAKGLVDIRKEDFPHRYRAAVSREDCAAAERRGLLERAYQGSAGKLVAAFLKDEKLTPQERDELRKLLDEME. 120
185 1.000e-35UniRef50_B2TPS0 Penicillinase repressor n=21 Tax=Clostridium TaxID=1485 RepID=B2TPS0_CLOBB  ali  25  6.KISNAEWEIMKVIWSHTEITSVNIICELKDKVEWKPSTIKSLINRLLKKKVIGFKRLSNEYLYFPLISEDECIKIESKSFINKVFNGSVKSMLLNFVESKEISETDIEELKNILKQ... 121
186 1.000e-35UniRef50_A0A1V4VT41 Penicillinase repressor n=10 Tax=Firmicutes TaxID=1239 RepID=A0A1V4VT41_9FIRM  ali  30  4VNITEAELEIMKILWKSDPLSSYDICDRL-EDKTWKYTTVSTLLSRLAEKGAITYEKRGKSYFYTPLLDENAYKIRQAKKLIGKIYDGSLKNLVVALYENKEISEQDIQEIKKL...... 117
187 1.000e-35UniRef50_A0A1C6GDU4 Regulatory protein BlaI n=14 Tax=Clostridiales TaxID=186802 RepID=A0A1C6GDU4_9FIRM  ali  29  3.RLTDSEWKVMEALWQGGPQTLGEVLARLAEDTGWSRTTVHTYLTRMMAKGLVAADAQSPR-RYSAARSRESCVAEEERSLADRAYGGSAGRLVAAFVRSGQLGREERAELRRLLDEME. 119
188 1.000e-35UniRef50_UPI00029A2B26 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Schlesneria paludicola TaxID=360056 RepID=UPI00029A2B26  ali  22  10..LSEAQLEIMNIVWLAGECSVADVLEQLSTRRTVTRNTVQTMLSRLDEKGWLIHRDDGGTFIYRTSVPRERVQQQRLEQVVETVFDGSTAGILMALLKDSTLTSDEANRIRKMIDHAE. 126
189 1.000e-35UniRef50_UPI000D686586 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Occallatibacter savannae TaxID=1002691 RepID=UPI000D686586  ali  23  9.RPTEAELELLQILWQKEPATVRDIYEALNEEKPSGYTTVLKLLQIMTTKGLVVRDEAARAHVYRAAFSQDTMQSRLLSDLSNRLFAGSAAQLALHALSMGPASEDELAEIRALLESRR. 126
190 1.000e-35UniRef50_A0A0S7YC38 Uncharacterized protein n=1 Tax=Planctomycetes bacterium DG_20 TaxID=1703413 RepID=A0A0S7YC38_9BACT  ali  29  11..LSGSEWAVMKALWEAREMAAGEVYGVLAQERDWAYPTVRTLLRRLVAKGWVDAQRVGNSYLYRPAVPRDKAVRRAVREFSTRVLDGLLTPFVAYYIEEHDLSPEEVAQLEAIVRRQRE 128
191 1.000e-35UniRef50_A0A267MHL8 Transcriptional regulator n=1 Tax=Anaeromicrobium sediminis TaxID=1478221 RepID=A0A267MHL8_9CLOT  ali  27  7.KISDSEYEIMKIIWKNHPIKSNDIIQQIDQGHNWSEKTIKTMINRLLKKEVISYKKDGKSYLYYPLVEESNYRKLENESFLKKVYNGSINVMFASFIKDMKLSDKDINELKMILEE... 122
192 1.000e-35UniRef50_A0A1I2G1X0 Predicted transcriptional regulator n=2 Tax=Nannocystis exedens TaxID=54 RepID=A0A1I2G1X0_9DELT  ali  25  5VQLSDLQLGLLRILWDRGEATALEVHSALVERRGLAPTTVSTMLSRLEKKGAITHRTEGRQFIYRALVGEVDVRRSMLSRVTDYFFGGDVSALVSHLVEGRGVDPDDALRLQQLLAER.. 123
193 2.000e-35UniRef50_A0A0P9DWI8 Beta-lactamase n=7 Tax=Paenibacillaceae TaxID=186822 RepID=A0A0P9DWI8_9BACL  ali  36  6.HITEAESEVMKLLWQKEPLTAIEIISKLKDQMDWSDQTVKTFLNRLHKKNAIRFEKSGRNYLYYPLVSYDEYVKAANRSFLDRIYNGAVGMLFAKFLEEEKLSESEIDQLQQLLEKKK. 123
194 2.000e-35UniRef50_A0A143PP97 Regulatory protein BlaI n=11 Tax=unclassified Acidobacteria TaxID=458031 RepID=A0A143PP97_9BACT  ali  23  7..LTPQELAIMKVVWRLGSATVRDVHDVLRREHDLAYTTVLTMMRILEQKGMLSKSQDSRGHRYTPARTQRQMMRVLVREFVDRVFDGAADSLVAHLVADRKLSARDRAEIRKLIDK... 125
195 2.000e-35UniRef50_K9EBB0 CopY/TcrY family copper transport repressor n=1 Tax=Alloiococcus otitis ATCC 51267 TaxID=883081 RepID=K9EBB0_9LACT  ali  25  5..ISQSEWEVMRVAWAQNRVTNREIYEVLADKTEWKMSTVKTLVRRLCDKGFLRPEKGSREYTYRPLISQNQALAAASQELFSQICNKEVGSVLIDFIREAPMSQADLDQLQALVDEKK. 121
196 2.000e-35UniRef50_A0A0J1F9R9 Penicillinase repressor n=1 Tax=Peptococcaceae bacterium CEB3 TaxID=999898 RepID=A0A0J1F9R9_9FIRM  ali  28  6.RITDAEWQVMKILWEKAPITSLALVEILQSRIGWKPTTVYTLVSRLVTKKAVMVDKSSSPYVCTPLLSEQECRRAERNSFLQKAYDGSLSMLVVNLLEENELSANEIEHLKRVLANKK. 123
197 2.000e-35UniRef50_A0A2D6A069 Transcriptional regulator n=1 Tax=Bdellovibrionaceae bacterium TaxID=2026715 RepID=A0A2D6A069_9PROT  ali  19  12..LTDTEIQIMNVLWDLGAVTVHDVQEALNQQKEYAYTTVSTMLRVLEKKSVVRSEKQGRGHIYSAGIAQKDYQKKATDHLVEQVFSGSRSDLLKNLLGAGALSAKDLNEVRELLDSKR. 130
198 2.000e-35UniRef50_A0A1C6BKM2 Regulatory protein BlaI n=29 Tax=Firmicutes TaxID=1239 RepID=A0A1C6BKM2_9FIRM  ali  25  3.RLPDTELEVMKALWTSGPGTPRAQLDQILAPFGWSPNTINTYLTRLVAKGFVSVRREGRGNLYTPLILRDDYQAFDSRAVVSRLY-GSPRNFVAALAREG-LDRRDLDELQALLNEL.. 117
199 2.000e-35UniRef50_A0A017TA79 Penicillinase repressor n=7 Tax=Bacteria TaxID=2 RepID=A0A017TA79_9DELT  ali  19  8.QLGDLQLAILQVLWELGEGTVTDVYQALLAERGLAPTTIATMLKKMDEKGVVEHHAEGRRFIYRPTVTREQVRRSMVADLTERLFGGDPAALVAHLISRNEIRAEELTALERQIAEAR. 125
200 2.000e-35UniRef50_A0A1Y4S6Q9 Transcriptional regulator n=1 Tax=Flavonifractor sp. An135 TaxID=1965558 RepID=A0A1Y4S6Q9_9FIRM  ali  27  7.HLPDGELEIMQIIWHREPVSRSDIEAALGPDKALAPTTILTFLTRLCEKGFLSSERVHRVNWYTPLITEREYLASESRSILDKLYGGSLSAFAVSLCDSG-IKQEELDELRDLLER... 122
201 2.000e-35UniRef50_A0A0F6TQ31 CopY family transcriptional repressor n=2 Tax=Kangiella TaxID=261963 RepID=A0A0F6TQ31_9GAMM  ali  35  3IRVSEAEKSVMDVLWQESPLSSLEVVEKLQSQ-EWSEKTVKTFLNRLVKKGVVTFEKDGRRYLYSPAIEREEFLADESEGFLDKVFKGNMKELLATFVENKQLSQNELDYLKGLLDDNK. 120
202 2.000e-35UniRef50_A0A142YGS4 Penicillinase repressor n=8 Tax=Planctomycetales TaxID=112 RepID=A0A142YGS4_9PLAN  ali  23  8...TDRELEIMKILWARGQASVRDVQEDLNDSGPVAYSTVQTLLNIMEKKGLVRHVVEGRTFIYHPKKSSERTIRELTRKFVDRVFDGALDRVMVALFDSKPPTPEDLDRLRAMIDDAQ. 125
203 2.000e-35UniRef50_A0A1Y3XN93 Uncharacterized protein n=2 Tax=Gemmiger TaxID=204475 RepID=A0A1Y3XN93_9FIRM  ali  26  71MRLSEAELEIMEQIWKLGPVTAAELAGPL-QQKGWKPTTLLTFLARMAAKGALKVEKRGKQNVYTACVSSEQYRAAEAQELLTKLYSGSVKSMVAALYDGKALSGDQLDELRDWLE.... 186
204 2.000e-35UniRef50_A0A1Y4HLJ9 Uncharacterized protein n=1 Tax=Anaerofilum sp. An201 TaxID=1965588 RepID=A0A1Y4HLJ9_9FIRM  ali  27  7.RLGDAELEIMQILWENAPLSAGQIHTALQGQRSWALSTLMTVLARLADKGFVECIRTEKPNRYAALVAKTDYQASESRSFLARLYGNSVQSMMATLYDSRMLDGQDVRELRAFLDELEQ 126
205 3.000e-35UniRef50_UPI000DAB68FB BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Phenylobacterium sp. LX32 TaxID=2170551 RepID=UPI000DAB68FB  ali  64  12..ISGAESQIMEALWARGPLGAEDLVREVGGPQGWGEATVKTLINRLLKKKAIASERVGGRARYRPLVSRADYVTGESQGLLDRLFGGEVAPLVAHYAKHRPLSAEEIDRLKALIAQME. 128
206 3.000e-35UniRef50_UPI0008DA1756 CopY/TcrY family copper transport repressor n=1 Tax=Enterococcus timonensis TaxID=1852364 RepID=UPI0008DA1756  ali  19  6..ITDAEWEIMRIVWTKGETTSTEIFELLQEKINWKPSTVKTLLNRLVEKNYLQTEKSGKRFLYTALVAENKATSDLATEVEGKICAMKIPDFLAQLLEDSQFTKEDLAHFEEIINNKK. 122
207 3.000e-35UniRef50_A0A1I6LRV4 Predicted transcriptional regulator n=1 Tax=Dyella sp. OK004 TaxID=1855292 RepID=A0A1I6LRV4_9GAMM  ali  54  1MSISEAESVVMEVLWRQAPRSAEEILAEVGPQQGWQEGTVKSLLNRLLKKKAVKAEREGRRYLYIPRLTREQYVSQESKGLLDRLFDGRIAPLVAHFSEQHKLSRKDVADLKKLLEELDD 120
208 3.000e-35UniRef50_A0A2V5VW89 Transcriptional regulator n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5VW89_9BACT  ali  23  11..LGAAEAEILKIVWELKEATVQQIWERLPAERNIAPTTVQTVLRRLRQKGYVKSSAEGKAHTFSPAIKPERVISKTVGDLVNRFFGGDAVPLLMHLARTRKIAREDLKRLQDLLKRPK. 127
209 3.000e-35UniRef50_L0DCP9 Putative transcriptional regulator n=10 Tax=Planctomycetales TaxID=112 RepID=L0DCP9_SINAD  ali  20  8.QPTPAELEILKILWRNGPSTVRDILEVLQADSPRAYTSVMSLMNVMTEKGLLRRSPQGRAFVYEPVLPREQTQRSLLSETLERAYSGSASLLVAHLLDQSAPSADELDQIRSLLDGYED 129
210 3.000e-35UniRef50_A0A2D6PQH9 BlaI family transcriptional regulator n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D6PQH9_9BACT  ali  27  7..LSDLQLSVMQALWQRGEGTVSEIHEALLTQRDLAVTTVATLLSRLEKRGLLIHRVTGRQFVYRPTVTEEDVRQDVVSRVADRVFRGDVTELVCQLLSARELAPGDLDRVKSLIREREE 124
211 3.000e-35UniRef50_A0A1G0LLW6 BlaI family transcriptional regulator n=1 Tax=Gemmatimonadetes bacterium GWC2_71_10 TaxID=1798309 RepID=A0A1G0LLW6_9BACT  ali  26  4LELTELQLDVMRVLWQAGEARVSDVHAALEPERGLALTTVATLLSRLEKAGLAARRPEGRHFVYRALVSEEDVRRSMVSGLADRLFRGDVTALVSHLLTEGEIAAGDLERVKRLIDSRQ. 122
212 3.000e-35UniRef50_A0A1V5MFZ3 Penicillinase repressor n=5 Tax=Firmicutes TaxID=1239 RepID=A0A1V5MFZ3_9FIRM  ali  27  4IKLFDSELKLMEHVWSNAPITAKELALIADKEIGWNKNTTYTVLKKLVDKGAIRREE--PNFICYPIVSKEQVQQAETDNLINKLFNGSKKAFFAAFVGREKLSASEIEELKRIIEKSGE 121
213 3.000e-35UniRef50_O07127 Uncharacterized 16.5 kDa protein in ptsI 3`region n=49 Tax=Lactobacillales TaxID=186826 RepID=YPTY_LACSK  ali  23  7.EITTSEWEVMRIVWSLGQVNSRDLIDLLQPKRDWQDSTIKTLIGRLVKKGFLKTEKEGRRFNYTATVPEIEAMENATQSLFEHLCGMKKGQTLAALIDQTTLSQTDILQLQQLLTAK.. 123
214 4.000e-35UniRef50_A0A0Q6TYJ8 BlaI/MecI/CopY family transcriptional regulator n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0Q6TYJ8_9CAUL  ali  55  1MKISSAESVVMEALWRRSPLTSEAIITEVGEPQGWTEGTVKVLISRLLKKKAITATAEGRRYLYSPLVSRRAYVETESQGLLDRLFNGRLAPLVTHFSEGDRLSDEDIAELKALIEK... 117
215 4.000e-35UniRef50_A0A176U2C2 Transcriptional regulator, BlaI/MecI/CopY family n=7 Tax=Firmicutes TaxID=1239 RepID=A0A176U2C2_9FIRM  ali  26  7..LSDGEWKLMKLLWENYPMTLGDMVEAMQDDTAWSKGTIFTMLRRMNTKGVIRMDDSGRYQQYYPVLQKEEAEQAETRSFLERVYDGSVGMMLSAMAHDRKLSKSEIDELYKIIQEARE 124
216 4.000e-35UniRef50_A0A0R1R7L8 Penicillinase repressor n=47 Tax=Lactobacillales TaxID=186826 RepID=A0A0R1R7L8_9LACO  ali  23  11LEISDAEWEVMRIVWTLGESNSRQITEILADKMGWKSATVKTLLGRLVKKQALTTRKDGNAFIYTPLVAEQDAMDSATRALFGHLCQMKVGQTLADLIDDLTLSKANIADLQAQLAEK.. 128
217 4.000e-35UniRef50_A0A2E9MHE8 CopY family transcriptional regulator n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E9MHE8_9BACT  ali  24  10.KLTPLETLIMNVLWDDSPAPVKQVQEKLKSAKPMAYSTVLTMMRILRDKGFLVSERRGRADFYRPTVTRRNMGCRSLGEVMDSFFAGSATALVSQLLNGERLSDEELTSIRAQVDKVK. 127
218 4.000e-35UniRef50_A0A2A5DFJ7 BlaI family transcriptional regulator n=3 Tax=Bacteria TaxID=2 RepID=A0A2A5DFJ7_9BACT  ali  21  6.RLGDLQLAIMHVLWSEGEATSSQVHAALLEEHGLAPTTIATMLKKMEAKGVLKHRKEGRIFVYQPTVAEEHVRQTMVGELVGRLFMGDTAALVNHLLTEGDIDAAELAALRTRIEEER. 123
219 4.000e-35UniRef50_A0A2A5AK41 MarR family transcriptional regulator n=1 Tax=SAR86 cluster bacterium TaxID=2030880 RepID=A0A2A5AK41_9GAMM  ali  23  9..LTEGELRLMKVIWTLETATVRDVVVELQKKGKVAYNTVQTMLRILEEKGYLTHTKTGRSFVYIPIVQRHNARSAALKQLLSNFFDDSPQSLMINLIEDEELNASDIKKLKELIAK... 123
220 4.000e-35UniRef50_A0A2E7K9V9 BlaI family transcriptional regulator n=8 Tax=Planctomycetales TaxID=112 RepID=A0A2E7K9V9_9PLAN  ali  23  5.QLGRVQLQIMQVLWDRGRVNAREITDALNQHSNIAHSTVQTLLRQLEAKQAVAHDVEDRTFVFYPLIKEDKVTREATRGLINDIFDGSAAGLVAYLLENEKIPKSELQQLRKLIND... 120
221 4.000e-35UniRef50_A0A1Y6CFS9 Predicted transcriptional regulator n=1 Tax=Alteromonadaceae bacterium Bs31 TaxID=1304903 RepID=A0A1Y6CFS9_9ALTE  ali  17  4..PTQAELEILNILWGMGELRVQEVHKQLNEVRPIGYTTTLKMMQVMAQKGLLARQLDGRSHIYSPVIQESTTKNKLLSRFVDSTFGGSRSQLLMQLLGNAKVSDEELKEIKDFLAQIEE 121
222 4.000e-35UniRef50_UPI0009855C36 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Marinicella sediminis TaxID=1792834 RepID=UPI0009855C36  ali  23  8IKLSQSQIDVMKVLWQHDKLAVSDVHQALNQHKQLALTTVATVLKRLQEKDIVGYEKAGRQYLYFARVSEAEVRSSMLANLLNHLFNGEPEALVHHLVDQESVSEADLQKIKALLDE... 124
223 4.000e-35UniRef50_A0A1Q6F8Q6 Transcriptional regulator n=1 Tax=Bacteroidales bacterium 43_36 TaxID=1897038 RepID=A0A1Q6F8Q6_9BACT  ali  22  3.KLSEREEEIMSVLWNNGPLFVREIVEKLPEPRPH-FNTIATFLKGLESKGWVKKEMVGNANRYCAIKDVEPYRESSLKNIISRFFGGSSLNLVSTLTRNESISADELRELIDMIEKKK. 119
224 4.000e-35UniRef50_UPI000946601E BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Mariniblastus fucicola TaxID=980251 RepID=UPI000946601E  ali  22  10..LSDKQREIMDIVWELGEASVFEVREELLKRRQVARNTVRTMMERLEEKGWLRFRVIGRTHFYAALIPREVNLGRRVMDLVNKICGGSPANLMSALINHGDLSEAEIERIEKLLAEAK. 126
225 4.000e-35UniRef50_A6BZP2 Probable beta-lactamase repressor n=11 Tax=Planctomycetaceae TaxID=126 RepID=A6BZP2_9PLAN  ali  20  4LHLTKCELEVMDVVWRKGRATVQDVVDSL--ERPLAYTTVMTTLKILEQRDVLRKKKQGRAYVYEPAVSREEISSSMAADLTQRLFGGSVKSFVLSLVESDSMSQSDIEELKQAIESLE. 121
226 4.000e-35UniRef50_A0A1G5YAH8 Predicted transcriptional regulator n=11 Tax=Bacteroidetes TaxID=976 RepID=A0A1G5YAH8_9BACT  ali  16  22.KPTESELEILSLLWEMKEASVRQIHERLAETKDTGYTTTLKTMQIMYAKGMVTRDEENRSHIYRPKTNQQETQNSLLKSLMSTAFGGSSKALVMQALGQDNPSKDEIDEIRAFLDQLE. 139
227 5.000e-35UniRef50_A0A1U9NQI5 Regulatory protein BlaI n=1 Tax=Phycisphaerae bacterium ST-NAGAB-D1 TaxID=1936003 RepID=A0A1U9NQI5_9BACT  ali  22  12.RPSELELQVLSVLWDKGPASVRDVMNSLPDGKQRAYTSVLSVMQVMEKKRLLTHTRQGNTHIYKPTKPRRAVVDPLMKRLASNIFNGSKVSMVQSLLGSEKLTDAELAKLEQLIESKK. 129
228 5.000e-35UniRef50_A0A0S2HXS6 Regulatory protein BlaI n=207 Tax=Bacteria TaxID=2 RepID=A0A0S2HXS6_9BACT  ali  27  3.ELTKAEQQVMQQLWKLEKAFVRDIIAELPGPKP-AYNTISTIVRILERKGFVKHEAFGKSHRYYPVVSKKEYTKGFFKGFLNNYFSNSMKNLVSFFAKDKSLS................ 104
229 5.000e-35UniRef50_UPI00098D0FE4 CopY/TcrY family copper transport repressor n=1 Tax=Wohlfahrtiimonas larvae TaxID=1157986 RepID=UPI00098D0FE4  ali  22  4IKITKTEWEVMRILWTQGECYSNEVTTLLSEKYEWKPSTVKTLIARLVNKGYVGKHPEGNRYRYFPTISEKESLQQSRAELAHHICSTKMGKYIAALLEENPLSHSDIALISQALEKK.. 121
230 5.000e-35UniRef50_A0A1V4IZY9 Penicillinase repressor n=21 Tax=Clostridiaceae TaxID=31979 RepID=A0A1V4IZY9_9CLOT  ali  21  5.KISDAEMEIMKIIWKKNEITTAEILEELPKENSWKVTTIMTLISRLTEKGILSVTKVGKLNNYFPKITEEEYRAIQTDNFLEDMHKGSVRNFMATLFNNKKISNKDIAELKEWLKE... 121
231 5.000e-35UniRef50_D5BB68 BlaI-like antibiotic resistance-related regulatory protein n=276 Tax=root TaxID=1 RepID=D5BB68_ZUNPS  ali  20  3.QLTKAEEEIMQILWQLKEANVATIIEEMPEPKP-AYNTVSTIVRILENKEFVDHRKKGKGYIYFPVVAKDTYSDQSMTKLINNYFNGSFKSMVSFFMKKNEMDTKDLEAILKEINK... 117
232 5.000e-35UniRef50_A0A0W1AZE1 BlaI/MecI/CopY family transcriptional regulator n=58 Tax=Bacillales TaxID=1385 RepID=A0A0W1AZE1_9BACL  ali  31  7..ITDAELEVMRVLWASPNCPSSEVVKQLAEQVGWSPNTTRTLLNRLVQKEAAGTTQEERNFLFYPLISEQEYLKSETKSFMKKLYGGALKPMLANFLQDKKLNEKEIDDLKALFDESR. 126
233 5.000e-35UniRef50_UPI000C08C39C BlaI/MecI/CopY family transcriptional regulator n=2 Tax=Clostridiales TaxID=186802 RepID=UPI000C08C39C  ali  34  6.QISESELEIMKLLWKKSPLSSNEIISLLSDKNSWSNQTIKTFINRLLKKRALRFEKLGRNYLYYPLVSYDEYIKTENNSFIQRVYDGAIEMLFSKFLEEKNLSKKEIENLQKILEEKK. 124
234 6.000e-35UniRef50_A0A150XIU6 Uncharacterized protein n=10 Tax=Bacteria TaxID=2 RepID=A0A150XIU6_9BACT  ali  24  3.ELTKAEEKVMQLLWQLEKAFTREILDQF-EGTPPSYTTVATVLTILEQKGFVDFEKLGNSKRYYPLVSKEAYSEFALSNVVGKYFEGSLSKLVSFFTEKKNIDLKELDEIIDVIEKNKE 120
235 6.000e-35UniRef50_A0A1I3C836 Predicted transcriptional regulator n=4 Tax=Planctomycetaceae TaxID=126 RepID=A0A1I3C836_9PLAN  ali  22  1MRLTRCEVEIMNAVWHRGTATVQEVCDAL--DRPLAYSTVMTMLRILETKQALERVKRGRAYVYRPLVSREEISHELLAEVRDDFFGGSVKSLMLNLIGGEQVSASDIRELKAALSQLE. 118
236 6.000e-35UniRef50_A0A1F2UG45 Uncharacterized protein n=2 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A1F2UG45_9ACTN  ali  20  19..LGELEADIMRVVWELGGATVKDVFEELYPDKHLAYTTIMTVMSRLANKNVLKQDRSGTAYMYTPNVSQEDMANAMITQVVDKVMGGRVAPILSFLLNKGDIDVKELDRIKQAIQDKK. 135
237 6.000e-35UniRef50_A0A1I1IMC2 BlaI family transcriptional regulator, penicillinase repressor n=1 Tax=Clostridium uliginosum TaxID=119641 RepID=A0A1I1IMC2_9CLOT  ali  31  6.KISESEWEVMKLLWKTSPLTSEKIIDSLSDKMNWSKQTIKTFITRLIKKEAIYFEKCGRVYNYYPLISQNECIKSENESFLKKVYDGALGILFSKFLEEENLSIDEIKELENIL..... 119
238 7.000e-35UniRef50_UPI00098D1B47 CopY/TcrY family copper transport repressor n=1 Tax=Wohlfahrtiimonas populi TaxID=1940240 RepID=UPI00098D1B47  ali  21  4IKITKTEWEVMRILWTQGECYSNDVTTLLSEKFEWKPSTVKTLIARLVNKGYVGKHAEGNRYRYFPTISEKESLQQTRAELAHHICSTKMGKYIAALLEENPLSHSDIALIAQALEKK.. 121
239 7.000e-35UniRef50_A3UBB5 Putative antibiotic resistance-related regulatory protein n=86 Tax=Bacteroidetes TaxID=976 RepID=A3UBB5_CROAH  ali  24  36..LSKAEEEVMQILWKKEKAIMMDILEAYPEPKP-ANTTIATLLKRIQDKGFVSYTQVGRSREYFPLVKKNAYFSKQMNGMIKKFFNNSASQFASFFTEEANMSKEELEDLKKLIDN... 149
240 7.000e-35UniRef50_Q09BI5 Conserved uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=Q09BI5_STIAD  ali  23  8.RPTDAELAILRVLWKRGPSTVREVHEAFQDGTG--YTTLLKLMQIMTEKGLVVRDESQRAHVYSARVPQQKTQRQLVADLMDRAFGGSPAQLALQALSSKKTSPEELAELRRLLDSLE. 123
241 8.000e-35UniRef50_A0A2P6C0G9 Transcriptional regulator n=7 Tax=Bacteria TaxID=2 RepID=A0A2P6C0G9_9BACT  ali  21  8..PTDAELAILRVLWTHGPATVRTVQERLDTDQG--YTTVLKHLQLMLEKGLVTRDESGRAHVYAAVIEEADTQRRLVRDLLDRAFEGSARQLVMRALATEDVSRDELNQIRDLLDQFDE 123
242 8.000e-35UniRef50_A0A2G9YAR1 CopY family transcriptional regulator n=1 Tax=bacterium (Candidatus Ratteibacteria) CG23_combo_of_CG06-09_8_20_14_all_48_7 TaxID=  ali  30  22..LSAAELEVMKVLWEKKATTVKEVQQELSHKKAWRYTTVLTFIVRLYNKGYLKRKKEGMVYIYSPTLPEKKTKGKMVEDFVDRVFDGNPTPLMNYLSESNKLKPSEVTALKNLVA.... 135
243 9.000e-35UniRef50_A0A1V5N7W6 Transcriptional regulator BlaI n=5 Tax=Bacteria TaxID=2 RepID=A0A1V5N7W6_9BACT  ali  18  8.KPTESELAILGILWEKGPCTVRQVNETLSKQQPTGYTTTLKLMQIMAEKGLVVRDQSQRTHVYQAHLPEEQTQNQLLGDLMDKAFGGSAEKLVLRALSAKKISAGELAKIKQMLTEIE. 125
244 9.000e-35UniRef50_A0A2S8R9Z7 Uncharacterized protein n=2 Tax=Herbivorax saccincola TaxID=1677857 RepID=A0A2S8R9Z7_9FIRM  ali  20  23.RLSESELEIMLVIWRAGPVNSNYVREAMSE-KDWAKTTVLNFLARLVDKGFLKCESQGKSNIYTPLVMEEDYMKLKNENFLKKFYNNSIKNMVAALYQDQIISDEDLEELKQFIEEK.. 139
245 9.000e-35UniRef50_H7F8B5 CopY family transcriptional regulator n=18 Tax=Firmicutes TaxID=1239 RepID=H7F8B5_9LIST  ali  22  3.KLPDSEFEVMEAVWKLPPVSTNEITSMIDGDKQWKPQTILTLLTRLVEKGFLESSKQGRERRFSPIISEEEYLQVETKNFMKRHYNNSITQLVNTLYDGKGLSNKDIDELKEWLNN... 119
246 9.000e-35UniRef50_A0A1P8WNN1 Methicillin resistance regulatory protein MecI n=11 Tax=root TaxID=1 RepID=A0A1P8WNN1_9PLAN  ali  19  7..LSKAELEIARIVWGLKSATVRQVHDALPVGRDVDFTTVQTYLKRLEEKGYLKVRLENRTRIYAPRVKPRTVIRETVDDLVERLFGGDAMPLMQHLVEEKEFTTADIEQLRSLLNRLE. 123
247 9.000e-35UniRef50_UPI000B598346 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Listeria sp. ILCC801 TaxID=1649188 RepID=UPI000B598346  ali  24  3.KLPDSEFEVMQAVWKLGAVSTNEIIAELADDKDWKPQTVLTLLTRLVEKEFLESSKNGRERRFSPIVSEEEYLQVETKNFMKKHYNNSITQLVNTLYDGKDLTHDDINELKDWLNK... 119
248 9.000e-35UniRef50_A0A143XQW6 Penicillinase repressor n=15 Tax=Clostridiales TaxID=186802 RepID=A0A143XQW6_9FIRM  ali  28  6.QISEAEYEIMKILWEEYPLSTNEICERAQQTHSWNQKTIHTLLSRLNNKRVTSYEKRGRMYYYFPIISQNKYLEQENHHFLDRFYDGKAAPMLSALLSNETLTDSDLQEMYDMIQSK.. 122
249 9.000e-35UniRef50_A0A2C6CN64 Transcriptional regulator n=1 Tax=Lewinellaceae bacterium SD302 TaxID=2014804 RepID=A0A2C6CN64_9BACT  ali  21  4.KLTKAEEEVMRYVWELGECTIGNIRDAMAAKYPAAHSTVSTVLKALRDKEYIGFKSYGRTYVYNPIVSKDEYSRGRLKSLVGRFFGGSPQKMVSFLVEENDLSLEDLEELTRRIND... 123
250 9.000e-35UniRef50_A0A1Y1CNA0 Uncharacterized protein n=24 Tax=Bacteroidetes TaxID=976 RepID=A0A1Y1CNA0_9BACT  ali  23  3.ELTRAEEQVMQILWGLENAFVKEIIEKIPEPKP-AYNTISTITRILEKKGFVSHIAYGKSHQYFPLVGKKEYTRKFMKGFVRNYFSNSYRDMVSFFAKEEQVSLSELEEVKRMVEE... 117
251 1.000e-34UniRef50_A0A140L0F6 Penicillinase repressor n=7 Tax=Firmicutes TaxID=1239 RepID=A0A140L0F6_9THEO  ali  22  6.QMSDAERQIMEYIWKAGPVTTSEIMENLPKGKIWKQNTVITFLSRLIKKGILKATRVGKANYYEPCITEQEYRYFETKQFINEVHKGSIVGFITALFENGDLTKEDIESIMKRLKE... 122
252 1.000e-34UniRef50_A0A180EJB3 Transcriptional regulator n=12 Tax=Bacteroidetes TaxID=976 RepID=A0A180EJB3_9BACT  ali  26  3.KLAKREAQIMQAIWSLEKAFIKEIVEEMPEPRPH-YNSVSTMVKLLEKKGFVGHEKLGNAHRYFALVPKSDYQEEVVDDVVEKYFGGSPMKLVNYFAREQKLDEAELERLLKMIKD... 117
253 1.000e-34UniRef50_A0A0F8ZW36 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8ZW36_9ZZZZ  ali  23  16..LGDLEVDVMGIVWSLKKATVKDVFEVMYERRGLAYTTIMTVMNRLAIKGILEQDKTSVPYIYRPLIERDQMANSMVSEVVDRLLEGSAGAVVSYLIDGGKIKSEEIADLKALIKEKE. 132
254 1.000e-34UniRef50_A0A257WD88 Transcriptional regulator n=5 Tax=Planctomycetales TaxID=112 RepID=A0A257WD88_9BACT  ali  21  7VTPTEVELEILQVLWDRQPATVREVVDVLNQSRPRAYTSILSMLNVMLEKGLVVREEQGRSHVYRTKRSREKTLGGVVKDLLGRAFQGSTSSLIAQVLDQSQPSPEEMDEIRRTIEAWE. 125
255 1.000e-34UniRef50_A0A1Q3GIJ7 Penicillinase repressor n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1Q3GIJ7_9BACT  ali  24  1MKLTKSEEQLMQHIWKLERAFMKDLLEAYPAPKP-AKTTVATLLKRMIDKGFVAYKTYGNSREYYPLIKKKDYFTKHLRGLIKNFFNNSPTQFASFFTANAELSREELEDLKSLIDNK.. 117
256 1.000e-34UniRef50_A0A1P9X1V7 Transcriptional regulator n=4 Tax=Cytophagaceae TaxID=89373 RepID=A0A1P9X1V7_9BACT  ali  22  3.KLTAKEEEIMQVLWKMEPCYVKDMVPHFTNP-PLHYNTVSTIVRNLEEKGYVGHRAYGNTHEYYSVISKEQYQRFVITKVVGDYFDNSYKNLVSYFAQNEKISADELREILAMIEKK.. 119
257 1.000e-34UniRef50_A0A259R4B3 Transcriptional regulator n=1 Tax=Xanthomonadales bacterium 14-68-21 TaxID=1970612 RepID=A0A259R4B3_9GAMM  ali  22  11.RPTEAELEILRVLWSRKQCTVREVHEVLRGGRS-GYTTALKLLQVMHAKGLVLRDDSSRAHVYRAAISKERAQKWFLRDLVRRLFDGSSSQLVMQALGNDEASPSELRAIRELLDQLD. 127
258 1.000e-34UniRef50_A0A142X1F4 Penicillinase repressor n=9 Tax=Planctomycetales TaxID=112 RepID=A0A142X1F4_9PLAN  ali  23  9..LTDAQREIMEIVWAEREVTVSQVWTTLSPKRDVARNTVQTLIVRLEEKGWLTHREEGRLFLYSAARPRTTSLGASVARMIDHLFAGSPENMLMAMMEYRGLSDDEKERIRALIDNA.. 124
259 1.000e-34UniRef50_A0A0P7XK12 BlaI family transcriptional regulator n=6 Tax=Cyclobacteriaceae TaxID=563798 RepID=A0A0P7XK12_9BACT  ali  16  3.KPTEAELEVLAILWELKEASVRQVHERLAETKETGYTTTLKIMQIMHAKGMVSRDEKSRTHLYRPTVKQGETQKSLLKDLMSSAYGGSSKALVMQALGQDNPSKEELDEIRAFLDQLE. 120
260 1.000e-34UniRef50_UPI00029A287C BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Schlesneria paludicola TaxID=360056 RepID=UPI00029A287C  ali  19  8.QPNDVELAILRVVWKLKSCTVREVHEVLQTERTCGPTTTLKMMQVMCEKGLLKRDDSQRPQQYSPAVPEEQTQQKIVGDLIRKVFGGSVRKLVMHAVQTESMSTDELAEIRKLFDNLK. 125
261 1.000e-34UniRef50_A0A1C6D2R5 Regulatory protein BlaI n=8 Tax=Clostridiales TaxID=186802 RepID=A0A1C6D2R5_9CLOT  ali  26  8..LGKSEWHIMEKLWESAPRTYVQLCHELKENPGWSRSTVQTMLERMTEKGILRYEVVGRAKQYYPNVARDDVAVAETRSLLDRAFEGSASLMMSTLVRKNQLTKEDIDELYAILEQAE. 124
262 1.000e-34UniRef50_A0A1E4BA06 Uncharacterized protein n=2 Tax=unclassified Gemmatimonadetes TaxID=234665 RepID=A0A1E4BA06_9BACT  ali  26  6.HLTDLQLAIVRILWTRGPSTVIEVQESLLPDRPLAQTTVATLLTRLEKRGVVTHGNSGRQYQYRALVTEIEVRRSMVSELTEMLFAGRPAALISHLIGEREIAPGDLDEVKRLIADAEQ 124
263 1.000e-34UniRef50_F7QU10 Penicillinase repressor n=114 Tax=Bacteria TaxID=2 RepID=F7QU10_9LACO  ali  18  5IEISNAEWEIMRVIWTLGETTSRQIIEVLSDKKNWKPATTKTLIGRLVSKGYVGTRREGRAYIYYPVIKEQKTINEQVLTNFENICQMHVGQTLVEVLNNVKLSKNDIKKLEEVLK.... 120
264 2.000e-34UniRef50_A0A0S2DHK8 Penicillinase repressor n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A0S2DHK8_LYSEN  ali  23  2.............LWDRGEASVREVADALSQHKPVAYTTVLTTFNVLAKKGFVTHRQEGRAFVYRAAISREQARRQALDQLLLRFFEGSPNLLAQHLLDQDEVGRDELKALRAKVEAAKQ 108
265 2.000e-34UniRef50_A0A1C6E2K4 Regulatory protein BlaI n=2 Tax=unclassified Clostridiales TaxID=186813 RepID=A0A1C6E2K4_9FIRM  ali  31  2LRLSDSEWAVLEALWHTGPVPLSTLVEELRRRGSWAPNTVHTLLTRLSRKGAVAVHGGARPFRYEAAVDRRSCEGARSADLLSRVFGGSLSGLVSTLMDSGQVSDEELDRLEALLQKRRE 122
266 2.000e-34UniRef50_A0A2A5DJW6 CopY/TcrY family copper transport repressor n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2A5DJW6_9BACT  ali  26  7.QISDAEWEVMNVIWENENCSADTIIDFFEGVKEWNHRTIRTMLGRLTKKNYLTVSKDGRKFLYTSAIDQKDCIKSESKSFLKRVFNGASSSMFLHFVDEFNLTKNEIDD.......... 115
267 2.000e-34UniRef50_A0A2N5FGA4 Penicillinase repressor BlaI n=121 Tax=Bacteria TaxID=2 RepID=A0A2N5FGA4_9BACI  ali  29  8..ITEAEWELMKVLWKESPLTANEICSAIQEYEDWKPKTIRTLLDRLTKKKVVAANKDLRVYTFTPLYSEHECQRAETQSFIERIYGGTTKSLLVQFIEDETLTKEELKELREMLDKK.. 123
268 2.000e-34UniRef50_G0J8H3 Transcriptional repressor, CopY family n=37 Tax=Bacteroidetes TaxID=976 RepID=G0J8H3_CYCMS  ali  29  3.ELTRAEEQIMQILWDIEKGFVKDVLEKMTAPKP-AYNTVSTIIRILERKGFVKHKAYGKSHEYYPIVSKDEYRSFTIKNLLTGYFSGSFANLASFFAKDEKL---DVKALEKIMDEVKD 117
269 2.000e-34UniRef50_A0A2D9QS11 MarR family transcriptional regulator n=5 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2D9QS11_9BACT  ali  19  17.KLHRLDLEIMKVIWELGQATVSEVLDTIN--RKLAYTTVATTMKHLEQKGFLTYTVDGRTFVYQPLIQEAEVSQSMLSDLLERFFDNSVERLVNTLLETEHIDSVELDLLQQLINRHKE 133
270 2.000e-34UniRef50_A0A1Y4TJM9 Uncharacterized protein n=2 Tax=Gemmiger sp. An120 TaxID=1965549 RepID=A0A1Y4TJM9_9FIRM  ali  32  12IKIFDSELLVMEYLWENGPCLAADLAEEFLKRYNWKKSTTYIVLKRLEGKGAISRE--YPKYNVTAIVSRQQVQSAETNTLVDRMFGGSFASLFANFLNSGQLSDKTLDELQALIDEKR. 128
271 2.000e-34UniRef50_N2A5Z8 Uncharacterized protein n=1 Tax=Clostridium sp. ASF502 TaxID=97139 RepID=N2A5Z8_9CLOT  ali  23  1MKFYDSELKVMDLLWKKGELSAKQIADALNQSIGWNKNTSYTVIKKLVDKGAVRRTDPG--FLCTALIGQESARQSALTEFLDKFYQGSVGLLFASLLARENLSPEETAQLRSMIEDKK. 117
272 2.000e-34UniRef50_H1YB24 Transcriptional repressor, CopY family n=16 Tax=Bacteroidetes TaxID=976 RepID=H1YB24_9SPHI  ali  21  6.ELTKAEEQVMRILWQLNEAMVKDVVEQMPHPKP-AYNTVSTVIRVLEGKGFINHKAYSNSYVYFPAIGEEDYKKFAVDKIMTNYFSNSYQSLVSFLVNEQKLDVNQLEELTKLAENLK. 122
273 2.000e-34UniRef50_A0A081BN84 Uncharacterized protein n=2 Tax=Candidatus Moduliflexus flocculans TaxID=1499966 RepID=A0A081BN84_9BACT  ali  21  10.ELSRAEYDILRVLWKGGEQTVREAHDQLQQTYGWAYTTTKTMMDRMVAKGLLRRDTFHGVFVYTPLISRPAGLARFIQFFADRVLETDPSAVVAMFAKSQAISQDEIHELEQLLHQQRQ 128
274 2.000e-34UniRef50_A0A117M9M1 Uncharacterized protein n=1 Tax=Marinimicrobia bacterium 46_43 TaxID=1635280 RepID=A0A117M9M1_9BACT  ali  21  7..MTPLEWEIMKLFWKHGKTSIRKIADKLPESYQRAYTTIQTYVERLVDKGLLQKEKKGKINLYEPVIREQTALHHETESFVKRAFNGSFSRLSGYLIKSGKLSEDEIEELQLMIDHYRE 124
275 2.000e-34UniRef50_A0A1Y4UDI9 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1Y4UDI9_9FIRM  ali  18  8.KISEAEMEIMNIVWKYGGVTSKDIMEAIPE-KQWKITTVLTLMSRLVDKGFLKAEKNGRGKIYNSIISEKEYKKMCSKNFLNEFYEGSAKNFFAALFEDNEISESNLEELKSILERDE. 125
276 2.000e-34UniRef50_A0A1X6PT03 Uncharacterized protein n=12 Tax=Firmicutes TaxID=1239 RepID=A0A1X6PT03_BACMY  ali  34  6.KISEAELEVMKVLWAASPLTANEITQALENKSDWSPKTVRTLINRLSKKEAISHQEKGKVYTYAPLISQEIYLQVETDSFLKRVYGAALKPLLVNFIKEEKLSAEDIHELKNILENKAE 126
277 2.000e-34UniRef50_A0A1H5A6U6 Predicted transcriptional regulator n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1H5A6U6_9FLAO  ali  23  4.QLTKAEEQIMQVLWELNEASVKEVIAELPMPKP-AYNTVSTIIRILETKEFVGHKPKGRGYVYYPIIEKSSYSNQSLHKLMNGYFGGSFKSMVSFFMKENKMDITELENILKEVDKNK. 120
278 2.000e-34UniRef50_Q5FHR8 Similar to the negative regulator of copYZAB operon n=103 Tax=Bacteria TaxID=2 RepID=Q5FHR8_LACAC  ali  23  11..ISDSEWEVMRIIWTLEPVSSTQIIHELQAKKDWSESTIKTLLRRLVQKNLLSTKKEGRHFVYTAKINQTQVMAETAQELLNRMCDMHKGEVLLQLLADSSISKNDLEKMKQKISEKE. 127
279 2.000e-34UniRef50_B5Y639 Penicillinase repressor (Regulatory protein BlaI) (Beta-lactamaserepressor protein) n=8 Tax=Terrabacteria group TaxID=1783272 RepID=B  ali  22  7.RLPDSELEIMKIIWDKEPVTSAYISEKLKGKKDWKITSILTFLARLTEKGFIECKREGKVNIYRPLISEQEYLEKESKSILEKLYNNSLTNFVASLYNSNAIAEDELKELQEFIEEL.. 124
280 2.000e-34UniRef50_A0A2D0NGY1 Transcriptional regulator n=1 Tax=Lewinella nigricans DSM 23189 = NBRC 102662 TaxID=1122177 RepID=A0A2D0NGY1_9BACT  ali  18  10...TEAELEILQVLWEKQPATVKEVHEELRDTREVGYTTILKQMQRMFDKGMLQRTKEGKTHLYTAVAREQEVQRSMFDRLVDTAFRGSAMKMFMHALGQSRINEADLEQLQEWIAQQKE 126
281 2.000e-34UniRef50_A0A142X0X1 Methicillin resistance regulatory protein MecI n=5 Tax=Planctomycetales TaxID=112 RepID=A0A142X0X1_9PLAN  ali  23  8.HPTDLELTILKVLWTSSPRTVEEVRDALAESRELAHSSVITMMNIMVRKGYLDRTKNGRAFEFRPLIAEDEVGRGMVSDLVHRVFDGSATTLMLRLLEAGDVDPDELAEIRRLIQKA.. 125
282 2.000e-34UniRef50_A0A1L8R233 CopY/TcrY family copper transport repressor n=8 Tax=Enterococcus TaxID=1350 RepID=A0A1L8R233_9ENTE  ali  29  6VKISDAEWEVMRVLWTLHAATAHEIAEILADKMDWKLATVKTLLGRLSKKEVIYSELDGKKFIYYPKVSESATVQSATENLFSHICAKKIGATIADLIDDAQLTAQDISAIQKALAAK.. 123
283 2.000e-34UniRef50_A0A2V9KK64 MarR family transcriptional regulator n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9KK64_9BACT  ali  23  10..LTRQELQIMKVVWDRGTATVKEVCEVMSRNKPTAYTTILTLMGILEDKGALTHVRSGRAYVYKPLLSRQQATRNQVRDVVARFFDGRPEKLIENVLDNEVTDPERLLDVKTLLDSRR. 126
284 3.000e-34UniRef50_UPI0002EAF51E BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Zavarzinella formosa TaxID=360055 RepID=UPI0002EAF51E  ali  33  18..MSDAEREVMKLLWDHGPLAVRDVLLRLTEQQEWTRSTVVTLLQRLEKKGYVASDRSGFAFVFRPLVSREEEMHARMASLAGELCDGEALPLVLAFAERHQFSAAELAKFRQMIDQLE. 135
285 3.000e-34UniRef50_A0A1Y4TJH8 Transcriptional regulator n=4 Tax=Clostridia TaxID=186801 RepID=A0A1Y4TJH8_9FIRM  ali  31  4MELTGAEWDVMECLWDASPRTGRELAQEMAARRGWSRSTTLTLLRRLETKGAVTAQEGDGVRRFSPAVRREDAALREAESFLDRVYKGSVSLLVSALTQKQALSRREIDELYAILQQAE. 122
286 3.000e-34UniRef50_A0A2N9NMI5 CopY family transcriptional regulator n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2N9NMI5_9BACT  ali  26  9..LTNAEHRIMEVIWARGSATVADVVEALHGKD--AYTTILTLIRILKAKGYLSSRKEGRAYVFTPRVDRQTVARTAAHQLLSKFFAGSPSELVLSFLRDEELTTEELDQIKEKI..... 119
287 3.000e-34UniRef50_A9GPM4 Transcriptional repressor CopY n=2 Tax=Sorangium cellulosum TaxID=56 RepID=A9GPM4_SORC5  ali  25  6..LTDLQLAVMKALWAVGEGSVGDVVSAMAEDRELAPTTVATLLQRLSQQGWVERKRSGRQFVYRASVDQKEAARGVLHRVLRSFFGGRASALTAQLLESEQLSPEELEEMQRLIKEK.. 122
288 3.000e-34UniRef50_A0A1I0J8C2 BlaI/MecI/CopY family transcriptional regulator n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1I0J8C2_9FIRM  ali  26  6..LSETEWKLMDALWEEPPKTITQLTKALEEDTGWGKNVIITMLKRLEAKGAVRHEEGERAKQFYPAVSREDTALEETRGFLNRVYNGSLGLMVDAMVNSRSLSDREIEELKEILKKAEE 123
289 3.000e-34UniRef50_A0A1H4D7G9 Predicted transcriptional regulator n=1 Tax=Chitinophaga terrae Kim and Jung 2007 TaxID=408074 RepID=A0A1H4D7G9_9BACT  ali  25  6..LTQAEENIMQIMWRLNRATVKEIIDEIPLPKP-AYNTVSTVVRVLEKKKIIGHVSEGNSHIYYPLISEADYMHYSVDKVLRDYFKNSYKNLVSFLVEKQDMSSKDIAELEALIKTLK. 121
290 3.000e-34UniRef50_A0A2V2DQD4 CopY family transcriptional regulator n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2DQD4_9FIRM  ali  24  5.RLPENELLVMQILWSCGDASSDDIVSRFLQQKEWERPAILTLLKRLEKKGFVRCRKDGRRNLYTALVGEKEYLAFESRGFLDRLYGSSVKKLVATLYRSHDISAADLEELRQFLEEEK. 123
291 3.000e-34UniRef50_A0A142Y2F7 Methicillin resistance regulatory protein MecI n=1 Tax=Pirellula sp. SH-Sr6A TaxID=1632865 RepID=A0A142Y2F7_9PLAN  ali  21  19.ELSASQLEIMKIIWERGETTISEVWQELQTRRKVARATVQTVIGRLEEKGWLKHREIGQAFLYSAVSEQSEIQRTLVDNLCNQAFDGSASGLVWTLLDSRGVSKKDLERIRELISKAE. 136
292 3.000e-34UniRef50_A0A2A5DBY7 BlaI family transcriptional regulator n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2A5DBY7_9BACT  ali  18  8..LSESQLEIMNIIWDAKETTVNHVWQTLQTRKIVARNTVQTLMSRLDEKMWLKHKKVGNIFYYSATKPKSNTLKNMADKLLNNAFGGSVDNLMMALFDGGNISTEDSKKIRELIDQFEE 125
293 3.000e-34UniRef50_A0A174J5U0 BlaI family transcriptional regulator n=114 Tax=cellular organisms TaxID=131567 RepID=A0A174J5U0_9FIRM  ali  31  3LKLFDSERKVMEVLWDHGDLSAKELADRLKELVGWSKTTTYTVIKKCIDKKAVSRSEPG--FVCHPLVSREEVREQETDALIDRMYGGSADLLVANLLGSRRLSPEELARLKRRIEELE. 119
294 3.000e-34UniRef50_A0A2D6A1U1 Uncharacterized protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D6A1U1_9BACT  ali  25  8..ISDTELAVLKALWEVGEATVRDLQEHLSAGFNWAYTTVQTLLNRLEQKECVASTKHGRAFRFCVTTTRDDLLHRELGDLAERVCGGAALPLVMSLVEHTRFSKVEIKRLRDLLDDLEQ 126
295 3.000e-34UniRef50_A0A2G3PY94 CopY/TcrY family copper transport repressor n=1 Tax=Lachnospiraceae bacterium TaxID=1898203 RepID=A0A2G3PY94_9FIRM  ali  31  5.KITEAEWKIMRILWNHAPITLKEIIKELKREINWSNTTVRTLVVRLMEKEFIGADKTAANFKYYPLIDKGECQVKEAKNLINTVFEGSMEMLITAFDKKGKLSGKELEELKRIIDKIEE 123
296 3.000e-34UniRef50_A0A0R2L4I4 Transcriptional regulator n=59 Tax=Lactobacillaceae TaxID=33958 RepID=A0A0R2L4I4_9LACO  ali  21  7IEISQSEWETMRVIWTLNGASSKQIIAILAEKLGWKASTTKTYLGRLVKKGALSTTKNGREYVYQPLIEEQVAMNNATSGLFDHLCQHKVGPTLTTLINNVELSQSDIEELINELNQK.. 124
297 3.000e-34UniRef50_A0A1Y3RWR2 Uncharacterized protein n=2 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1Y3RWR2_9FIRM  ali  25  1MRLSEAELEIMEQIWKLGPVTAAELAGPL-QQKGWKPTTLLTFLARMAAKGALEVEKRGKQNVYTACVSSEQYRAAEAQELLTKLYSGSVKSMVAALYDGKALSGDQLDELRDWLE.... 116
298 3.000e-34UniRef50_UPI00031D3633 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Zavarzinella formosa TaxID=360055 RepID=UPI00031D3633  ali  26  7..ISETERAVLKALWDHGPGTVRELHTVLLDQATWAYTTVQTLLTRLAGKGYVECGRSTPAHVYKAAVTLNELLQQQLTDLAATYCEGTSSPLMLALVEGGKFSPEEIAQFRELLDKLD. 124
299 3.000e-34UniRef50_A0A1E4LDQ1 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1E4LDQ1_9BACT  ali  26  3ISLGSVQLKIMRVLWSEGKASARQITETLSEEKPIAHSTVQTLLRQLEGKRAVTHEREDRTFVFRPLIKESEVTKSVAQDLLSRVFQGSISGLVAHLLESEEVTPEEMERLQKLVREKSQ 122
300 3.000e-34UniRef50_A0A2E2W6M6 Transcriptional regulator n=9 Tax=root TaxID=1 RepID=A0A2E2W6M6_9FLAO  ali  23  4..LTNKEEEIMQTLWKLEKAFIKEVVAAMPG--NHHYNTVSTIVRNLEEKGYVSHQAFGKTHQYFPVVSKAAYTKKFMSQATKRYFDNSYKSMVSFFAKEEKISAEELREILNIIEKK.. 117
301 3.000e-34UniRef50_Q47839 Transcriptional repressor CopY n=166 Tax=Firmicutes TaxID=1239 RepID=COPY_ENTHA  ali  23  8IKISDSEWEVMRVIWTLGQANAQQITQILADSMDWKVATVKTLLGRLVKKEALWTEQEGKKFIYHPAVSEMENVRSATENLFSHICAKRVGATIADLVEEATLTQEDIQQIMKQLNKKE. 126
302 4.000e-34UniRef50_A0A1U7CKM8 Transcriptional regulator BlaI n=1 Tax=Paludisphaera borealis TaxID=1387353 RepID=A0A1U7CKM8_9BACT  ali  29  7..LSDAEREVLRVLWDQGPGTVREIKDALTERRGWAYTTVSTLLQRLATKQYAAADSSVMPHIYRATVSRDELLERRLKDAAHELCDGQAAPLMLALVQGNRFSADELARFRRLLDEA.. 123
303 4.000e-34UniRef50_A0A174W2B4 Transcriptional regulator n=67 Tax=Bacteria TaxID=2 RepID=A0A174W2B4_9BACE  ali  20  3.KLTIQEEEVMIYVWELQSCFVKDIVAKYPQPAP-PYTTVASIVKNLERKGYVTSKRVGNTYQYTPAIRENEYKRHFMSSVVRNYFENSYKEMVSFFAKDQKLSTDDLKDIIELIEKGKD 120
304 4.000e-34UniRef50_A0A1H4EB76 Predicted transcriptional regulator n=47 Tax=Bacteroidetes TaxID=976 RepID=A0A1H4EB76_9BACT  ali  19  3.KLSRKEEELMQVMWYLKKAFVKDAIDQLPDPKPH-YNTIATLMKRLEEKGFLAHREYGGTFEYYPIVEKEKYKDTFMKKVVSTFFDNSYFNMLAYFAKEEKLNQEEIEELMKIIEKNK. 119
305 5.000e-34UniRef50_UPI0008D9B1E7 BlaI/MecI/CopY family transcriptional regulator n=2 Tax=Rikenellaceae TaxID=171550 RepID=UPI0008D9B1E7  ali  23  9.EMTRAELEVMQHIWRLREAFLGEIVDSFTEPRP-AYTTISTVIRTLETKGFVKHHVVGKSHRYYPAISKEEYRGRFMQRVVSKLFDNSPGQVLSYLAESGSLTVEQYEELRRVARQIVE 126
306 5.000e-34UniRef50_A0A081PKT5 CopY family transcriptional repressor n=6 Tax=Bacteroidetes TaxID=976 RepID=A0A081PKT5_9SPHI  ali  25  8VQLTKAEEQIMQALWTLKQATVQDILEVLEAPKP-ARTTVSTVLTILENKGFVSHTTAGRVNTYLPLIKKEQYSRSMLSGFLHNYFNGSFATMASFFAKDNNYS................ 110
307 5.000e-34UniRef50_UPI0006B69874 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Clostridiales bacterium mt11 TaxID=1686289 RepID=UPI0006B69874  ali  30  6.RISESELEIMQILWDNNPMTAPEIRKILQKQKDWKKSTVLTLIKRLTNKGVITCEKKE-LFYYTPLVTEQEYVDYQTQNLVDKLYNGNLKNYVLSLCDNNKLNENDLKELRDY...... 118
308 5.000e-34UniRef50_A0A1C6H5Q8 Regulatory protein BlaI n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1C6H5Q8_9FIRM  ali  25  6..LSDSEHEIMKYIWKHEEVTLREVVAWLENRYTWKQQTVYTLLNRLIDKGAITAIKKGNYRLYYPAITEDELIGQWTENLVENEYQGSLKNFLLAFTRKKSLTRTEADELRKILDEKEE 124
309 5.000e-34UniRef50_C1A6I2 BlaI family transcriptional regulator n=1 Tax=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) TaxID=37906  ali  22  8...TALQLAILRVLWERGEATVVEIWEALHEERGLAQTTLATMLSRLEKRGAVSHRTSARQFVYRAVVSEDAARHSMVSELTTRLFEGDVPSLVSHLLTAQDISPGDRERIRAMLDAA.. 122
310 5.000e-34UniRef50_A0A1F8VAA8 BlaI family transcriptional regulator n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1F8VAA8_9FIRM  ali  25  4IKVFDSELKVMEIIWANEPVTAKQVAAVAGEQIGWNKNTTYTIIKKLIYKNAVVRTE--PNFVCTTTVSKSEVVKTETKSLIDKLFGGSKKAFFAALLDDKKLTKEEIDELREMIDKH.. 119
311 5.000e-34UniRef50_A0LXH3 BlaI-like antibiotic resistance-related regulatory protein n=27 Tax=Bacteroidetes TaxID=976 RepID=A0LXH3_GRAFK  ali  20  3.QLTKAEEEIMQILWDLKEANVASIIEEMSEPKP-AYNTASTIVRILENKEFVGHRQEGRGYIYFPLVQKETYSNQSMTQLMDNYFNGSFKSMVSFFMKKNDMSSQDLESILKEINKEE. 119
312 5.000e-34UniRef50_C5NVC1 Copper transport repressor, CopY/TcrY family n=7 Tax=Bacilli TaxID=91061 RepID=C5NVC1_9BACL  ali  20  3INISEAEWEVMRVVWSNKETTSKFVIDTLGEEKSWTPSTIKTLLSRLVEKGFLETRKQGNKFLYSANCVEDECLDILTQNFLERICERRTHVIVKNIIETDNLSKSNIDEIIELLKEKR. 121
313 5.000e-34UniRef50_A0A174SRA9 Regulatory protein BlaI n=103 Tax=root TaxID=1 RepID=A0A174SRA9_9FIRM  ali  28  22.ELTRAELEIMQILWDEKNAFVNDILERMPEPKP-AYNTVSTIVRILEKKGAVGHEVLGKSHRYYPLFGREAYTQNLMQGVVRNFFGNSFARMVSFFCEKEHLPADESEKILQIAQEA.. 137
314 6.000e-34UniRef50_A0A0R1SBV3 Copper-responsive repressor CopY n=6 Tax=Lactobacillus TaxID=1578 RepID=A0A0R1SBV3_9LACO  ali  22  7IKITSAEWRVMRVIWTLESATSRELTDILGESMDWKSATIKTLLRRLVDKNMLQTQKDGNKFIYKATMAETDAIEVTSKQFFEQVCARKVGTAIASLISESELTQEDIDKIQQQLDDK.. 124
315 6.000e-34UniRef50_W7D022 CopY family transcriptional regulator n=9 Tax=Firmicutes TaxID=1239 RepID=W7D022_9LIST  ali  25  3.RLPDAEFEIMKAVWKSPPVSTNEIIAVLDGDKHWKPQTVLTLLVRLIERDFLESEKVGRERVYTPIVTEEMYLQSETEQFMDKHYNNSLVGLVNTLYKGGDMSDDDIDELKDWLSKR.. 120
316 6.000e-34UniRef50_A0A1I5FK05 Predicted transcriptional regulator n=4 Tax=Firmicutes TaxID=1239 RepID=A0A1I5FK05_9FIRM  ali  21  7.KLPDAEFDIMKVVWANPPITTNIIMQELGNEREWRAQTVISLMLRLVERGFLRTEKNGKERTYFPLISKEDYLKFETGDFIERYHGNSFTSLVATLYDGNKLKDSDLDQLAKWLREKRD 126
317 6.000e-34UniRef50_E8V3A5 Transcriptional repressor, CopY family n=40 Tax=Bacteria TaxID=2 RepID=E8V3A5_TERSS  ali  23  9..LTEAELRLMRLLWRCGECFVQDLVSAMPAEGRLAYNSVLTTIRILETKGYVEHRQEGRAFLYTAVVAEEDAQQSEVRNVISRFFGDSRERLMLALLGGGDVSLDELQALKR....... 119
318 6.000e-34UniRef50_UPI00029A11BD BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Schlesneria paludicola TaxID=360056 RepID=UPI00029A11BD  ali  16  5.RLADLQLAIMHILWDKGEATVSDVQKALAPGRPLAYTTVGTMLSKMEANGQVSHRVDRRINVYRAVLQQENVSRSMISDLAQRLCAGDVTKLVCHLLDECDVSREELSVLKKLIRQKEQ 123
319 6.000e-34UniRef50_A0A285MSK1 Predicted transcriptional regulator n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A285MSK1_9FLAO  ali  25  3.KLTNKEEEVMKILWKLKKAFVKEIKAELKGDKPH-YNTLSTIVRNLEEKKYVGHEAFGNTHRYHPLVTKEAYRKKFINSTIADFYDNSYKNLVSFFAKEEKISVEELKEIIDLIESKK. 119
320 6.000e-34UniRef50_A6CCS2 Penicillinase repressor n=3 Tax=Planctomycetaceae TaxID=126 RepID=A6CCS2_9PLAN  ali  31  7LQITDAEWEVMLSVWEAEDQTAGEIIARTETLRDRSHRTIRTLLARLVEKGAVDVHVEGSRHLYRAAVTRNECVRSAAHSFSERFFAGNLQSLLMHFVENETLSSEELAELKQTLDE... 123
321 7.000e-34UniRef50_A0A085WL13 Transcriptional repressor, BlaI/MecI family protein n=6 Tax=Bacteria TaxID=2 RepID=A0A085WL13_9DELT  ali  20  15.RPTDSELAILRVLWSRGASTVREVHEALQDGSG--YTTILKLMQIMTEKGLVVRDESQRAHVYTTRLPQEKTQRQLVTDLVDRAFGGSPAQLAMQALSTKKTSPEELAELRRLLDSLE. 130
322 7.000e-34UniRef50_A0A1F6D3T7 Uncharacterized protein n=1 Tax=Handelsmanbacteria sp. (strain RIFCSPLOWO2_12_FULL_64_10) TaxID=1817868 RepID=A0A1F6D3T7_HANXR :_  ali  24  6.KLAASEREIMEGVWRNGEITVRNVHDQLYPNGEKAYTTVQTVMNILMEKGFLTRKKIGMVNFYTPTVSREEMAQQETHTLVSRAFGGSFVALANYLVDSGSLSEKELTVLKDMIDAKE. 129
323 7.000e-34UniRef50_A0A174SNK2 Regulatory protein BlaI n=10 Tax=Bacteria TaxID=2 RepID=A0A174SNK2_9FIRM  ali  22  3.HLTNREEEIMEQFWDRGPLFINDILKALGDLK-LHYNTVSTVVRGLEDKGFVDHEQFGNTYRYFPVISREDFSRMSLQNIVGKYFNHSYASVLSMFVEEEKISAEEIRELIAQVEAHSQ 120
324 7.000e-34UniRef50_K1KZP3 Copper transport repressor, CopY/TcrY family n=35 Tax=Bacteria TaxID=2 RepID=K1KZP3_9BACT  ali  24  3.ELTRAEEQIMQILWDIEKGFVKDILEKMSEPKP-AYNTVSTIVRILERKGFVSHKAYGKSHEYFPIVSKDEYRSFSIKKLLSGYFNDSFSRLASFFAKDKDL---DVKEIEKILNEVKE 117
325 7.000e-34UniRef50_A0A1X7MTH1 Copper transport repressor, CopY/TcrY family n=1 Tax=Carnobacterium iners TaxID=1073423 RepID=A0A1X7MTH1_9LACT  ali  25  7IKITEAEWEIMRVAWASGTVTSREIIKVLENKKQWKATTIKTLIGRLVDKKALMTKKEGNKFIYSALVTEENSMEFYTDDVLTRVCTKHRGQLISNMIVDTILSKSDIEMLRTLLEQKE. 125
326 7.000e-34UniRef50_A0A1M5N8P5 Predicted transcriptional regulator n=6 Tax=Bacteroidetes TaxID=976 RepID=A0A1M5N8P5_9FLAO  ali  22  3.KLTNKEEEIMQILWKLEKAFVKEVLAEITEEQPH-YNTLSTIIRNLEEKGFVSHNAFGNTHQYFPIVKMEDYRKRFMNTAIDTYFNSSYKNMVSFFAKEEKISAEELREILAMIENK.. 118
327 7.000e-34UniRef50_A0A0P0G1R2 Methicillin resistance regulatory protein MecI n=47 Tax=Bacteroidetes TaxID=976 RepID=A0A0P0G1R2_9BACE  ali  21  3.RLTAKEEEIMQMFWEHGPMFVRELLAFYEEPKPH-YNTVSTLVRGLEEKGFVKYKAYGNTYQYYAAVSDKEYKRSALNDVVAQYYNNSYTNVVSTFIEEEGMSVDELKALIAEIESKK. 119
328 7.000e-34UniRef50_A0A2V2S6J0 CopY/TcrY family copper transport repressor n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V2S6J0_9BACT  ali  30  5VRISSAEWEVMAVAWERAPVPASTVADVLERKKHWSLATVRTLLRRLVNKGALAQQSDGRRHLYKPLVSLEDCVRRESEWFLDRVVGRAPFATILHLVRNAPLSTEDIQELRRILREKE. 123
329 8.000e-34UniRef50_A0A1V6JYQ6 Penicillinase repressor n=6 Tax=Verrucomicrobia TaxID=74201 RepID=A0A1V6JYQ6_9BACT  ali  32  6.RISETEWEIMRVIWATHPITAAEIIAKLEEDATWHPKTARTLLARLVRKKVLDCERKGRAYVYAPRVSERECVGMASESFLDRVFGGSLVPMLAHFVEERRLTRKD............. 112
330 8.000e-34UniRef50_UPI000B35D92A BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Intestinibacillus massiliensis TaxID=1871029 RepID=UPI000B35D92A  ali  25  7.RISDTELEILNLLWHSDEASSTEVFERL--DTGWKYPTVTTLLGRLVEKGAVRYEKRGKAYYYSPAIDEAAYKASETARFISRMHGGSVRSMIAALCDSRGLTEQDAEALRRIFD.... 120
331 8.000e-34UniRef50_A0A1M3EBK6 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 43-16 TaxID=1895923 RepID=A0A1M3EBK6_9BACT  ali  22  2VQLTKVEEEIMQIIWDKGKCLVSDIIAAL-ENPDTPHSTISSVVRILEKKGFVAHKAYGRTYEYFPTISKEAYAQKGFKSWFASYFDSSPAQLASFFVKEKALKPKEIDELLKQLEQLK. 119
332 8.000e-34UniRef50_Q07X52 Transcriptional repressor, CopY family protein n=35 Tax=Proteobacteria TaxID=1224 RepID=Q07X52_SHEFN  ali  38  3.EISNSELVVLQQLWLQSPLTSSEVVDALEQSHDMHEKTVKTLLNRLVKKQAVSFEKQGRVYHYSPLIAQQDYTVKESLSFVDRMFAGKLTPLVAGFAQKNKLSAEDVAELQTLLDD... 118
333 8.000e-34UniRef50_A4XIM3 Transcriptional repressor, CopY family n=2 Tax=Caldicellulosiruptor TaxID=44000 RepID=A4XIM3_CALS8  ali  29  8.KISKAELEVMKVVWKENRVSGREIVKVMETNKKWHKNTIFTLIDRLAKKGVLKVEKKGKFNFYTASITEEDYKKEEARDILQRMFGGSFRNVIATFLETTNVSKKEIEEIKKMLDEK.. 126
334 8.000e-34UniRef50_G8X5F1 CopY family transcriptional regulator n=53 Tax=Bacteria TaxID=2 RepID=G8X5F1_FLACA  ali  21  3.KLTNKEEEIMQILWKLENAFVKDVMAEIKNETPH-YNTLSTIIRNLEDKGYVGHTIFGNTHQYYPIVPIKEYRKKFFNTTIETYFNNSYKNLVSFFAEEKKISAAELREILELIENKK. 119
335 9.000e-34UniRef50_A0A059WPI7 Penicillinase repressor n=1 Tax=uncultured bacterium TaxID=77133 RepID=A0A059WPI7_9BACT  ali  23  8.QLTDLELELMQLVWRLGECTIRDVYEALPQGRDLAYTTVATMIKILEQKGAVTCQKKDRAITVKPRIERSQYESASLRHLNERVFQGDATTMVTRLLDESELTVEELKSLRKLLDER.. 124
336 9.000e-34UniRef50_A0A2A2RQE2 MarR family transcriptional regulator n=1 Tax=Pedosphaera sp. Tous-C6FEB TaxID=1982324 RepID=A0A2A2RQE2_9BACT  ali  20  8.RLGELQLRILEVLWQQDEAPVSAVHEALGGSAEFAYTTIATMLRKMEDRRLVRHRTEGRSFLYRAAVKADEVTRNVADHLVDRFFAGSLAEAVSHLLDTRDATKAELAELEQLIAARK. 125
337 9.000e-34UniRef50_A0A143PGF6 Regulatory protein BlaI n=11 Tax=Bacteria TaxID=2 RepID=A0A143PGF6_9BACT  ali  23  5..LSRRERQIMDVLYRHGRATAAEVLAALPGSP--TDSTVRTQLRILEAKGHVVHETHGNRYVYAPTVPRHSARRSALRHLVETFFDGSRAKVVAALLGTGQLTPDELERIESLVRRARE 122
338 9.000e-34UniRef50_A0A1C5Z055 Regulatory protein BlaI n=4 Tax=Firmicutes TaxID=1239 RepID=A0A1C5Z055_9CLOT  ali  31  5ISISESEWQVMKIIWNDPPQTLQEILEKL-KHTDWSKTTIQTYIARLVKKGALSTKRQGKGYLYYPAISESECQLAESQNFLRRVYDGSLSSMVSGFVKS.................... 103
339 9.000e-34UniRef50_A0A1F3VDC8 Uncharacterized protein n=1 Tax=Bdellovibrionales bacterium RIFOXYC1_FULL_37_79 TaxID=1797395 RepID=A0A1F3VDC8_9PROT  ali  18  11..LTEVELQLMNVIWSLGSCTIKEVQNEINKHRELAYTSVATIMKILETKGILTSIKNDKAHIYSPQITKEVYEAQSLDHLAENLFGGDPSMMVMRLINDANISKKDLEVIRKVLD.... 124
340 9.000e-34UniRef50_A0A1F3L327 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWF2_35_48 TaxID=1797343 RepID=A0A1F3L327_9BACT  ali  25  3.ELTRAEEQIMQILWSLKKAFVKDILDEISEPRP-AYNTVSTIVRTLEKKGFVKFKSYGNSHQYYPAIEKDEYTKYFMKRVINNYFDNSIHQLVSFFTKDRSLDLKEVDEAIGLMQEMK. 119
341 9.000e-34UniRef50_B9Y788 Transcriptional regulator, BlaI/MecI/CopY family n=3 Tax=Holdemania TaxID=61170 RepID=B9Y788_9FIRM  ali  33  17.KITDAELEVLKVLWLREPLTANQIVEEVSKQKDWNAKTIRTLIHRCEEKQAVTADRGSREILYSPAISRRDYTRQTQKSLADKLFNGSMSRMMLNFMEEVQLNEDELEELKEMIRNAE. 134
342 9.000e-34UniRef50_A0A2K4ZJ23 Penicillinase repressor n=1 Tax=Acetatifactor muris TaxID=879566 RepID=A0A2K4ZJ23_9FIRM  ali  30  4..LSEAEWNIMESLWEESPKVGSRIVADMGGRIGWSRSTTLTMLKRMTEKGLIFCEDNGQMKAYTPLIEREDAVKRETESFLQRVYHGSISMLVSGFVERKRLSPEELSELRQILDKAEE 121
343 1.000e-33UniRef50_X1GS65 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1GS65_9ZZZZ  ali  25  1MKLSAAEWEIIHAVWQAEPITVRQVLDQTYPRGEKAYTTVQTLMNILVEKGFLSRRKQGRLNYYTAAIHREEVLRGSLANIAQRMFQGSWGAMASFLVHSVPLTPEELAELKKTLDE... 123
344 1.000e-33UniRef50_A0A1U7CQC0 Penicillinase repressor n=2 Tax=Paludisphaera borealis TaxID=1387353 RepID=A0A1U7CQC0_9BACT  ali  17  9..LGELQKAVMESVWELGEGTVQQVRDRLDREPQPAYTTVLSVMQKLEKAGWLSHRPEGRSYVYLPTRSRDEAGSSTLRTFIDRAFRGDPMLLFQRLLDDKQLSEHDLSEIKRMIDQKR. 125
345 1.000e-33UniRef50_A0A0Q5NCS1 Transcriptional regulator n=28 Tax=Bacteria TaxID=2 RepID=A0A0Q5NCS1_9SPHI  ali  17  4.ELTKAEEQIMLILWEMKEGLVKDVIEKMNEPKP-AYNTVSTVIRVLESKGFVDHKAVGNTYIYFPIVKEADYKRFALDKVMNNYFENSYESLVSFLVKEKSMSNEKLNELIQLAEKLK. 120
346 1.000e-33UniRef50_A0A069RFD6 Penicillinase repressor n=1 Tax=Peptoclostridium litorale DSM 5388 TaxID=1121324 RepID=A0A069RFD6_PEPLI  ali  29  6.KISDAEYEIMKVIWENEPLTAADIVSIV-DSESWNENTIRTMVNRLLKKAAIGYKKNGKAYIYHSLISSGEYKKFEGMSFLKKIYGGSISAMFANLVNGEEISKDELNDLKELLEK... 120
347 1.000e-33UniRef50_A0A1Q6FI57 Transcriptional regulator n=1 Tax=Bacteroidales bacterium 43_36 TaxID=1897038 RepID=A0A1Q6FI57_9BACT  ali  23  6.KLTEKEEEVMTFFWQKGKLAVRDVVALYPEPQPH-FNTVSTYVHILEKKGYLTREKTGNSLAYSPAIGIEEYRKSTMKGVIRRFFDNSYMKIVSSFVKEENISVDDLKELIKIVEQNKD 123
348 1.000e-33UniRef50_A0A1G0YU30 Transcriptional regulator n=5 Tax=Bacteria TaxID=2 RepID=A0A1G0YU30_9BACT  ali  41  6.KISEAEWEVMTVLWKRQPMAAHEIIKELPAKK-WHPKTVKTLIARLVKKGAVSFKNEGRTYLYRPMIKEKDCVIDESQSFLNRLFGGALAPMVAQFVENKKLS................ 107
349 1.000e-33UniRef50_A0A1Z8L3S9 Uncharacterized protein n=7 Tax=PVC group TaxID=1783257 RepID=A0A1Z8L3S9_9BACT  ali  24  14.RPTESECNILSIIWDRGTATVREVYEDLSQRQEVGYTTVLKFMQIMTEKGLLERDVSVRPQVFRPARDKADVQRDMVGDLLDRVFGGSPESLVLGALSSRPSTPGEIAKIRQFLDEME. 131
350 1.000e-33UniRef50_A0A150XF75 Transcriptional regulator n=3 Tax=Flammeovirgaceae TaxID=200667 RepID=A0A150XF75_9BACT  ali  22  3.ELTKAEERVMQIVWDLEKAFTREVLEQFKKEKP-SYTTVATVLTVLEQKGFVAHKMLGNSKQYYPLISKSKYSDFAMSNVMGKYFEGSLTRLVSFFADRKKIDINELDEIIKILESKKE 120
351 1.000e-33UniRef50_A0A2V2G7C4 CopY/TcrY family copper transport repressor n=1 Tax=Clostridiales Family XIII bacterium TaxID=2137877 RepID=A0A2V2G7C4_9FIRM  ali  27  6..ISNSEWKIMKILWQTPKLTLRQIYEKTGAAEGWSYTTVRTLVTRLVEKEAVAADKSGANFKYYPLLSENECKNSEVKNFIDKVFDGKKSTLMVSLTKDSKLTEEETKTLMSLIEKID. 122
352 1.000e-33UniRef50_A0A1H3XGV8 Predicted transcriptional regulator n=9 Tax=Prevotellaceae TaxID=171552 RepID=A0A1H3XGV8_PRERU  ali  26  7.QLTKAETQVMNILWSLPEGFIQDIIDRYPEPKP-AYTTILTFMKILTDKGFVKPERVGKANRFSPLVSKDDYTYSFISDVKDTFFDGSFTSLVSFFAKKEQYTDEELAELKELMTKIE. 125
353 1.000e-33UniRef50_Q9A854 Transcriptional regulator, BlaI family, putative n=13 Tax=Caulobacter TaxID=75 RepID=Q9A854_CAUVC  ali  100  1MHITAAEAHVMEALWRRSPLSADELVAEVGAAQSWGEATVKTLINRLLKKKAIKSERAEGKHGYRPLVDRSAYVQAESQGLLDRLFDGQLAPLISHFAQHRPLKPDEVAKLKKLIDEMGE 120
354 1.000e-33UniRef50_A0A2V8IRN9 Transcriptional regulator n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8IRN9_9BACT  ali  21  6..PTDAELEILRIIWTRGPSTVREVHERISDMKTVGYTTVLKQMQVMHGKGLLARSDRFRSHVYEPVQSRTQTQRQLAASMLRQVFDGSARQLLQSALAGRKVDPRELKQIRELLDNYE. 122
355 1.000e-33UniRef50_A0A132GW94 Putative transcriptional regulator n=1 Tax=bacterium P201 TaxID=1768112 RepID=A0A132GW94_9BACT  ali  27  1..........MQVIWSIGQGFANEIMAAFPEPKP-AYNTVLTVIKILENKGFVKHETFCRANRYSAAISKEEYSQRYLGSVVERYFNNSYLDLVSAFAKKENFSLEELEALKKVIDEA.. 107
356 1.000e-33UniRef50_F2IAD5 Transcriptional repressor, CopY family n=6 Tax=Bacteroidetes TaxID=976 RepID=F2IAD5_FLUTR  ali  23  4.ELTRAEEQIMQAIWSVGKGFAKDIHEQLEEPRP-AYNTVLTVIRVLVQKGFVEYKTYGKSNEYSPMITKEAYSAQRFQSLKENYFGNSNAKLLSFFLKENNLDLKDVNELLEIIKKER. 120
357 1.000e-33UniRef50_A0A2E7D5I0 Uncharacterized protein n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E7D5I0_9PLAN  ali  24  12..ISDSERDVMKVLWEHGPIAVRELREHLEQSRKWAHTTVNTLLSRLEQKGCVSCDRTGFAHLFTAAVSRDQLVKQRLTTIANDYCNGTRVPLMLALVDGQSFSETEIQQFRDLLDELE. 129
358 1.000e-33UniRef50_C1F3S0 MarR family transcriptional regulatory protein n=9 Tax=Acidobacteriales TaxID=204433 RepID=C1F3S0_ACIC5  ali  21  9..LTRLELQIMQVIWKLGSANVTAVQAAL--EHPLAYTTVQTMLNILHRKGKLRRKLEGRSYVYRAAVSESKATGHAVRDLIDRVFGGSTEALVMSLIKNRQIDADKLAELTRKLEAGK. 123
359 1.000e-33UniRef50_A4CGH6 Putative antibiotic resistance-related regulatory protein n=424 Tax=root TaxID=1 RepID=A4CGH6_ROBBH  ali  25  1MKLSRTEEALMNLLWEQKQAFLKDLVDAYPDPKP-APTTVATLLKRMAEKGYVAYRTHGRSREYYPTVSKKAYFAGHFNKLIANFFNDSTAQFASFFTREADLSREQLEELKSLIEE... 116
360 1.000e-33UniRef50_R5AF54 Putative BlaI family transcriptional regulator n=1 Tax=Firmicutes bacterium CAG:102 TaxID=1262998 RepID=R5AF54_9FIRM  ali  27  4.KISDSEWKVMEILWEKGAATQSEVMDALTE--GWNKNTVYTFLSRLEHKGLVAAE--GSPKRYAAVIGREECVRQEEESFLNKVYHGSAGKLVAAFVEEGRLTEKEKAMLKQLLE.... 114
361 1.000e-33UniRef50_A0A0E4GBX4 BlaI transcriptional regulatory family n=2 Tax=Syntrophomonas TaxID=862 RepID=A0A0E4GBX4_9FIRM  ali  29  9.EITDAEFEIMKVLWAKEPLSVQDICDELLH-KNWKYSTVATLLGRMKKKGIVEGVKSGYAYYYTPLTDEKEYKKSQTRKLISKLYDGSAKKLIASLYSDNEMSAEDIAELKNYFD.... 123
362 2.000e-33UniRef50_A0A1N6N9N7 Predicted transcriptional regulator n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A1N6N9N7_9SPHI  ali  21  3.RLSEKEEAIMQSVWKLKKAFVKEVRDGLPDPKPH-INTVATMMRRLADKGFLKFEDFGSTYRYAAIISKMEYTRKFVRPLLAGLFGNSMKNVVSFFAEEDEVSLDELKEIIKMIEDK.. 118
363 2.000e-33UniRef50_F3ZX54 Transcriptional repressor, CopY family n=1 Tax=Mahella australiensis (strain DSM 15567 / CIP 107919 / 50-1 BON) TaxID=697281 RepID=F3  ali  25  7.QISESEWQVMKVLWQNPGLTAAQVSDEVSKENDWSSGTTRTYLRRLVAKEALRFERDSRIYYYYPIISETEAIEHESKSLLGRIVKGKAGIVLASLIKDSDLTPEDINELESILNQRRD 128
364 2.000e-33UniRef50_A0A199XVU6 Methicillin resistance regulatory protein MecI n=497 Tax=root TaxID=1 RepID=A0A199XVU6_9FLAO  ali  20  3.KLTNKEEEIMHILWKLKKAFVKEILAEITEEQPH-YNTLSTIVRNLEEKGYVSHTAFGNTHQYFPVVKIEDYRKKFMSNAIETFFGSSYKNMVSQFAKEEKISAEELREILAMIEQK.. 118
365 2.000e-33UniRef50_H3NGG1 CopY/TcrY family copper transport repressor n=12 Tax=Dolosigranulum pigrum TaxID=29394 RepID=H3NGG1_9LACT  ali  22  4VDITASEWEVMRVVWAKEQTTSATIIKVLSQEMNWKDSTIKTLIGRLKDKGLLDAERDGRGFVYRPTVSQQDMILKSGEQWLDRICSTKVGGVLAELIKTSELSQDDLDQIIQVAQAKK. 122
366 2.000e-33UniRef50_G8LUX0 Putative transcriptional regulator n=2 Tax=[Clostridium] clariflavum TaxID=288965 RepID=G8LUX0_CLOCD  ali  27  8..ISDSEWLVMKVIWEKKEAKSSEIAAKLSDSTKWSDKTIITLLNRLVNKGILATKKDKRAYVYYPLVTEQECIEAETDSFLKKCFNGAVKDLLLNVIDKRRLTKSDIEELKSILDTMEE 128
367 2.000e-33UniRef50_C1A740 BlaI family transcriptional regulator n=8 Tax=root TaxID=1 RepID=C1A740_GEMAT  ali  24  6..LGARELDVMTLLWQHGSGTATEIRERLEA--DLAYTTVLTILRNLEAKGLLRHEPEGRAHRYFPRVEQRIAQQSALQRVLGSFFGGSAESLLARLVDDQHVDAAELQAIARRITEGQD 121
368 2.000e-33UniRef50_A0A0N1ID14 Methicillin resistance regulatory protein MecI n=22 Tax=Clostridiales TaxID=186802 RepID=A0A0N1ID14_CLODI  ali  28  3IKLFDSELKVMEVLWEIGESKAGELVKILKEETGWNRNTTYTVIKKLVAKGAI--ERIEPNFVCKALISKEEVQKQETETLINKMFGGSSEKFLSAFINKENLSSDDITKLKQIVEKLK. 119
369 2.000e-33UniRef50_A0A1M6M2W9 Predicted transcriptional regulator n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1M6M2W9_9CLOT  ali  22  3.KLPDSELELMMIIWSQGPVTRMDIEAKLDKSRDILPNTVLSFLSRLEDKGFIKKEKQGKINYYSPLVDEDKYLQEEGKSIFKKMFGNSLSRFVTSLYDGNAIGEEDLTELRNMLDEMDD 122
370 2.000e-33UniRef50_A0A1T5P7F9 Predicted transcriptional regulator n=2 Tax=Chitinophaga TaxID=79328 RepID=A0A1T5P7F9_9BACT  ali  18  3.KLSRKEEELMQVMWDLEKAFVKDAIEQLPDPKPH-YNTIATLMKRLEEKGYLAHHEYGGSFEYYPTIAKESYKDTFMKKVLNTFFDNSYLNMLAYFAKEEKISAEEMKTLVKMIEKDK. 119
371 2.000e-33UniRef50_W7D6A3 CopY family transcriptional regulator n=1 Tax=Listeria riparia FSL S10-1204 TaxID=1265816 RepID=W7D6A3_9LIST  ali  24  3.RLPDAEFEIMKAVWKQPPVSTNEIIAMLDSDKHWKPQTVLTLLVRLIERDFLTSEKVGRERTYTPLITEEMYLQSETEQFLGKHYNNSLVGLVNTLYKGGDISDEDIDDLKDWLSKRE. 121
372 2.000e-33UniRef50_A0A0V8TBH3 Uncharacterized protein n=3 Tax=Cellulomonas TaxID=1707 RepID=A0A0V8TBH3_9CELL  ali  28  3.RLPDAELDVMDVLWSSEPLTTRAVVESVPSDRGWKIQTVATLLTRLQGKGFVRSTRTGRDLQYVAQVGREEYLAFETGRFMERFHRGSLRSLLASFTADGPVDEAERRDLEAWLDARE. 121
373 2.000e-33UniRef50_A0A1I0RE52 Predicted transcriptional regulator n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1I0RE52_9FIRM  ali  18  3.RLPDSELELMMIIWRAEPVTRTEIEEGLNDERKLSPTAILSFLSRLEEKGFLKIKKQGKSNIYTPIIKEQDYTRKESKSILQKMYHNSVKSFMTALYDGDNLSEDDIKELQNFIDEKR. 121
374 2.000e-33UniRef50_A0A1F2TR84 Uncharacterized protein n=1 Tax=Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 TaxID=1797191 RepID=A0A1F2TR84_9BACT  ali  26  8.HLGDLQIAVMQILWERQRATLGEIRSALRRARPIATTTVATVLSRLEQSGFVEHREGERSRIYVPRIRHEDFQRSQAQGLVDRLFGGRASELVAHLVRESEIDDEELAHLRRLIRKRE. 125
375 2.000e-33UniRef50_F2CFZ3 Transcriptional repressor CopY n=83 Tax=Streptococcus TaxID=1301 RepID=F2CFZ3_STRSA  ali  21  1MKISNAEWRIMKIIWMEGKQTSTDLIAVLSERFDWSKSTVKTLLTRLVEKGCLTREKSGKAFVYSALLKQDQSLDLVVEEVKDKVCSKRIVQVLENLIQESDFTLADLNQLQRVLDEKK. 119
376 2.000e-33UniRef50_A0A0K1PNJ0 Transcriptional repressor, BlaI/MecI family n=1 Tax=Labilithrix luteola TaxID=1391654 RepID=A0A0K1PNJ0_9DELT  ali  26  13..IHDTEWDLLEVLWSKERATAREVAEALAEKRAWAVSTVKTLLDRMVQKDLVSARQVGNVWEYTPAVRAVDAQRSAWAELVDKAFGGSVAPALHFLAKDAQLSKKELAELRALLDAKD. 129
377 2.000e-33UniRef50_R6XRL2 Uncharacterized protein n=4 Tax=Bacteroidales TaxID=171549 RepID=R6XRL2_9BACT  ali  20  4.RLTAKEEDVMNIIWAKGEVFIRDIVAALPDPKP-NYNTVATQVKFLEDKGFVKRKPMANSFQYSPALTERDYHGTTVGDVVSRYYNNSYISLVSQFVEEDKMDVEDLKKLISQIESKR. 120
378 2.000e-33UniRef50_A0A258B245 Transcriptional regulator n=2 Tax=Verrucomicrobia TaxID=74201 RepID=A0A258B245_9BACT  ali  43  7..IAESEWSVMEALWETSPQTASEVTKVLRPTMNWAENTVRTLLTRLVEKGALKTENASGTRTFLPAVKREACVRAEGESFMQRIFGGAAKPLLVHFAQNSKLTAEEVMELKKLLDQ... 122
379 2.000e-33UniRef50_A0A1V4W4Z8 Penicillinase repressor n=90 Tax=Firmicutes TaxID=1239 RepID=A0A1V4W4Z8_9FIRM  ali  23  6.KLSETEMEVMQIIWESDPVTSGELLDIFARSKGWKGQTIATFLARLVEKGVLNSAKQGRANTYTPRISPEEYRCLEAQSVLDMMYEGSVKNFLAALYDGKKVTRDELAELKQWLK.... 123
380 2.000e-33UniRef50_A0A1W9HH04 Transcriptional regulator n=22 Tax=Proteobacteria TaxID=1224 RepID=A0A1W9HH04_9PROT  ali  20  14..LTETELELMTILWRLGEGAVADVIEQLPKERDLAYTSVSTILRILEQKEILKTRKEGRGHIYTPHLKKNDFEAKTVKHIVERVFDGTPVALVRQLLDSVKLDEKDLKELKNLINQA.. 129
381 2.000e-33UniRef50_UPI0008F897E6 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Angelakisella massiliensis TaxID=1871018 RepID=UPI0008F897E6  ali  25  1MKISQSEMKIMRLIWNSEPLTAAQLMEQLPQE-GWKPTTLLTFLSRLEEKGFVTISKRRRQNTYSARVTEQQYKTMETRAFLEQIHGGSTASLLSALCDAQPLTPEEAQELRRWFDQ... 117
382 2.000e-33UniRef50_UPI0004DB8903 hypothetical protein n=1 Tax=Kineothrix alysoides TaxID=1469948 RepID=UPI0004DB8903  ali  24  7.KLGDAEFEIMEVLWRHDPLTSNEILDEIIEKRNWKLPSLMTVLSRLSEKGFVYCDRSTRTNYYHSLISEDEYKVNQSESFLEKMYSRSAQKFIAGLYQGKKLSPYDIKELRKYLDSLE. 125
383 2.000e-33UniRef50_UPI000C81FFE2 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Clostridiales bacterium Marseille-P2846 TaxID=1852363 RepID=UPI000C81F  ali  32  34..LTDAEWKIMTLLWERSPLTMPQITHALEAETGWTKHTVITLLKRMMQKGTVRMEEAEPARRYYPCVEKDKVAREQTQTLLSRLFEGRASLLVSNMVEQGELTDDEVDELMDILKRAKD 151
384 3.000e-33UniRef50_A0A1G7N8E1 Predicted transcriptional regulator n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1G7N8E1_9BACL  ali  29  10....KSEWHIMEKLWEGAPLTYVQLCHELKENPGWSRSTVQTMLERMTEKGILRYEVVGRAKHYYPNVARDDVAIAETRSLLDRAFEGSASLMMSTLVRKKQLTKAEINELYAILQEAE. 124
385 3.000e-33UniRef50_G0IZ55 Transcriptional repressor, CopY family n=4 Tax=Bacteria TaxID=2 RepID=G0IZ55_CYCMS  ali  19  3.ELTQRELAVLEILWDIERGFVNDVLDKFPDPKP-PYTTVSSIIRILETKGYVNHRAFGKTHEYAPCISKVKYKKGLLKNMVSHFFEGSFDNVVSFMAKENELTEKEITEISSLIEHYK. 119
386 3.000e-33UniRef50_UPI00036ECEBC CopY/TcrY family copper transport repressor n=1 Tax=Streptococcus entericus TaxID=155680 RepID=UPI00036ECEBC  ali  25  1MSLSASEWQVMRVVWAQGALPSSAIITSLQDKFNWSPSTIKTLLGRLVDKGALQTERHGRQYIYSPILAEEATYQEEVRQAFDKICQRKHLPLLLSILTDLPMTASDIAAAEALLCSKKE 120
387 3.000e-33UniRef50_A0A0Z8HDS4 CopY/TcrY family copper transport repressor n=136 Tax=root TaxID=1 RepID=A0A0Z8HDS4_STRSU  ali  21  10..ITDAEWEVMRVVWANDRVTSKIVISVLKEKMDWTESTIKTILGRLVEKGVLNTEQEGRKFIYTANIVEKEAVRDYAEDIFNRICNKKVGNVIGSIIENHVLSFDDIDRLEKILEIKK. 126
388 3.000e-33UniRef50_A0A1C4BIY1 Copper transport repressor, CopY/TcrY family n=1 Tax=Weissella bombi TaxID=1505725 RepID=A0A1C4BIY1_9LACT  ali  20  7..MSNAEWQIMRVVWTVKEATSSEIITAMKQKKDWSESTIKTLLRRLVQKEMLITQKVGRHFIYRPLIAEDDAMIQMTSAVFDRLCSMKKGRTLAELITDMPLSQSDIMNLQEILKQK.. 122
389 3.000e-33UniRef50_S0P2J4 CopY/TcrY family copper transport repressor n=1 Tax=Enterococcus saccharolyticus subsp. saccharolyticus ATCC 43076 TaxID=1139996 RepI  ali  27  1MQISNAEWQVMRVIWSKEQTTSKEITHLLQDKLHWTASTVKTLLTRLVAKKFVTTEKLGNRFLYRPLITEEASVLAMSQEVSEKVCTKKIPLVIMDLIQQNDLTAADIADLMEALQAKE. 119
390 3.000e-33UniRef50_A0A2D0N309 Transcriptional regulator n=2 Tax=Lewinella TaxID=70994 RepID=A0A2D0N309_9BACT  ali  16  6.KPTQREMTILKILWKLGPATVRQVHEQLKSGKKVGYTTALKMMQVMHEKGLLERTLDGVSHIYTPTISEEENVREVLDNMIRTTFKGSSSKLVMQLLGNHETSPEELDEIRNFLDELD. 126
391 3.000e-33UniRef50_A0A1J4XK71 Uncharacterized protein n=3 Tax=Candidatus Marinimicrobia TaxID=62680 RepID=A0A1J4XK71_9BACT  ali  19  11..LSKFEWTIMNRIWEKSRQTAREVMEALPVEHRRAYTTIQTYLERLVEKGYLQKEKLGLVNFYTATVNRSSVVEGATSHFVNQVFGGSASRLAAFLLPNINLQPEDILVIRQMLKEAED 128
392 3.000e-33UniRef50_A0A1M5Z6J7 BlaI family transcriptional regulator, penicillinase repressor n=2 Tax=Sporobacter TaxID=44748 RepID=A0A1M5Z6J7_9FIRM  ali  30  7..ISDAEAEVLRVLWAGGPVTTAEICRDISDKTGWDRSTVRTLIRRLVEKGAIEEQRLG-VLSYRPLLAEEDYRRSLTKSFLERHYGGSAKRLIASLVQSDNLTAGDIAELREFLN.... 120
393 3.000e-33UniRef50_A0A132U563 Uncharacterized protein n=3 Tax=Paenibacillus TaxID=44249 RepID=A0A132U563_9BACL  ali  23  6.KISDAELEILKVLWANSPLSERQIIDALNDDNNWHRATIQTLLRRLCDKGVVEKVKQE-IFYYSARVTEDEYARERTSDLLNKVYGGSAKNLVSAMLGSNILSEKDIEDLGDYWKKRK. 123
394 4.000e-33UniRef50_UPI00094678DB BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Mariniblastus fucicola TaxID=980251 RepID=UPI00094678DB  ali  21  1MKPTDGEQEILSALWALEKATVRQVYTELSGKRDVGYTTVLKLMQIMFEKGLLDRDETSRSHMYWPRQKAQVTQRRLVNDFVQKVFGGSTGKLVLNALSTKKATPAEIADIRKMLDEM.. 118
395 4.000e-33UniRef50_A0A1V5N8E4 Penicillinase repressor n=8 Tax=PVC group TaxID=1783257 RepID=A0A1V5N8E4_9BACT  ali  21  19..ITEAEWTILKVVWKKHPCPAGDVQEALAKIKGWAYSTVKTTMDRMVQKGLLNTHSIRSLQLFTPAITEAQAQRNEIFKTIKRAFDGALTPMMQFLLENEKFSEDDLKQLRNMVDKAQ. 135
396 4.000e-33UniRef50_UPI00035EB819 CopY/TcrY family copper transport repressor n=1 Tax=Allofustis seminis TaxID=166939 RepID=UPI00035EB819  ali  22  6..ISPAEWEVMRVVWAHDHVKSREVIEILGDKMNWKPATIKTLLRRLVDKQVLSIAKEKRSFIYTPIISEEEMAQEAADTLFSMICAKEAGALIQYLIETHPLSKSDVKVIQDIVAKKME 123
397 4.000e-33UniRef50_UPI0009878110 hypothetical protein n=1 Tax=Marinicella sediminis TaxID=1792834 RepID=UPI0009878110  ali  40  5..ISQAELVIMKMLWAQSPLSAVQINEQIRDQ-NWRMATVKTLINRLLKKGFISYEQQGRTYYYQPVIEKSAYLEAQNESFLNDLYDGRLSDMLAAFTQQERLSSKEIEELKNIIDDME. 120
398 4.000e-33UniRef50_UPI00035D01EE BlaI/MecI/CopY family transcriptional regulator n=2 Tax=Hyphomonadaceae TaxID=69657 RepID=UPI00035D01EE  ali  19  6.KPSAAESAILNVLWAKQPCSVKEIHDILSATKDVGYTTTLKQVQRLHSKGMVARKPEGKSFLYSAAVKEDVTKSDLFDQFVETAFSNSVSELVMHALGNEKTSEAEINKIRAFIAKLDE 125
399 4.000e-33UniRef50_R5AI82 Transcriptional repressor CopY family n=2 Tax=Firmicutes bacterium CAG:102 TaxID=1262998 RepID=R5AI82_9FIRM  ali  26  5MSISNAEMKVMNHIWKTGAMTVPEMLAILNEEEEWTYPTVATFLRRLETKGILGVTKKGNKLCYFPLVSKEQYETKEAEGFVESKFGGSLKNFLVAFRGSDKISKKDMNDLKAWLDELDD 126
400 4.000e-33UniRef50_W6T4Z7 Uracil phosphoribosyltransferase n=91 Tax=Terrabacteria group TaxID=1783272 RepID=W6T4Z7_9LACO  ali  23  7IEISDAEWEVMRVTWTLGSVTSSQMAEIMAEKMGWKTATVKTLLGRLIKKGALRAEKNGRAFTYYPTVDEQPSMDEAVTTLFGHLCQMRVGQTLTDLVAKVQLSQKDIQQLQAALAKKAE 126
401 4.000e-33UniRef50_A0A1Y4TJM7 Uncharacterized protein n=7 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1Y4TJM7_9FIRM  ali  33  6.RLPDAELAVMQALWQAGPLTRPELETMLAPAHAWAPTTVLNLVARLEGKGFVTRHKAGRGHLIEPLVTRQEYLAVESRSALERMFGGSARNLVAALHQCHALSKNEIRELSDYLDEL.. 123
402 4.000e-33UniRef50_A0A1G3ARE1 Uncharacterized protein n=5 Tax=Planctomycetes TaxID=203682 RepID=A0A1G3ARE1_9BACT  ali  21  8.HFGQLQRAVIEVVWELGEATVRQVWKRLCRKKELAYTTVLTALQRLEKAGWLKHRVDGRKHIYLPTKTREQAGAGSVRKFVQRMFNGNALVLFRQLVEEGELSDEELRELQQLINQKR. 125
403 4.000e-33UniRef50_A0A1Q3H0W3 CopY family transcriptional repressor n=5 Tax=Cytophagaceae TaxID=89373 RepID=A0A1Q3H0W3_9BACT  ali  24  3.ELTKNEEVIMHILWKIERGTVRDVMAHMPEPLP-PYTTVSSIVRLLEKKGYIGHKAYGKTHEYFPEVPKSAYRKKAFNAFLKNYFEGSAKKVVSFLVKEKNLDTEEAEEIKKMIDQFEQ 120
404 4.000e-33UniRef50_A0A2S8GSQ9 CopY family transcriptional regulator n=3 Tax=Bacteria TaxID=2 RepID=A0A2S8GSQ9_9PLAN  ali  21  9..LSDLENKVMGVIWKRQVVTAEMVREELPADPPLKDSTVRTILRRLEEKGYVQHRSEGRAYVYSPKVASQSVAADAVRSIIERFCNGSVEALLMGLVDREVVSPEKLQQLALKIAEQEE 126
405 4.000e-33UniRef50_A0A1I4W8C6 Predicted transcriptional regulator n=1 Tax=Flavobacterium ummariense TaxID=913024 RepID=A0A1I4W8C6_9FLAO  ali  25  1MKLTAAEEQLMQYIWKHDKVVLKDLIDSYSDPKP-AKTTVATTVKKLIDKGFVGYDEIGNTRLYFAIVRKENYFSKQMKNMIKQFFDNSTSQFASFFAKDATLTKDELQKLRDLIDD... 116
406 4.000e-33UniRef50_A0A1H7S7F4 Predicted transcriptional regulator n=1 Tax=Pseudosphingobacterium domesticum TaxID=407022 RepID=A0A1H7S7F4_9SPHI  ali  20  3.RLSEKEEALMQIVWTLKKAFAKEVREELPEPKPH-INTVATTMKRLADKGFLKFEDFGSTYRYAAAITKKEYTTRFVKPLLTGLFGNSMKNVVSFFAEEEDISVEDLKEIMDMIEKKK. 119
407 4.000e-33UniRef50_R5PA98 Uncharacterized protein n=14 Tax=Bacteria TaxID=2 RepID=R5PA98_9CLOT  ali  33  6.QITEAEYEVMQIIWHNYPISTNEITEQLLQTTNWNPRTIQTLIKRLATKNIITYEKQGRVFVYTPLLKEEDYISQQSKSFLDKFFNGNLSSMVSTFLDH.................... 104
408 4.000e-33UniRef50_A0A1I5XVB7 Predicted transcriptional regulator n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1I5XVB7_9FIRM  ali  23  3IKLFDSELKVMEVLWQYGDTPAKRIAEILNKQVGWKKTTTYTVIKKCIEKGVIERRE--PNFVCHPLVTKEQVREFETNELINKMYGGAADQLVASLLESRKLTPQEIERLKRLVKDLE. 119
409 5.000e-33UniRef50_A0A0R2N4T6 Uncharacterized protein n=1 Tax=Pediococcus argentinicus TaxID=480391 RepID=A0A0R2N4T6_9LACO  ali  23  5..ITPAEWKIMRIVWTLGEVGSADIIENIQRMNDWSNSTIKTLISRLVKKGYLLATSQGHANLYSALIPEETAINSESANLFDSICEMKVGEVIAKAIQEHQVSKNDLKEIQKII..... 117
410 5.000e-33UniRef50_A0A255IHZ0 Transcriptional regulator n=2 Tax=Romboutsia weinsteinii TaxID=2020949 RepID=A0A255IHZ0_9FIRM  ali  27  6.QVTEAELEVLKVIWKKKKTTSKEIVDELLYTTNWKSKTIQTLITRLVDKGALDVDKSSKKYIYSPNVSEQEYKKVANESFINKLYNGSLNLMLSTFITDNQLSKQDINNLKNLLNEK.. 123
411 5.000e-33UniRef50_B0MWE0 Transcriptional regulator, BlaI/MecI/CopY family n=6 Tax=root TaxID=1 RepID=B0MWE0_9BACT  ali  23  3.KLTPREEELMRCFWTRGPLFVRELVALWPEPKPH-FNTLSTMVRGLEAKGYVGHKAYGGTYQYYPLVSEEEFSRKTLKGVVSKYFDNSYLGVVSSLVREEKISVDDLRDLIRQIESQTE 120
412 5.000e-33UniRef50_N1ZYG1 Uncharacterized protein n=1 Tax=Eubacterium plexicaudatum ASF492 TaxID=1235802 RepID=N1ZYG1_9FIRM  ali  24  4.KLTDAEWKVMAVLWEKSPRTMMEITNLLKEETGWTKYTVMSFLKRMEEKGAVHYEDGGKAKLYFPDWKREDVAIQETEDFLNKVFYGKIGLMLNAMVQQKALSQQELDELSQILQENE. 121
413 5.000e-33UniRef50_C5EEJ6 Transcriptional regulator, BlaI/MecI/CopY family n=38 Tax=Firmicutes TaxID=1239 RepID=C5EEJ6_9FIRM  ali  28  3LKLFDSELKVMEMLWNHGDCTAGQLAKLLKEETGWNRNTTYTVIKKCIEKGAI--ERCEPNFLCRAVVRREEIQAAETEELIDRMFDGSKSKFFAAFLSGQSLSKEELEELRQMLKQAGQ 120
414 5.000e-33UniRef50_A0A1U7CSR3 Penicillinase repressor n=3 Tax=Planctomycetales TaxID=112 RepID=A0A1U7CSR3_9BACT  ali  23  7MQPTDGELEILNVLWDAGPVDLGTVRAALQSKRAVASTTVATMLKLMLDKGLVERADGPKGYLWSARVSRKSARSGLVGKLLDLAFDGSAQGLVAHMLEAGKLSPRDRDEIRRLLDEKSE 126
415 5.000e-33UniRef50_A0A1Y4S6F7 Transcriptional regulator n=1 Tax=Lachnoclostridium sp. An131 TaxID=1965555 RepID=A0A1Y4S6F7_9FIRM  ali  25  3.QISESELVLMKIIWGNGGTALSFIMEKLEKERDWKKNTVLTLLSRLVEKGYLRTNKIGRRNEYEALVTEQEYQAMQTNSFLDRIFGGNVRGLVSTLLQEDRLSPEELKEIEKFWEEQNE 123
416 5.000e-33UniRef50_A0A1W1YP71 Predicted transcriptional regulator n=7 Tax=Firmicutes TaxID=1239 RepID=A0A1W1YP71_9FIRM  ali  27  8..LTGSEWSLMECLWEDSPRSSMQVVSDLKRRVGWSKSTTLTMLRRMASKGLLKSTSEGGTRLYSPNLKREEATAKETKEFLDKVYQGSVSLMMSSMAENRELTQEEIDELYEILRKAEE 125
417 5.000e-33UniRef50_A0A2E1VWF2 Transcriptional regulator n=2 Tax=Planctomycetes TaxID=203682 RepID=A0A2E1VWF2_9BACT  ali  18  9.EPTERELEILKVLWEQGESTVRQVHEALRERLPIVQNTVQAFLRTMEDKGLVTHRAEGRSFIYRAVLQRESTAQTVVSGVMNRVFDGAMDQLVQSAFSVRRPTREELAQLRALLEDAE. 126
418 5.000e-33UniRef50_UPI000BFF12AE BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Marinicella litoralis TaxID=644220 RepID=UPI000BFF12AE  ali  16  6.KPTKTELAILNIMWQISPATVRQIHEELIKNGKTSYTTTLKMLQVMHQKGLVSRNSEQKAHIYQPSLSKKETQKQMLDDLKNRLFGGSISSLVLQALGTADITKQEINEIKAILEKAEE 125
419 6.000e-33UniRef50_E8R3Y4 Transcriptional repressor, CopY family n=1 Tax=Isosphaera pallida (strain ATCC 43644 / DSM 9630 / IS1B) TaxID=575540 RepID=E8R3Y4_ISO  ali  23  33...TDRELEILKILWAKGRANVREVQEELGRNGPVAYSTVQTLLNIMEEKGLVRHVVEGRTFVYIPKKTPEGTLREMTKRFIDRVFDGALDRVMVALLDARAPSPEELARLRAVLDRA.. 149
420 6.000e-33UniRef50_A6C1U6 BlaI family transcriptional regulator n=8 Tax=root TaxID=1 RepID=A6C1U6_9PLAN  ali  21  24..MTDVEWVIMNVVWEHEPCAAGTVQEALAESYAWAYSTVKTTMDRMVTKGLLTRKSIRNLNLFSSAISPDNAKRGELKRVLSRAFNGALTPMLQFIVDEEELTAEEIQQLRKIIKRAD. 140
421 6.000e-33UniRef50_A0A075MW91 Negative transcriptional regulator-copper transport operon n=148 Tax=Streptococcus TaxID=1301 RepID=A0A075MW91_STRAG  ali  22  1MTISSAEWEIMRVVWAQQNTTSNEILAVLLEKYDWTPSTVKTLLRRLLDKGYVSREKMGKGFSYSPLIDEDLAMMSEVDSVFQKVCQTKHVAIVRHLLESIPMTEKDRLNLQSSLEAKK. 119
422 6.000e-33UniRef50_G0J4Q3 Transcriptional repressor, CopY family n=13 Tax=Cytophagales TaxID=768507 RepID=G0J4Q3_CYCMS  ali  19  4..LTNNEEQVMRIIWKLEKALVRAVLNEFPEPRP-PYTTLASIIRQLENKGYLDHKTYGNTHEYFPVISKKAYQHRSFNQLVKNYFDGSAKKVLSFMVKEEKLTEKDIQELEKIVENFK. 119
423 6.000e-33UniRef50_F6GI73 Transcriptional repressor, CopY family n=39 Tax=Bacteroidetes TaxID=976 RepID=F6GI73_LACS5  ali  24  3.QLTKAEEDIMQVLWQLEKANVKQIIEQLPQPKP-AYNTVSTIVRILESKGFVDYEKKGKGHIYFPLLKKQEYSNQSLNKLVDNYFQGSFKSMVSFF....................... 97
424 6.000e-33UniRef50_A0A2N1D3G4 BlaI family transcriptional regulator n=2 Tax=Paraglaciecola TaxID=1621534 RepID=A0A2N1D3G4_9ALTE  ali  24  5IKLSEFELDVMNILWQAGKASAPEVHQKIKLDKDVSYSTVKTIIDRLEQKLALTRDQQGRTIYYAPAIEREALSTPLLKGFLKRMFAGDPHKMVAQLLANEQLDNSEIEQLENMLAAQK. 124
425 6.000e-33UniRef50_R5RQV8 Uncharacterized protein n=4 Tax=Firmicutes TaxID=1239 RepID=R5RQV8_9FIRM  ali  20  4.RLPDSELEIMMAIWSCEPVTRMQIEEKLDREPKISATTVLSFLSRLEEKGFVTVTKEGKTNVYRARISKKEYLGEESKSILSRMYGSSLKNFVTAFYDGKQVSRDEIQELQDFLD.... 119
426 6.000e-33UniRef50_A0A0D8IUR8 Uncharacterized protein n=2 Tax=Ruminococcaceae TaxID=541000 RepID=A0A0D8IUR8_9FIRM  ali  33  7.RLPDSELAVMQALWRADPLTRPELDAALTH-REWAATTVVALLARLEGKGFIAREKQGRGYLYRALVTQDAYLAAESRTLLGTLYGGRPRNFIAALHDADALTPNDIAELEDYLEKAK. 124
427 7.000e-33UniRef50_A0A2P1PPY2 BlaI family transcriptional regulator n=1 Tax=Ahniella affigens TaxID=2021234 RepID=A0A2P1PPY2_9GAMM  ali  26  12..LSGLQLEILRAIWKRGEASTSDVAAELAESRDLAHTTVGTLLNRLEKRGLIRSRRDGKHLIYHASVAESDIKRSMVSEFLDRLFGGDANALVAHLVSEQEVKAADLNAVRKLLQDQEQ 129
428 7.000e-33UniRef50_A0A098S7K3 Uncharacterized protein n=1 Tax=Phaeodactylibacter xiamenensis TaxID=1524460 RepID=A0A098S7K3_9BACT  ali  21  5..PSDTELDILRVLWDKQPRTVREVHEVLSATKDVGYTTTLKQMQRMLDKGALHRQEDGRAHLYSTSLKAPKVQRSLLSRLTEKAFGGSAMDLVIQALGHGDPTADELDQLEQLIAEKK. 121
429 7.000e-33UniRef50_V6Z6S2 Uracil phosphoribosyltransferase n=2 Tax=Streptococcus TaxID=1301 RepID=V6Z6S2_STRAG  ali  18  2LQIANAEWEVMRVVWASEEVTSSYIIDILQQNHDWSDSTIKTMITRLSEKGLLSSRREGRRFWYRAVISEEEGQWKRIEETFDKICITKRGKLLAALMTDTPMTEQDIAMFESILQAKK. 120
430 7.000e-33UniRef50_A0A0M6Z384 Methicillin resistance regulatory protein MecI n=19 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0M6Z384_9RHOB  ali  22  10..LTEVELEFMTELWKIGEGSVRDILACLPPERKLAYTSCATIMRILDEKGFVDSRKEGKTFIYSPRLTKDTYQSRSLRNLSEKLFDGTPASLVARLVDEYELSEDELEKIRALLVRRR. 126
431 7.000e-33UniRef50_U2H9R0 Uncharacterized protein n=43 Tax=Bacteroidetes TaxID=976 RepID=U2H9R0_9SPHI  ali  16  1MKPTESEMEILQVLWNKGQCSVREVFETL-DKKDVGYTTILKLMQIMHEKKMVIRDTSSKTHIYTANINKEKTQNQFLNKMIDTVYNGSTSRLVMQALGNHKASKEEIDLIKDYLNQLE. 118
432 8.000e-33UniRef50_A0A0R2JUG8 Uncharacterized protein n=6 Tax=Lactobacillus TaxID=1578 RepID=A0A0R2JUG8_9LACO  ali  23  10...TGAEWNVMRIVWSLGSCTTREIIDNLQCESAWKDSTIKTLLTRLTKKGFLQNKKVDRHFVYLPLVPEQEAMNQSAEELFTRLCAMKKGQSIIDLVKNTKMTQSDLAELSRLLTQK.. 124
433 8.000e-33UniRef50_B2TM47 Penicillinase repressor n=36 Tax=Bacteria TaxID=2 RepID=B2TM47_CLOBB  ali  30  6.KISESEWEVMKTLWKTNPLTSEEIIDTLSLKMSWSKQTIKTFITRLIKKGVIGFKKDGRVYNYYPLISEGDCMKFENKSFIKKVYDGALNILFSSFLEEEDLS................ 108
434 8.000e-33UniRef50_E4TNJ2 Transcriptional repressor, CopY family n=20 Tax=Bacteroidetes TaxID=976 RepID=E4TNJ2_MARTH  ali  25  3.ELTKAEEQLMRHLWKLEKAYLKDIVDEYDEPKP-AYTTISTVVNVLVRKGIIGFDLHGKAKHYYPLISKEDYSNQSIKGLVSNFFNNSYQQFASFFTSRKELSVDELKEIRKMIDD... 117
435 1.000e-32UniRef50_A0A2G6HV41 Transcriptional regulator n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2G6HV41_9BACT  ali  28  1MRCSDFEIEVLQVFWEQGDLTAPEIHEIIQKRRLVAYNTVKTIIDRLEKKGAVERRQYGRTILFRATVAEAEITRPMVQSMLKRLFGGNRKALMSHLFQDEALSDDEILYLESLLKNHK. 120
436 1.000e-32UniRef50_B5JQ06 Transcriptional regulator, BlaI/MecI/CopY family n=9 Tax=Bacteria TaxID=2 RepID=B5JQ06_9BACT  ali  23  11.KLSPMELEIMQTFWKLKSASIREVQEALPKKRKVEYTTVQTIVYRLEKKGAVRRKKIGNAHVFEPLVTKKSAIGSMVDDFLS-LFGGSAEPVMLHMAESGKLSLEDLKALEDAIKQTRE 129
437 1.000e-32UniRef50_R6Q3I1 Transcriptional repressor CopY family n=7 Tax=Firmicutes TaxID=1239 RepID=R6Q3I1_9FIRM  ali  26  3ISISDSEMKVMEKLWACGHMSVADVVAALNDDENWTHQTVGTFLKRLETKGIVSASKKGKSLYYFPLLSKEQFYAKEADHFLQSKFKGSLKNFLAAFSSEKKLSENEIQDLKDWFD.... 120
438 1.000e-32UniRef50_A0A0R2CMC0 CopY TcrY family copper transport repressor n=4 Tax=Lactobacillus TaxID=1578 RepID=A0A0R2CMC0_9LACO  ali  19  6VEISDAEWQIMRVVWTLQQATSRQIIDNLAAKNHWKEATIKTLLRRLIQKKVLATTTQKRSFVYHPLINEQEAIDLMTTNVFEKICQMHVGSALQSLVKQFPLTKNDISALETELRQK.. 123
439 1.000e-32UniRef50_A0A2V7VTU1 BlaI family transcriptional regulator n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7VTU1_9BACT  ali  23  8.ELTDLQIAIMQEVWSRGTASVTDVHDALLDKTGLAKKTIGTMMTRLEKQGFLAHYADGREFIYEPTVTRYEVGRAKMRNVLDHLFGGSLPALVSHALEAKDIAPGDVERVRSLISDWE. 125
440 1.000e-32UniRef50_A0A238U6E8 Penicillinase repressor n=18 Tax=Bacteroidetes TaxID=976 RepID=A0A238U6E8_9FLAO  ali  26  1MKLSKSEEQVMQYLWKLNKAFMKDLLLEFPDPKP-ANTTLATLLKRMKDKGFIDYKLYGKSREYFPLVKKTDYFSKHVNGLIKNFFNDSASQFASFFTKETDLSVDELKELRKIIDQIKE 120
441 1.000e-32UniRef50_A0A2U2ACQ2 CopY/TcrY family copper transport repressor n=2 Tax=Ignatzschineria TaxID=112008 RepID=A0A2U2ACQ2_9GAMM  ali  22  7...TPAEWEIMRVLWANGEARSADIIRIFQEKRHWKPTTTKTLLSRLVDKNCVGTIQEGNRYRYRPLVTELDVWRSVTNELFTFVCDKDRASRIAQMIEAYPLSEEDLALIYQSLERAE. 122
442 1.000e-32UniRef50_I3ZIN6 Putative transcriptional regulator n=21 Tax=Bacteria TaxID=2 RepID=I3ZIN6_TERRK  ali  23  9.KPTEGELELLSILWDRGPATVRDVFVEVNKHRPVVYTGVQKLMQIMLDKGLLARDATERAHVYRPAVAKEETEQRFMRELSNRFFAGSAGQLALRALEMEQASEEELDEIRKLIAKKR. 126
443 1.000e-32UniRef50_A0A1Y3RY62 Uncharacterized protein n=2 Tax=Gemmiger TaxID=204475 RepID=A0A1Y3RY62_9FIRM  ali  27  13.RLPDGELEVMQALWQSDPLLRSELDEGPGKKNGWAPQVLVTMLTRLEKKGFVCRNKEGRSYRYEALISRDEYLASESESLVERLYGGQPAGFIAALQRGKGLSATDIQELEAILQKAKE 132
444 1.000e-32UniRef50_A0A091BJM3 Uncharacterized protein n=27 Tax=Bacteria TaxID=2 RepID=A0A091BJM3_9GAMM  ali  22  8IALSELQLDVMRVLW-RGEASVADVAAALAESRGLAHTTVATVLTRLAKRGVVAARRDGRQLVYRATVSEPQVRRSMVGDLIQSLFKGDPRALLAHLVSEKDVAPGDLAKVQALLAADE. 125
445 1.000e-32UniRef50_A0A2N5ZHL0 Transcriptional regulator n=4 Tax=Bacteria TaxID=2 RepID=A0A2N5ZHL0_9BACT  ali  18  4..LTKAEERIMKILWKIEKGFINDILDHFPDPKP-PYNSVSTIVRVLVKKDIVSFKKYGNTYEYFPKITKEEYRKSQMSRLLKDYYNNSLKQVVNFFSENKNLDVKEVDEVMQMLNELK. 119
446 1.000e-32UniRef50_A0A1C6HHC2 Regulatory protein BlaI n=16 Tax=Firmicutes TaxID=1239 RepID=A0A1C6HHC2_9FIRM  ali  25  7.KISDSELEVLEVLWEAEEAPIAPIRKRLEERRGWDSSTIKTLLRRLCEKGAVEARRRE-SFYYRPVLNREDYQRWSTRSLIQRVYRGSAKDLVASLVRGDQLTDQDLDELRALLDR... 122
447 1.000e-32UniRef50_UPI0007855523 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Paenibacillus sp. 32O-W TaxID=1695218 RepID=UPI0007855523  ali  21  7.RLSATEKKIMDLIWKAERVTMREIMDQLPEASEWKHNTTITFLSRLINKGFLTSTRVGKAHHYEACITEREYQDLETKQFIKEIYKGSVYGFVSALCDNGDLTKEEIESLMKRLEE... 123
448 1.000e-32UniRef50_L1NKX8 Transcriptional regulator, BlaI/MecI/CopY family n=22 Tax=Bacteroidetes TaxID=976 RepID=L1NKX8_9BACT  ali  23  5.KMTQQEEEVMRYVWLLGRCTVKDIVTEMPEPQP-PYTTVASVINNLKRKGYVEATRKGNGYEYVPTVKEATYKQSFMSGFVHDYFKNSFQEMVSFFAKEDKITPEELKEIIREIEKGK. 121
449 1.000e-32UniRef50_R6EUS5 Transcriptional regulator n=4 Tax=Prevotella TaxID=838 RepID=R6EUS5_9BACT  ali  23  1.......MQIMSILWDNGRMTTHEIIDAYPEPRP-AYSTIATFMKILTHKKYVTSYKRGKTYVFSPLVTRAEYTRQAMKEVKKSFFGGSLHSLISFFVKEENISDEELEEILSLIDKGTE 116
450 1.000e-32UniRef50_UPI0009ED5D2C BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Emergencia timonensis TaxID=1776384 RepID=UPI0009ED5D2C  ali  25  26.KISDAEAEIMRVVWEHGPVTYSYIRTVLTQQKNWESPTVNTLVKRLVKKGALIQEKRE-VYYYTAVISEEEFTKAKTESFLQKVYGGSVKGLMSALITSGNLTSEDLAELHALWEE... 141
451 2.000e-32UniRef50_UPI000BBB71B9 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=bacterium JGI 053 TaxID=1855372 RepID=UPI000BBB71B9  ali  24  80.RLTELQIEVLGVLWQRSEATVADVHQALEPSTGLARKTIGTLLFRLEQQGVIRHREEGREYLYAACVTREQVERAAVGSVLGRLFRGDVAAMVSHALRAEEVEPGDVERLKEMLER... 195
452 2.000e-32UniRef50_S0P0C1 CopY/TcrY family copper transport repressor n=1 Tax=Enterococcus sulfureus ATCC 49903 TaxID=1140003 RepID=S0P0C1_9ENTE  ali  23  10...SEAEWQVMRVIWNKQHTTAKEIYELLHESLDWKLTTVKTLLGRLVTKEWVQTTKEGKRFIYSPLLSQTDAMKLATDDFLARFCATTVGETIAEMIRTTPLRQEDLQLLRETIDQ... 123
453 2.000e-32UniRef50_V4QBR3 Uracil phosphoribosyltransferase n=7 Tax=Streptococcus TaxID=1301 RepID=V4QBR3_STRIN  ali  24  4..ISEAEWEVMRVIWARKQLKSSDIIDILQEKFQWSPSTIKTLLGRLVDKKLVGTQKSGRAFLYESLVNEKDYQEKLIQDGLNHICQRKHASLLLKILKAMPMTKQDIADFQELLREKE. 120
454 2.000e-32UniRef50_A0A1M6PMY3 BlaI family transcriptional regulator, penicillinase repressor n=3 Tax=Clostridia TaxID=186801 RepID=A0A1M6PMY3_9FIRM  ali  25  7.RISQAEFEVMKILWRTGPVSTGDIYQELSKEFGWDRSTVRTLLKRLTEKGAVSAHKL-KVLCYQPAISEKEYCDEQIKNVVERLYGGSATRLVTSLVENYDLTDADMEELRDILK.... 121
455 2.000e-32UniRef50_A0A257FN74 MarR family transcriptional regulator n=2 Tax=unclassified Burkholderiales TaxID=119065 RepID=A0A257FN74_9BURK  ali  27  7IELTPAEQRIMQVLWRGRAMTVREIAAELSTEHELAYTTVQTLCRILLDKGHVSCEKQGKAFVYQALTVQQEARSQALLGLLKKFFGGSPTLLAQHLLNQEALSPEVASQL......... 117
456 2.000e-32UniRef50_A0A2D0NFP0 Transcriptional regulator n=2 Tax=Lewinella nigricans DSM 23189 = NBRC 102662 TaxID=1122177 RepID=A0A2D0NFP0_9BACT  ali  21  8.EPSNSELEILQILWAHAPATVRFVHEQLKRETEIGYTTVLKQMQRLADKGVVKRKLKGKTHYYSAIPKQSEIQQNLFQRFLSNVYEGSAMKLVMHALGQGNTSPEELKKLEQWIEEQKD 128
457 2.000e-32UniRef50_A0A0Q0VH24 Uncharacterized protein n=1 Tax=Pedobacter sp. Hv1 TaxID=1740090 RepID=A0A0Q0VH24_9SPHI  ali  22  6.ELTKAEEQLMKVVWQLQKATIKEITDGMPEPKP-AYNTVATVLKVLKGKNFVALEANGNVFSYYPLVAEKDYRHFAFDKVFDNYFSGSYHSLVSFLVEEKNLDEVTHERLKQLADKLKD 123
458 2.000e-32UniRef50_A0A243WFG5 Transcriptional regulator n=21 Tax=Bacteroidetes TaxID=976 RepID=A0A243WFG5_9BACT  ali  18  3.RLTQPEEDAMQVLWQLDGGFVKDVLEHLPTPAP-PYTTLASTIRNLERKGYVQGTKLGNSYRYAPLVRAEDYRRTFMSSFVSDYFRNSYKELVSFFAKEQKISADELQEIIRMIEQDK. 119
459 2.000e-32UniRef50_A0A2E7KDH7 Penicillinase repressor n=2 Tax=Planctomycetaceae TaxID=126 RepID=A0A2E7KDH7_9PLAN  ali  27  8.HPTDLELEILKILWSTSPLTVREVRDQLEAGRPLTHSSVITILNIMYRKGYVKREKAGKSFQFSPAQEKQTVTGSIMGDLLSRVFEGSSSDLVLNLLETAELDSDELAELRKLITRK.. 126
460 2.000e-32UniRef50_V6LZ77 CopY family transcriptional regulator n=10 Tax=Firmicutes TaxID=1239 RepID=V6LZ77_9BACL  ali  22  6.RLSETEMEVMEVIWGAAPVTVAQLLDIF-ESKGWKTSTLSTILKRLIEKGYLTKSMTGKVNYYDPVLTLDEYKKHETQSFLSRLYNGKVKNFIASLVDDDELSREDIAELKEWFARKE. 123
461 2.000e-32UniRef50_A0A2G6H8E2 Transcriptional regulator n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2G6H8E2_9BACT  ali  24  3.ELTRAEEQVMKIIWEIKEGVIHDILHKIEEPKP-AYNTISTIVRILETKGFISHKAVGRTHIYYPLIGQEEYTNRFFKNFLSKYFHGSFAELASTFTRWEDFSIGEMEEIQKLIAE... 117
462 2.000e-32UniRef50_D2QW86 Transcriptional repressor, CopY family n=1 Tax=Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) TaxID=530564 RepID=D2QW86  ali  24  3.RMSGLQLSIMRVLWQRGPSSVAEVQKELHSTRPLAYSTLATLLKRMEEKHAVRHITEGRTFIYEAMIQPEEAGHSLFADLLEHVFAGSPSQLVSHLLHTREIEPDEMARIESLVRKHQE 121
463 2.000e-32UniRef50_A0A1V0DIY8 CopY family transcriptional regulator n=4 Tax=FCB group TaxID=1783270 RepID=A0A1V0DIY8_9BACT  ali  12  8.QLSRRESQIMDIIYHLGEATVAQVLERMPDPPG--YNSVRITLGILEKKGYLRHRQDGQRYVYAPVVPPEKAKRSVMGHLLKTFFAGSTSHAVLTLLDSSRISDAELDEIAAWIEQAR. 125
464 2.000e-32UniRef50_E8V5J1 Transcriptional repressor, CopY family n=13 Tax=Acidobacteria TaxID=57723 RepID=E8V5J1_TERSS  ali  20  11..LTPLEMQIMQVLWRDGPSHVQHVQTSLAPENELAYNTVQTMLNVLHRKGRVERSLSGRAYVYSTVASREIVLGQAVKDFVERLFGGSSEELVMSLIKSRQVDPERIADLSRKVANLD. 127
465 2.000e-32UniRef50_A0A1Y4C5F1 Uncharacterized protein n=7 Tax=Flavonifractor TaxID=946234 RepID=A0A1Y4C5F1_9FIRM  ali  29  7.QIQDAELEVMRILWQSEPVALAEVRRELAARCGWEDSTVKTLLRRLCAKGAVKLERRG---MYRAVITQAEYGRWSAKRFVSKVFEGSAKKLVAALVSDGQLSQADIDELSALFHQGEE 123
466 2.000e-32UniRef50_A0A242L769 CopY/TcrY family copper transport repressor n=2 Tax=Lactobacillales TaxID=186826 RepID=A0A242L769_9ENTE  ali  21  9..ITDAEWEIMRVVWTKKETTSTEIINVLESKTEWKPSTVKTLLSRLVAKNYLFTRKEGKQFVYQASVQEDDAIKEARNELFDKICNKKIGSTLIETVKERELSISDIEILEQLLREKK. 125
467 2.000e-32UniRef50_R8VZK4 Uncharacterized protein n=5 Tax=Clostridiales TaxID=186802 RepID=R8VZK4_9CLOT  ali  27  6.KLSETEYEIMEVLWKSQPMSSAQLASYFAENKEWKPSTLATFLSRLTQKGLITSHREGRVHYYRPIKSKKDYARDGAQGILDALYDGSIKNFFAALYGGSQMSEEDRETLKEWLDN... 124
468 2.000e-32UniRef50_A0A081PVW3 COPAB ATPase metal-fist type repressor n=296 Tax=Bacteria TaxID=2 RepID=A0A081PVW3_STRMT  ali  19  1MQISDAEWQVMKIIWMQGEQTSTDLIRVLAERFDWSKSTIQTLLARLVEKECLTRKKEGKFFVYSALLTLDQSRDLLVQDIKDKVCSRRIKNLLADLIAECDFTQADLEDLEAVISEKK. 119
469 2.000e-32UniRef50_A0A2N0VRU5 Uncharacterized protein n=2 Tax=Macrococcus caseolyticus TaxID=69966 RepID=A0A2N0VRU5_9STAP  ali  32  10.EIPASELTVMQVIWANKELSANQIIDYLSNDNQWSPKTIRTLINRLVDKNFLSKEKNSKVYIYKPLVKESSYKKNTTKSFINKLYDGALTNLVMNFAKQEKLTDDEI............ 117
470 2.000e-32UniRef50_V6Q6B7 CopY/TcrY family copper transport repressor n=1 Tax=Vagococcus lutrae LBD1 TaxID=1408226 RepID=V6Q6B7_9ENTE  ali  24  6..ISEAEWEIMRVVWANSPVTSQTIINVLTPKMDWKPNTIKTLINRLLNKGYIKAEKEGRAFLYEATVSEKEMLMTAFKALLGQTCARRSGELLQELITDTVLSQKDLVGLEQVIQDKQ. 122
471 2.000e-32UniRef50_A0A136LBR4 CopY family transcriptional repressor n=1 Tax=Bacteroidetes bacterium OLB8 TaxID=1617419 RepID=A0A136LBR4_9BACT  ali  22  8..LTKAEEEIMHHFWEKGQSSVSDIIAGMDDPKP-PHSSVSTIVRILERKGFLGHEAIGRAYEYFPLVEKNEYSSRSLNKFVNDYFDGSFSGLVSFIAKEQDLNMQEFNDLMDILNKK.. 122
472 2.000e-32UniRef50_A0A1Y4WDL6 BlaI family transcriptional regulator n=1 Tax=Flavonifractor sp. An10 TaxID=1965537 RepID=A0A1Y4WDL6_9FIRM  ali  29  1MELSKSALRVMNQLWEKGELPAKTLCGLLHEQCGWNKNTTYTILNSCVKKGLIERREPG--FLCRPLVGREEVRTQELGHLVDGLFQGSPALLFSTLVGSGSLSQEDVEEMQALIDKLK. 117
473 3.000e-32UniRef50_A0A1U7CSV8 Methicillin resistance regulatory protein MecI n=2 Tax=Planctomycetes TaxID=203682 RepID=A0A1U7CSV8_9BACT  ali  22  9..LTAREAQIMDVVWRLGEATAEQIREGLEDRP--HDSTIRTLLRILETKGFLAHEARGKAYLYRAAVERERAQGLALRSMLAQFFRGSAEDLVLRLIEDEQITPEQLDELRR....... 117
474 3.000e-32UniRef50_C6VVA3 Transcriptional repressor, CopY family n=67 Tax=Bacteria TaxID=2 RepID=C6VVA3_DYAFD  ali  17  3IKPTDSELEILNYLWQAGPSTVRAVHDALSETKDVGYTTTLKLMQIMHDKGLLYRTEQGRSHIYVALLGKEETQQNLVGKMVETLFQGSAAQMVMQALGN.................... 102
475 3.000e-32UniRef50_E8JU60 Transcriptional regulator, BlaI/MecI/CopY family n=60 Tax=Firmicutes TaxID=1239 RepID=E8JU60_STRCR  ali  17  23.RLPDGEFAILKIIWHLPPTTSAQIMEKLGEDNHWKPQTLLTVLARLTEKGFLESVRKGRERQYTALISEEEYLEVETSDFLKRYSGHSMGGFVKTLFSSNSFSENELDELRNLLNQKE. 141
476 3.000e-32UniRef50_F4KT41 Transcriptional repressor, CopY family n=2 Tax=Bacteroidetes TaxID=976 RepID=F4KT41_HALH1  ali  20  13.EPTKSELEILQVLWQCGPSTVRYVNEKLNEQREVNYSSTLKLMQIMIDKGLLQRDVDDRSHVYRPADNPEKVQNQVVKGLRDLAFGGSTSSLVMRALGSGSATPDELEEIKRLIEDMQ. 130
477 3.000e-32UniRef50_A0A1G6S557 Predicted transcriptional regulator n=25 Tax=Bacteroidetes TaxID=976 RepID=A0A1G6S557_9BACT  ali  20  3.ELSNQEETIMRILWSLGQGLVRDVLNEMEEPKP-PYTTLASTIRLLESKGYLTHKLYGNTHMYIPLVSKEEYSKKSINYMVKNFFEGSVGNFLSFMVKEKNISKKEVIELEKMIDDYE. 119
478 3.000e-32UniRef50_A0A2S8FQC1 Transcriptional regulator n=1 Tax=Blastopirellula marina TaxID=124 RepID=A0A2S8FQC1_9PLAN  ali  19  7VQPTAVELEILNVLWEHGPCPLGEIHQQLTANGERAYSTTRKMVQVMRDKGLIVCDDSSRPQQYSAAEPKDQTQLSLLEDIVDRAFGGSTQNMLMSLLSAKRLTPDELTEMQRLVDEAK. 125
479 3.000e-32UniRef50_R7L2R3 Transcriptional repressor CopY family n=2 Tax=environmental samples TaxID=2231195 RepID=R7L2R3_9FIRM  ali  27  4.NLTEAESAIMKKIWENSPVTSSVLMGYFSEERGWKSQTVSTFLSRLVKKGFLSVKRCGAANEYTAVISESAYEQAGAREVIDRLYNGSVKNMIASLADCGAISDEEMDELKNWFSKR.. 121
480 3.000e-32UniRef50_A0A1R0X290 Transcriptional regulator n=6 Tax=Bacillales TaxID=1385 RepID=A0A1R0X290_9BACL  ali  20  3.KLPDAEFDIMKVVWANDPITTNVIMQQLGNDRKWKAQTVISLMLRLVERGFIRTEKKGKERTYFPLINKEEYLKFETGDFMERFHANSFVSLVATLYASNKVKDSDLDQLENWLKDKRE 122
481 3.000e-32UniRef50_Q8CWY7 Negative transcriptional regulator, CopY n=40 Tax=Streptococcus TaxID=1301 RepID=Q8CWY7_STRMU  ali  26  4..ISNAEWEVMRVVWAKQMTSSSEIIAILSRTYCWSASTIKTLITRLSEKGYLTSQRQGRKYIYSSLISEEEALEQQVSEVFSRICVTKHQALIRHLIEETPMTLSDIEKLEALLLSKK. 120
482 3.000e-32UniRef50_A0A0S8JW11 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A0S8JW11_9BACE  ali  19  8VTLTKAEERIMQILWDLGKGFIKDIQEHFPDPKP-PYNTISTIVRVLVRKEIISYKTYGGSYQYYPLISREQYRTDQMGKLMKNYFGNSLKEVVHFFSEKKDIDLEELDETLRMLEELR. 125
483 3.000e-32UniRef50_A0A1U7GCJ0 Uncharacterized protein n=2 Tax=Planctomycetes TaxID=203682 RepID=A0A1U7GCJ0_9BACT  ali  17  1..........MNIVWDRGEVTVGEAWKILSERRPVARNTVQTMITRLAEKGWLRARDDGQAARYSAAQPRGRAMGSMVSRIVETAFRGSAEGLVMALVEGRGVSKEEADRIRAILKKAEE 110
484 3.000e-32UniRef50_A0A2E0SNF4 BlaI family transcriptional regulator n=1 Tax=Planctomyces sp. TaxID=37635 RepID=A0A2E0SNF4_9PLAN  ali  23  5VHLADLQLAIMQVLWDREEATVADVREALDEGRKLAYTTVATMLTKLEKSGHVAREAKGRVLSYRPTLRREQVSRSMVTDLAQKLFRGDLETMVSHLLEGCDVDQEELTRLKKLIRQKE. 124
485 3.000e-32UniRef50_A0A0S2DCP6 Transcriptional regulator, BlaI/MecI/CopY family n=49 Tax=Proteobacteria TaxID=1224 RepID=A0A0S2DCP6_LYSEN  ali  51  1MQISEAESVVMEVLWQRHPLAAEEVAAAVADAQSWQEATVKTLLNRLLNKGAIRAEKDGRRYLYAPVLKREDWLLDESQGLLQRLFGGRVAPLVAHFSQHRKLSRKDIAELRKLLEELDD 120
486 3.000e-32UniRef50_A0A0P9FL23 Transcriptional regulator BlaI n=3 Tax=Pseudoalteromonas TaxID=53246 RepID=A0A0P9FL23_9GAMM  ali  17  8..PTSAELNILNVLWRIQPATVRTLHEHISESQKIGYTTVLKMLQIMHEKGLVTRDESTRAHVYSAAYSVEHTQSSLLSDIVNKAFGGSRFDLVMRALGDEKASTKEINEIRTLLDSLE. 124
487 3.000e-32UniRef50_A0A1P8WK63 Regulatory protein BlaI n=7 Tax=Planctomycetaceae TaxID=126 RepID=A0A1P8WK63_9PLAN  ali  22  8.HPTELELEILKVLWHESPLLVRDVRARLEEDRPLAHSSVITMLNIMHRKGFLNRRKEGKSFLFWPKVPKERVMGGMMSDLLSRLFEGSPSAMVLNLLETADVDLEELAEIRKLIARK.. 126
488 3.000e-32UniRef50_Q3AAB7 Uncharacterized protein n=2 Tax=Carboxydothermus TaxID=129957 RepID=Q3AAB7_CARHZ  ali  22  19..LGELEARVMEIIWDLGEATVKDVHQIINQEKKLAYTTILTIMGRLADKGLLIKKSIGLAHSYTPAVSREEFYNKVAETVVDGLFEEFAEPAFTHFLKKVENDPQKLAELEKMLLKIKE 136
489 4.000e-32UniRef50_A0A1V4SQ99 Methicillin resistance regulatory protein MecI n=7 Tax=Clostridiales TaxID=186802 RepID=A0A1V4SQ99_CLOHU  ali  27  4IKLFDSEIKIMELLWDNGPTSAKNLSVMAQDRTGWNKNTTYTIIKKLIEKNAVKREE--PNFVCIPLITREQVQLAETSNLINKLYKGSKKLFFASFIQNENLSKEEIEELRRIIEK... 118
490 4.000e-32UniRef50_UPI00037EA3EA BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Acidobacteriaceae bacterium KBS 83 TaxID=1267533 RepID=UPI00037EA3EA :  ali  25  1..MTPLELKIMQVLWRLGPCQVQMVQQELEG--GLAYTTVQTMLNVLERKGRVTRRLRGRAFEYRAAVTEEKTLGTAVADLVDRMFGGSPEELVMSLVNSRQLDAGRLAKLAERVDAAK. 115
491 4.000e-32UniRef50_R5IK74 Putative transcriptional regulator n=2 Tax=environmental samples TaxID=2231195 RepID=R5IK74_9FIRM  ali  22  4LRLSDGEWKLMKTLWQRPGQTLAELVSALDADTGWSRATIFMMLKRLIAKGAVTMDDSGKFQTYSASVAYADVEPEETESFLSKVYGGSVGMMVSNLVDRGALSEQEIQELKAILDAAE. 122
492 4.000e-32UniRef50_R6DXS8 Transcriptional repressor CopY family n=1 Tax=Firmicutes bacterium CAG:238 TaxID=1263011 RepID=R6DXS8_9FIRM  ali  27  5ISISDAEWTIMKALWQSEKMTLKEIAEAVADA-GWSYTTVRTMVGRLVEKEVITADESHKSFRYSAAVSEEACRKEEMKSFINRIFDGSAKLMVSSLVSGKNLSKEEQQTLLEIIDKME. 125
493 4.000e-32UniRef50_A0A2N4S9X6 Transcriptional regulator n=32 Tax=Bacteroidetes TaxID=976 RepID=A0A2N4S9X6_9BACT  ali  23  3.RLTPQEEAVMLHVWQLGECAIKDVVDRMEEPKP-PYTTVASIFKNLESKNYLTMKRYGNVKVFRPKVTEAAYKQHFLSSVVKSYFDNSYKELVSFFAKEQKITKDELEEIIRLIEKNQE 120
494 4.000e-32UniRef50_A0A0P1FNL9 Regulatory protein BlaI n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A0P1FNL9_9RHOB  ali  27  9..LTDVELELMIALWQIGSGSVREVMAALSGESKRAYTSVATIMKILDDKGYVTSERQDRSLIYTPTVKRSEYEGKSLKNLSDSLFGGTPTALVARLVDNEDLTDEMIQEIKAIIE.... 122
495 5.000e-32UniRef50_S7X2V5 Transcriptional regulator, MecI family n=11 Tax=Flavobacteriaceae TaxID=49546 RepID=S7X2V5_9FLAO  ali  24  1MQLSKTEEQLMQHLWKLEKAFMKDLLDIYPEPKP-ATTTIATLLKRMIGKGFVDYKTHGKSREYFPLVKKEDYFSKHVNGLIKTFFNDSASQFASFFTRKTDLTTEELEALKKIID.... 115
496 5.000e-32UniRef50_A6DQC3 Penicillinase repressor n=1 Tax=Lentisphaera araneosa HTCC2155 TaxID=313628 RepID=A6DQC3_9BACT  ali  30  1MSISNSETVVMQVIWSSNELSSKEIVLLLSDKVDWSPKTIRTLLGRLVKKDFLGVVKKASSYSYFAKVSEDEFLADLSHGILDKFFGGALKPMLVHFADSKRISKTEADLLRKILDE... 118
497 5.000e-32UniRef50_UPI0008F84273 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Angelakisella massiliensis TaxID=1871018 RepID=UPI0008F84273  ali  23  7.KLSDSELEIMLAVWDAGPITGSEILQQIRQKRTWALSTLMTVLARLVEKGYLACDRSTRNNLYSPLVEEEEYKEEESRSFLHRMYGNSLPSLISCLYKSGAIGDKDLEELQDFLDQAQ. 125
498 5.000e-32UniRef50_A0A0A2E0Z1 Uncharacterized protein n=4 Tax=Porphyromonas macacae TaxID=28115 RepID=A0A0A2E0Z1_9PORP  ali  18  5IRLTPREEEVMRIMWSMGEAEVRMIIPHLPDP-EIPYTTVASIMHNLEKKEFIRKVGKGRGYIYRVAIPEEDYSKLSLNRMVNQFFTGDYKSLVQSFAEESKITADDLREIIQLIEQ... 120
499 5.000e-32UniRef50_A0A2W5EZK1 Transcriptional regulator n=1 Tax=Pseudopedobacter saltans TaxID=151895 RepID=A0A2W5EZK1_9SPHI  ali  16  9.KPSEGELEILQILWKRKAATVREVYEEISQTKECAYTTTLKLMQIMHEKQLVTRDNSQKTHTYMPNVSKERTQRQILGKMIHTLFSGSTSQMVLQALGNEKPSNDEIEQIQEMLDKLK. 126
500 5.000e-32UniRef50_A0A1P8Q353 Uracil phosphoribosyltransferase n=17 Tax=Lactobacillales TaxID=186826 RepID=A0A1P8Q353_9LACO  ali  21  6.NMTKAEWQVMRIIWTLGESTSKQVIDVLEKKTDWKQATIKTLIVRLHEKEFLKADVSSRPYVYHPEISEDDAIDQTVNNLFDNLCCMKKGEAIGDLIGSSDISKNEIQGLIEKLENKK. 123
501 5.000e-32UniRef50_A0A174VDK1 CopY family transcriptional regulator n=18 Tax=Clostridia TaxID=186801 RepID=A0A174VDK1_9FIRM  ali  32  11.RLPDAELEVMQALWRQEPVSSAALMEELAGRR-WQTATLLKLLSRLEERGFVKREKEGRNNLYTPLVRREDYLSAESRAFLQRLHGGSLPSLVAALMDSRAISRRDLEELEEILR.... 126
502 5.000e-32UniRef50_UPI000DE8E3CC BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Roseimicrobium gellanilyticum TaxID=748857 RepID=UPI000DE8E3CC  ali  27  7.RLSPAESEIMRHLWDLQEVRVNELLDACNAERDITRNTLLVQLERLEAKGWVKRSRDQRAHVFMPAVPRKEGLRHATREFLDRFFGGALTPLLAHCVDEEKLGKKEISDLRALLDEAE. 126
503 6.000e-32UniRef50_R9MR89 Uncharacterized protein n=7 Tax=Clostridiales TaxID=186802 RepID=R9MR89_9FIRM  ali  24  6IKLSEAEWKVMKLLWEESPKTMMQITNLLKETTGWTKHTVMTFLKRMEEKEAIHYEEGGRAKLYYPDIKKEEVVLQETEEFLHKVFDGRMGLMLNTMVEKKVLSKSEIDELYDIL..... 120
504 6.000e-32UniRef50_A0A1G9XJW1 Predicted transcriptional regulator n=1 Tax=Siphonobacter aquaeclarae TaxID=563176 RepID=A0A1G9XJW1_9BACT  ali  24  3.ELTKTEERIMLAVWELDPFFVKDLVERMPEKPP--YNTVSSVVRILENKGFLGYKAYGRTYEYFASISKEEYRKNGLRRLLDGYFDSSAVSLLSFMAKEEQISPEQLDALRKLID.... 116
505 6.000e-32UniRef50_W0U3G3 Penicillinase repressor n=5 Tax=Ruminococcus TaxID=1263 RepID=W0U3G3_9FIRM  ali  18  7.KLPDAEFEIMKTIWSSEPVTSSQIAEKMSD-HNWKLPTLISFLKRLIEKGFLRTEKTGKERQYYSLVSQSDYLKFETENFFGSVHNNSLSSLVTNLYETDKLSSQDIDELIRFLEEVKD 125
506 6.000e-32UniRef50_A0A1E3UL83 Penicillinase repressor n=63 Tax=Bacteria TaxID=2 RepID=A0A1E3UL83_9FIRM  ali  18  6.KLPDAEFDIMKVVWANEPVTTNIIMEQLGTEKSWKAQTVISLMLRLAERGFLSTDKRGKERIYYPLISKDEYLKFETSNFMKQYHDNSFLDLVNTLYEDKALTDKDIDELLQWAKKRRD 125
507 6.000e-32UniRef50_A0A1E3AFR5 Penicillinase repressor n=14 Tax=Clostridiales TaxID=186802 RepID=A0A1E3AFR5_9FIRM  ali  19  3.KLPDAELELMMIIWDEGPVTRMEIEERMDEGREVLPSTILSLLSRLEERGFVEREKRGKINYYSARVEKEPYLKETGRHILKRMFGGSISNFATALYDGEELSDEDIACLQDFIDSK.. 120
508 6.000e-32UniRef50_A0A142Y1S5 Penicillinase repressor n=11 Tax=Planctomycetales TaxID=112 RepID=A0A142Y1S5_9PLAN  ali  21  8.ELTERELEIMHIFWDKGELTAPQVRDHLASTRNLAYTTVATLIKILHEKDFLTQTGDQRPYSFKPSRPFEDVSKSMVGDLLERLFGGSREQLVLRLFDSGKLTRKEREALERVLKENK. 126
509 6.000e-32UniRef50_D0R6D0 CopAB ATPase metal-fist type repressor n=14 Tax=Lactobacillus johnsonii TaxID=33959 RepID=D0R6D0_LACJF  ali  24  9..ISDSEWEVMRIVWTLGETNTKQILNELQAKKDWTDSTIKTLIRRLVQKGWLNAKQDGRRYIYAATVNQTDMMYNEAKTLLNRMCDMHKGEVILKLLEDSPVSKGDLIKMKKEISQKE. 125
510 6.000e-32UniRef50_F5J3Z4 Uncharacterized protein n=25 Tax=Bacteroidetes TaxID=976 RepID=F5J3Z4_9BACT  ali  20  1MQLTKAEEQIMQILWTMEEGTVQDILKGFTDNKP-ARTTIATVLTILEGKDFVSHRSEGRVNIYKALISKENYSKKQLFGFVKDYFNGSFSSMVSFFAKETNLS................ 103
511 7.000e-32UniRef50_A0A1V4IL27 Penicillinase repressor n=1 Tax=Clostridium oryzae TaxID=1450648 RepID=A0A1V4IL27_9CLOT  ali  25  3.RLPEAEFQVMKAIWTYEPVTSSMVMGHLSREKSWPIQSVVTLLSRLVEKEFLRSEKKGRERLYYPLVSKKDYLQFETRNFVKQYHENSFISLLSALDQDKKLTDEDLDNLQEWIRKRR. 121
512 7.000e-32UniRef50_A0A0Q0V1U7 Transcriptional regulator n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A0Q0V1U7_9SPHI  ali  22  4.RLSEKEEVIMHIIWTKGQIFAKEVREALPEPKPH-ISTVSTMMRRLAEKGFLAIEDFGSTHRYSATIGMKDYTTRFVQPLLAGLFGNSIKNAISFFAEQEQVSVEELREIMEMIEKRK. 120
513 7.000e-32UniRef50_D5EWH7 Transcriptional regulator, BlaI/MecI/CopY family n=5 Tax=Prevotella TaxID=838 RepID=D5EWH7_PRER2  ali  23  6.QLTKAETQVMNILWSLPESKSAEIMEKFPEPKP-ALTTLLTFLKILKEKGFVSSEKIGKAQLFSTTISKEDYTRAYMKEVKNTFFGGSFASLVSFFAKDEQLSDDEVSEIMEIIKNRK. 124
514 8.000e-32UniRef50_A0A2V1ISA0 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Muribaculaceae bacterium DSM 103720 TaxID=2094237 RepID=A0A2V1ISA0_9BACT  ali  18  10..LTEKELVIMRMLWEHGPMFVREMLEIYPEPKPH-FNTVSTIVRILEDKGHVGHEVVAASHRYYAVARQEDFRKKSLARLVSDYFNNSYKNAVSALVEEEKISLDELREIIDLVERK.. 124
515 8.000e-32UniRef50_A0A1Y4WGW4 CopY family transcriptional regulator n=4 Tax=unclassified Clostridiales TaxID=186813 RepID=A0A1Y4WGW4_9FIRM  ali  28  7.KLPDAELEVMQALWALDPAHTSDLSARLS--KDWKAPTLLKLLSRLEERGFVRAEKQGRANLYTPLVQEQDYLQAESRSFLSRLHHGSLSSLVASLYPDANLSQEDIQALERIL..... 120
516 8.000e-32UniRef50_Q7TU00 Probable Penicillinase repressor n=20 Tax=Planctomycetaceae TaxID=126 RepID=Q7TU00_RHOBA  ali  22  9..LTESQREVMEVFWKHGEATVSEVREYLAGGRHVARNTVQTTIVRLEAKGWAKHRECGRTFVYSAAQPKTRSLGVKVAQMVDRFFAGSPEDMVTALIEYRGLTEEEATRITAMIDEAAE 127
517 8.000e-32UniRef50_A0A1Q3MKX1 Transcriptional regulator n=1 Tax=Armatimonadetes bacterium 55-13 TaxID=1895717 RepID=A0A1Q3MKX1_9BACT  ali  23  10..PTQAELEILNHLWERGPSTVKDLHEEVKKTSEVGYTTVLKFLQIMLTKGLVTRNEDERPHVYQAKASSEESKTNLLKDMVERAFGGSTKALLMHALGTQSVSSEELAEIRKEIEAME. 126
518 8.000e-32UniRef50_A0A1G2YA71 Uncharacterized protein n=2 Tax=PVC group TaxID=1783257 RepID=A0A1G2YA71_9BACT  ali  24  6LELFESEWMILQKVWDMEPCAAPTVQEALQSQKGWAYTTVKTMMDRMVKKGLLKAEKIRNLYLYRSIITRHCACKNEIARTLKRAFDGTFTPMMQFLIENDQLSDEEYHQLEHLIKQRK. 124
519 8.000e-32UniRef50_I3ZD97 Putative transcriptional regulator n=5 Tax=Acidobacteria TaxID=57723 RepID=I3ZD97_TERRK  ali  24  15..LTPLELEIMQVLWSAGPSTASEVVPQLAG--NLAYNTVQTMLQVLLRKGRVKRVAEGRAYRYRATVTRERAAGSAISDLVKRMFGGSAEAMLLAMVDAGQV................. 113
520 8.000e-32UniRef50_A0A0K9YRX3 CopY family transcriptional regulator n=16 Tax=Firmicutes TaxID=1239 RepID=A0A0K9YRX3_9BACL  ali  22  6.RMSEAEKQIMDIIWAVGPITTAEILTILPEDKAWKQNTVITFLARLMEKEMIKAVRSGKANFYEPRISEADYQKLETKRFVKEVHRGSVSGLISALCDSEDLTKEDIEELMNKLRAQAE 125
521 9.000e-32UniRef50_K5YU77 Uncharacterized protein n=3 Tax=Parabacteroides TaxID=375288 RepID=K5YU77_9BACT  ali  18  133.RLTAREEEIMGYFWTKGPLFVKQLLEFYDEPRPH-FNTLSTIVRGLEDKGFLAHHTFGNTYQYYAAVTEADYSRGTLKNVIAKYFNNSYLGVISSLVKEEEISVEELKELIESIDNGK. 249
522 9.000e-32UniRef50_UPI0009FE5871 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Mariniblastus fucicola TaxID=980251 RepID=UPI0009FE5871  ali  23  7..LSKGEMEIARALWAIGPATVREIHEYLSESKPIDFSTVQTYLRRIESKGYASSKLKGRVRTYSSKTKPGTVIRETVDDLVDRLFGGEAMPLVRHLVEDRGIDAEQLAELRELIDRLE. 123
523 9.000e-32UniRef50_A0A2E9WM82 Transcriptional regulator n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E9WM82_9PLAN  ali  29  12..PTPAEWKILHIVQESAPCAAREVVAVATEAFGWSPSTIKTLLRRLVAKGHLKTKRVGNLFVYAPTRSAVKMLCNEAEGLLSHAVDDAVGPLLAFMVERSRLSKSDVDELRSLLDEKE. 128
524 9.000e-32UniRef50_A0A1C0BR09 CopY family transcriptional regulator n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1C0BR09_9CLOT  ali  23  6.KLPGAELKVMQAVWSCAPVTTARVREILGREKPWSVSALQTLLNRLIARGFLSSGRQGRNRCYTPLIGEKEYLADENRSILEKLNGNSVTRLVASLYDSHSITPEDLEELRAFLDER.. 124
525 9.000e-32UniRef50_A0A1E3UP84 Penicillinase repressor n=4 Tax=Lachnospiraceae TaxID=186803 RepID=A0A1E3UP84_9FIRM  ali  23  4.QVSDSELELMKIIWENGGMALANIMEKLAQTRTWQKNTVTTLLSRLVEKGLLKTNKIGRRNEYTAIVSEEDYQADQMKCFLDKLYEGNAKGLVSTLIQREMLSPEDYEELKKFWEK... 121
526 9.000e-32UniRef50_A0A2V9BVP2 Uncharacterized protein n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9BVP2_9BACT  ali  17  20..LAPLELDCMNTLWPLGEGTVRQIQQCLAPYRPRAYTTIMTILDRLAHKGIVTRRKVGRAYLYRPNLSAQEARAHAVEQVVESFFAGSPEALAAHLAG..................... 116
527 9.000e-32UniRef50_A0A2D0N5J9 CopY family transcriptional regulator n=1 Tax=Lewinella nigricans DSM 23189 = NBRC 102662 TaxID=1122177 RepID=A0A2D0N5J9_9BACT :_  ali  23  8.QLSRRERQIMDLFFQHGELSAQAVQEQLPDAPG--YATVRSLLRILEEKGHLSHSKSGRQFIYRPVAGVEKVKHQRLNHLLRTFFGGSISEAVAAFIQDNDLRPEELEELDKIIREARD 126
528 9.000e-32UniRef50_A0A1X1FDT5 Transcriptional repressor CopY n=142 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1X1FDT5_9LACO  ali  26  7VTITDSEWEVMRAIWTMGQPTSRELIDAMAELQGWSDSTTKTLLHRLIKKEAVEQVGDTRPYTFEPVVGEKESMSAAADDLFDHMCAMRAGSTIAQVIKTRELSKKDIAELQRILAEKE. 125
529 9.000e-32UniRef50_A0A0Q0IEX7 Penicillinase repressor n=35 Tax=root TaxID=1 RepID=A0A0Q0IEX7_9GAMM  ali  25  1MKLSDFEMDIMQLLWQEEPCTASQLHKVLQKDKQVAYTTVKTIVDRLEHKGAIERCHEGRAIVFRTIVTQDALSEQAMPSFMQRFFKGNSRSLIAHFIKEEKLNDEDIEYLQTLLKNKK. 124
530 9.000e-32UniRef50_A0A0S3KE95 Penicillinase repressor n=12 Tax=Enterococcus TaxID=1350 RepID=A0A0S3KE95_9ENTE  ali  25  8.HITDAEWEIMRIVWTQGETTSKEVQQLLNQKTEWKTTTVKTLLARLVEKKLLSTEKLGNKFIYRSLIEEKSGIQLETDELLGKICAKEVGAVLKTIIDESVLSVEDIEQLEKALQKKK. 125
531 9.000e-32UniRef50_A0A1Y4I9G8 Uncharacterized protein n=1 Tax=Lachnoclostridium sp. An196 TaxID=1965583 RepID=A0A1Y4I9G8_9FIRM  ali  27  8...SDAELEILEVLWTAGPLNTAQIRSMLEENKSWERTTVLTLIQRLVKKGMLHQEKRE-VYYYSPAVSREAYVKEETKNFVNKFFHGRSGNMAAALMADDDLTKEDIKELRDFFNSR.. 122
532 1.000e-31UniRef50_A0A1E3AF84 Penicillinase repressor n=40 Tax=Clostridiales TaxID=186802 RepID=A0A1E3AF84_9FIRM  ali  28  4.QISDGELDIMKIIWANGPALFAHIMDALAAKKTWQKNTVIMLLSRLKDKGYLKAKKTGRRNEYIPLVSETEYQTFQTKKLLDKVYEGNVKGLVSNLIQSDLLTGEEYRELKKLLD.... 120
533 1.000e-31UniRef50_A0A2U1F765 Putative transcriptional regulator n=1 Tax=Porphyromonas loveana TaxID=1884669 RepID=A0A2U1F765_9PORP  ali  21  28.RLTAIEEDTMNVIWQLGTCSIRQVLAEVPEPKP-PYTTLASVFKNLERKHYIKPYRDGKTYVYRIGITKEEYAARTVHRMVDNYFTGSYKHLVQFFAAGSDISTKDLQEIIRMIEQGE. 144
534 1.000e-31UniRef50_A0A1M7YJP9 Predicted transcriptional regulator n=4 Tax=Lachnospiraceae TaxID=186803 RepID=A0A1M7YJP9_9FIRM  ali  26  26.RLPETEFEVMSVVWRNPPVTTAALMNQLGNEKGWKLQTLVTLLNRLTERGFLRSEKLGKERTYYPCVKQEDYIQYETALFVERYHHNSLFQLVNAFSGNNKLSKDEINELSSWLKNQKD 145
535 1.000e-31UniRef50_A0A094IJY0 BlaI family transcriptional regulator n=1 Tax=Idiomarina atlantica TaxID=1517416 RepID=A0A094IJY0_9GAMM  ali  26  1MSLSDFELEVMQLLWELEEATAPQLHKLIAQRRPVKYTTVKTIIDRLEKKAALQRRTEGRTIFYAPLTVKKDVRGSLLKDFINKVFLGKSQPLAAHILEEEELSIDDIEYLEKLLKERKQ 121
536 1.000e-31UniRef50_A0A1C7I5U1 BlaI family transcriptional regulator n=4 Tax=Clostridiales TaxID=186802 RepID=A0A1C7I5U1_9FIRM  ali  30  3VKLFDSELKVMDLLWEKGEISAREIAMCLKEQVGWSKTTTYTVIKKCIDKGAI--ERIEPNFICRPLVTIEETREFETQELIDKMYDGSPDLLVASILGSRKLKREDIERLKKLVEDLR. 119
537 1.000e-31UniRef50_A0A1I5BF38 Predicted transcriptional regulator n=5 Tax=Clostridiales TaxID=186802 RepID=A0A1I5BF38_9CLOT  ali  29  5.KLFEAEYNLMDIIWSHEPINSTELVKKAEESLGWKKSTTYTVLRKLVHKGFLRNEEA----TVSALVSREDALYAESKDFLDRFFQGSLPSFLASFTGEGKLSEKELAEIRKMMEE... 116
538 1.000e-31UniRef50_UPI000839C081 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Paenibacillus phocaensis TaxID=1776378 RepID=UPI000839C081  ali  31  8..ISPAELVVMKVLWKEGKCTASVIIDIVSKEADWHFRTIKTLLRNLVRKGYQVDEHDSRIYYYFPLIEEEAYLRRERQQFLDLYYDGNRHSLLAGFLQDGGLSPREADMLKQMLTRNDE 128
539 1.000e-31UniRef50_A0A142YFR2 Penicillinase repressor n=4 Tax=Planctomycetales TaxID=112 RepID=A0A142YFR2_9PLAN  ali  30  8..IPDSELDVLKVLWERGQATVREALETLKAAREWSYATVATLLDRLETKGLVESDRKELAFVYRPTISSQEVRRRRVSSLVDKLYEGEPGLLVLHLLKSHPLDPGQAMEVREVLDQM.. 124
540 1.000e-31UniRef50_A0A142YG71 Transcriptional regulator BlaI n=3 Tax=Planctomycetes TaxID=203682 RepID=A0A142YG71_9PLAN  ali  20  8.QPTDAELAILQVLWEGGPSGLGKVHEALRATRPVALTTVATTLKVMLTKKLVRRDDGPKGYVWAAETTRGAAASGLLGKLVRNVFDGSARGLVAHLIEQGDLDDRDREAIRALLDQADD 126
541 1.000e-31UniRef50_A0A068NYS2 Transcriptional regulator n=1 Tax=Fimbriimonas ginsengisoli Gsoil 348 TaxID=661478 RepID=A0A068NYS2_9BACT  ali  20  5..LGDHELDLLRFVADHEPCTVRQVSDSYGAAAGLARTTVLTVMERLRGKGYLVRSNGEGAFLYRAAESKGEVMRDVVGQFVRRTLGGSVSPFVAFLAESDQLSDEEIQQLRDLIKRFE. 121
542 1.000e-31UniRef50_R6PU89 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=R6PU89_9CLOT  ali  24  3.KISESEQEIMMAIWNAESITASYLEEVFGEKKGWKKTSILTFLSRLVEKGYLSCEKNGKSNFYEPIVSYEEFSRRESKHILDKLYRNSLKNFVVSLYDGDELSRQDVKELREFLDE... 121
543 1.000e-31UniRef50_A0A1Y4EKY0 Uncharacterized protein n=4 Tax=Clostridia TaxID=186801 RepID=A0A1Y4EKY0_9FIRM  ali  24  6.RLSESELDVMLVVWRAQEADTGEVARRL--QKGWKIQAVQVVLGRLVKKGYLSCEKIGRLNYYIPLVAEADYRAAETETFVEKLYRNSPKSLIAALVQSQPLSKEDLEEIRALLDRGEE 123
544 1.000e-31UniRef50_L0DAR7 Putative transcriptional regulator n=1 Tax=Singulisphaera acidiphila (strain ATCC BAA-1392 / DSM 18658 / VKM B-2454 / MOB10) TaxID=88  ali  26  9..LTPAEWKVMKVVWRRKECAARDVYEETRRTYDWAPSTAKSVLRRLVDKGYLTTTQVGNCYVYRPASSALQALLGVADALLETVLEGTTGVVLTHLVKNSRLSADELADLRALLDN... 123
545 1.000e-31UniRef50_S0JLW5 CopY/TcrY family copper transport repressor n=11 Tax=Bacilli TaxID=91061 RepID=S0JLW5_9ENTE  ali  21  8VKISDSEWEVMRVIWNNDQIDAATINELLSESKGWKIATIKTLLGRLVKKDVLHTEREGKKFLYSAKVSEAETVRSATENLFSHICARKAGQTIADLIAEVELTANDIQAIQEELAQKQ. 126
546 1.000e-31UniRef50_UPI0009846BC6 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Marinicella sediminis TaxID=1792834 RepID=UPI0009846BC6  ali  17  6.KPTKTELAILNVMWQISPATVRQIHEEIIKNGKTSYTTTLKMLQVMHQKGLVSRNSEQKAHIYEPAMSKKETQKQMLDDLKNRLFGGSISSLVLQALGNETTTQSELDEIKALLEKVEE 125
547 1.000e-31UniRef50_A0A037ZB14 CopY family transcriptional regulator n=4 Tax=Clostridium TaxID=1485 RepID=A0A037ZB14_CLOTT  ali  30  5.NISESEWKVMTCLWKEPNLTLKQISQNLKDTK-WSYSTIRTLVTRLMEKGAIDADKSSSSFKYFPIVQEKECKVQETKNFLTRVFNGSVSMMISTLAKQEELSPKEVAELKEIIESMD. 122
548 1.000e-31UniRef50_UPI0004BB944B BlaI/MecI/CopY family transcriptional regulator n=2 Tax=Dyadobacter TaxID=120831 RepID=UPI0004BB944B  ali  19  3IRPTDAELEILNCLWSQGPLTVRQVHTLLAATKEVGYTTTLKLMQIMHDKGLLYRTEKGRSHIYVALLGQQETQEHLVSRLLQTAFQGSAASAIEVILKTNRFSISELKQLQSQVEA... 119
549 1.000e-31UniRef50_U6ETA0 Negative transcriptional regulator-copper transport operon n=8 Tax=Bacilli TaxID=91061 RepID=U6ETA0_LACLL  ali  20  34..ISDSELVVMRIVWSLGATTADQIYSKLDKTYQWAPSTIKTFLARLVKKGLLTNQRVSRKYVYQATCTEDEAIAQMAQDFLHKICARKHTNVILEMIDASNFTEDDKVAIDDKIAEK.. 149
550 1.000e-31UniRef50_A0A101VX16 Transcriptional regulator n=2 Tax=Clostridiales TaxID=186802 RepID=A0A101VX16_9FIRM  ali  32  6.NIAEAEWDVMKICRLKPPCTANEIYASLQDSTDWKPNTVKTLITYLVKKQALCLKQEHRVY-YYPLVSQAACVRSETKSFVNQVFGGAAQPILVTFLQEETLSRSEIEELKKILEEKE. 123
551 1.000e-31UniRef50_A0A1F8QKA1 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_16_57_8 TaxID=1797652 RepID=A0A1F8QKA1_9CHLR  ali  18  20..LGPLEAEIMDVVWSCGNSTVRDIHRLLSKRREIAYTTVMTIMGNLTKKGVLRCARQDRAYVYSPAVTREQFTRAKIAQIVDTMLRRFSEPAMTYLVNRAQVDPQKLTELEEAISELR. 137
552 1.000e-31UniRef50_UPI0003435CCA CopY/TcrY family copper transport repressor n=1 Tax=Lactobacillus paracasei TaxID=1597 RepID=UPI0003435CCA  ali  19  5.EMSRAEWEVMRVIWTEGGADTNDIIEVLRAKQNWSDSTTKTLLRRLVGKQALTTVKVGRQFHYSPLIKEQETMQQNANEFFDRMCEMKQGSVLVDLLKNLNLSKPDIETMQAVLADRHD 123
553 1.000e-31UniRef50_A0A2V7JUC8 BlaI family transcriptional regulator n=3 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7JUC8_9BACT  ali  20  4LRLTQRELDIMSVLWELGEATVYEVRDRI--DPDLAYTSVSSMIRMLEIKGYVSHRREGKTHVYFPVIAAEAAGETALRRVLNKIYGGSPIKLLAHLVQQKRLSEKELARMRELLKK... 119
554 1.000e-31UniRef50_UPI00034C5925 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Nafulsella turpanensis TaxID=1265690 RepID=UPI00034C5925  ali  17  1MKLATREEQIMQAFWELKKAFIRDIIPLLPDPKPH-YNSVATMVKILEEKGFLALEMIGNMKCYYPVVAREDYQKHTMKDIVSQYFGNSYPKMLAFFAKEENLSEEDL............ 107
555 1.000e-31UniRef50_A0A0Q7WP95 Uncharacterized protein n=3 Tax=Burkholderiales TaxID=80840 RepID=A0A0Q7WP95_9BURK  ali  25  8VSLSEMQLSVMRVLWSKQSATVAEVVAALRGTRLLAHTTVATVLNRLEKRQLVESWRDGRQLVFRALASEEQVQRSMVTGLVSNLFSGSAGELMSYLLRSKDVDSDDLAKIRAMLD.... 123
556 1.000e-31UniRef50_X0SNQ5 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=X0SNQ5_9ZZZZ  ali  22  12..PTELELEILKVLWRIGPAPVRVVRDELVGFRVLAYTSVMTILNIMVNKGYLTRKKDGASFRYRTKIRQKSTTWRMLWDLVDRAFDGSASAAMVNLLEAGELGDDEIASIRKLLD.... 125
557 1.000e-31UniRef50_A0A1V6B3I1 Penicillinase repressor n=3 Tax=unclassified Aminicenantes TaxID=910038 RepID=A0A1V6B3I1_9BACT  ali  17  7..LSRRERQIMDVIYELKEATVLQVLERLPDPPG--YSAVRALIRVLERKGHLTHRRDGPRYVYSPLVAKEKARRNALRHVIRTFFDGSTESVMAALLDEKNLSEDDYVRLRELIDKAR. 123
558 1.000e-31UniRef50_A0A2E2CAB0 Transcriptional regulator n=1 Tax=Gimesia sp. TaxID=2024833 RepID=A0A2E2CAB0_9PLAN  ali  31  45LQITEAEWEVMLSVWEAVDQTPGEIIARVESVRKRSHRTIRTLLARLVEKGAVNVRVEGSRHLYRAAVTRNECVRSAARSFSERFFAGDLQSLLLHFVENETLTSDEIAELKQSLEER.. 162
559 1.000e-31UniRef50_A0A2V8N9T6 MarR family transcriptional regulator n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8N9T6_9BACT  ali  24  10...TDKELDIMKVIWEQDEASAREIQARLPGNQ--HYNTVLTIIRVLERKGHLTHRAEGKSHIYRAVHRPAKSRGRVLGHLIEQVFGGSPASLVLHLVETGSLTEADLRKARELLA.... 120
560 2.000e-31UniRef50_R9N1A1 Uncharacterized protein n=2 Tax=Lachnospiraceae bacterium 10-1 TaxID=1235800 RepID=R9N1A1_9FIRM  ali  24  5INLNNSEWYIMEVLWENQPKTLMQIAREMKEKQGWSKSTTNTMLRRMQEKGFIRYEEGEKARKYFTDILREKVVLKETESFLKRTYGGSLGMLVNTFVENDSLTDKEIKELQEILHKAE. 123
561 2.000e-31UniRef50_A0A2V7T1U9 BlaI family transcriptional regulator n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7T1U9_9BACT  ali  18  7...PPRELEVMSILWRLGSATVADVRDALDE--PLAYTSVLSALQTLEEKGYVRHEPEGRAYRYFPTIGAERAGGSALARIRDAIFHGSAERMFAQFVSDRKLGREELERMRRLLAER.. 119
562 2.000e-31UniRef50_B3PLF6 Uncharacterized protein n=15 Tax=root TaxID=1 RepID=B3PLF6_CELJU  ali  21  12.QLSRRERQIMDALFEAGELSAQEVRDALPDAPG--YSAVRALLAKLVEKKLVDFREDGPRYIYFPVIAQEEARTSALQKLLKTFFGGSTTAAVNALLGQEKLSTEEIAQLQDAINKAKQ 130
563 2.000e-31UniRef50_A0A1Y4S7E5 CopY family transcriptional regulator n=2 Tax=Flavonifractor TaxID=946234 RepID=A0A1Y4S7E5_9FIRM  ali  29  6.RLPDAELEVMQALWQLEPVTSAQLMEKLS-GRHWRLPTLLKLLSRLEERGFVANEKEGRNNRYRPLVDEREYLAAESGRFFQKLHSGSLPSLVAALMESRAITSDDVAELEAILK.... 121
564 2.000e-31UniRef50_A0A1Y4LA97 CopY family transcriptional regulator n=1 Tax=Lachnoclostridium sp. An181 TaxID=1965575 RepID=A0A1Y4LA97_9FIRM  ali  21  3.QISNAEMEVMLAVWNMGRVTSADVIACL-DRKDWKKTSVLTFLSRLVDKGYLSCQKEGRVNYYAPRITYEEFSKKEGRMMLKKLYHNSVKMFVSTLYDGKELDMEEIEELKTYLDSLE. 120
565 2.000e-31UniRef50_A0A0K6BZB6 Penicillinase repressor n=64 Tax=Bacteroidales TaxID=171549 RepID=A0A0K6BZB6_BACFG  ali  21  3.KLTMQEEEVMIYIWELESCYVKDIVAKFEQPTP-PYTTVASIVKNLERKKYVKAQRVGNTYLYTPSIKESEYKRSFMSGVVRNYFENSYKEMVSFFAKDQKISTNDLKEIIDMIEKGQE 120
566 2.000e-31UniRef50_A0A1J5RSZ8 Penicillinase repressor n=1 Tax=mine drainage metagenome TaxID=410659 RepID=A0A1J5RSZ8_9ZZZZ  ali  22  6VTLSRLELEVMRPLWTLGKATVREVLEALPEDRRPEYTTVQTIIYRLEAKGAVTRKKVGNAHVFAPAITQKSTVGTLVEELLRRL-GGTPEPVMAHLVESGKIGLKELRQLEAMIQDAK. 124
567 2.000e-31UniRef50_A0A0P9I2F3 Methicillin resistance regulatory protein MecI n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0P9I2F3_9GAMM  ali  22  1MKLSESESQVLQVFWQHGENSAPQVHKVIEKIKPVSYSTVKTLIDRLEQKGALRRTKEGRTVFYTAVAEPKVTKKPIVKSLIDRIFGGKPSELAAHIVEQETLNKQEIEYLESILAKRK. 120
568 2.000e-31UniRef50_A0A0R1MA84 Uncharacterized protein n=3 Tax=Lactobacillus TaxID=1578 RepID=A0A0R1MA84_9LACO  ali  24  9..ISGSEWEIMRVIWTLNNVTSRQLSEIMGQKCDWSTSTVKTLLSRLVKKRMLATKQEGRQFIYHPLVTEIAAMSQTSLALFQRMCAMKVGKAILADLKELTLSKSDIDSLSNLLQEKR. 125
569 2.000e-31UniRef50_R8VY41 Uncharacterized protein n=3 Tax=Butyricicoccus pullicaecorum TaxID=501571 RepID=R8VY41_9CLOT  ali  24  6.RLPDAELAVMQEVWSAPPVPSAWVTERLADR--WKTTSVLTFLSRLCEKGFLQCDKQGKMNVYTPLVSQDDYGERESVSLLRRFYRGSVRDLVASLSHTGALTREDLDELRDFLDE... 121
570 2.000e-31UniRef50_A0A098S557 Transcriptional regulator n=9 Tax=Bacteria TaxID=2 RepID=A0A098S557_9BACT  ali  23  3.KLTKAEEEIMQIIWEIAPCTVSDIRNYMVEEMGLPHSTVSTMVRILDDKKFLKHTAYGRTFVYEPKVTKDEYSRQSVRTLVQDYFGGSMNRLVSFLVQEEDLSLRELNDLMGKLEE... 122
571 2.000e-31UniRef50_A0A0M9UEV9 Transcriptional regulator, MecI family n=1 Tax=Candidatus Symbiothrix dinenymphae TaxID=467085 RepID=A0A0M9UEV9_9BACT  ali  18  3.QLTPQEEQLMLFVWKQGKGFIKDYRDKYPGANKPPYTTVATIMKKLEAKGYVAATLYGNTYEYRPKIKQDRYKSHYVSDLAKNYFQNSYKEMVSFFAQEEKLSERDLEEIIQMIKNR.. 119
572 2.000e-31UniRef50_UPI000717107F BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Bacillus cecembensis TaxID=459347 RepID=UPI000717107F  ali  17  3.RLPDSELEIMLIIWENKGVTRSYIQEHLEGSKILAPTTILSFLSRLTTKGFLRIEKEGKTNLYYHLVSQEDYANKESKKILERFFGNSVKDFVVQLNDSKAVDEEEIKELREFLDSL.. 120
573 2.000e-31UniRef50_A0A259TXP2 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A259TXP2_9BACT  ali  23  8..LGGTEMEILRLVWSLERATAREVHAAM--DHQVAYTTVATVIKNLAVKGYLSIERDGATYVYTPARPAEEVRGSLLTSVVDKVFGGSARTLIQTLAGHESLTETEQAEVRRLLDQL.. 121
574 2.000e-31UniRef50_M1ZEC9 Transcriptional repressor, CopY family n=15 Tax=Firmicutes TaxID=1239 RepID=M1ZEC9_9FIRM  ali  22  7.RLPDAELEIMLVIWRADQVSSSYILEQLRDKRKWSLPTLMTVLARLTEKGFLYCEKKGRNNRYRAAVSEKEYKESEGKSTLMKLFGNSVQDMVLSLYNGKAISKNDLIELRKLIDKVE. 125
575 2.000e-31UniRef50_UPI00082D15C9 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Clostridiales bacterium MCWD3 TaxID=1766203 RepID=UPI00082D15C9  ali  25  6.RISNSELEIMKILWKEAPLNSTEIINRLKCQSDWSRKTIHTFISRLVKKNVLRVLNGYKQKEYYPTITKNEYKKSETELFVKKIYNGSFILLVSDFIKNESLTENEINELKKML..... 119
576 2.000e-31UniRef50_A0A1E8GK56 Uncharacterized protein n=2 Tax=Floricoccus TaxID=1930830 RepID=A0A1E8GK56_9LACT  ali  24  15..ISDAEWDVMRIVWTDGNVTVDDIANKIDPKHGWQLATIKTLLGRLVKKDMLSTERDGRKYVYSAKMSECEAAREMADEFADKICTKQRASAIAELIRRSDFTQEDIQMLKDVLDHK.. 130
577 2.000e-31UniRef50_F3MNS8 Uncharacterized protein n=1 Tax=Lactobacillus helveticus MTCC 5463 TaxID=947827 RepID=F3MNS8_LACHE  ali  25  11..ISDSEWEVMRIIWTLEPVSSTKIIQELQAKKDWSESTIKTLLRRLVKKDLLHTTKEGRHFIYSANVNQTQVMTEAAEELLNRMCDMHKGEVLLQLIANSPISKSNLSKIKGFIDTKE. 127
578 2.000e-31UniRef50_A0A1J0A4R1 Uncharacterized protein n=2 Tax=Vagococcus TaxID=2737 RepID=A0A1J0A4R1_9ENTE  ali  21  8VSITQAEWEIMKVVWANDSVTSRFVLDILGDKMEWSMSTVKTLLARLVDKEYLTTQKNGKQFIYEALVNEEVAVNTLLEQDLDKICQKKKGRMIYQLIEEQELSEQDIDNLVDLLTVKK. 126
579 2.000e-31UniRef50_A0A1G7GFP2 Predicted transcriptional regulator n=2 Tax=Bacteria TaxID=2 RepID=A0A1G7GFP2_9BACT  ali  22  4..LTKTEEKIMQVMWDLKSGFVKDVIDRLGEP-AVPYNTVSSLIRILEKKGFIGHKAYGKTHEYFPLISKLSYRSFTFRNFVANYFDGASGNVLSYMLEEQDLSQEEIEKAVAEINKTK. 119
580 2.000e-31UniRef50_L0DFB3 Putative transcriptional regulator n=2 Tax=Singulisphaera TaxID=466152 RepID=L0DFB3_SINAD  ali  28  8..IPDSELDVLKVLWDRGQATVREVLETLRAGRQWSYATVATLLDRLETKGVVTSDRSELAFVYRPAITTQEVRQKRVNNLVEKLYQGETGLLVLHLLKSHPLDARQAKEVQSVLEEM.. 124
581 2.000e-31UniRef50_U6R7T6 Uncharacterized protein n=32 Tax=Bacteroidetes TaxID=976 RepID=U6R7T6_9BACE  ali  25  1MELTKAEEQILHYLWKLEEATVQDILSCMDDAGKPSRTTVSTIIRILENKGAVSHKPTGRGYIYYPLVKKEEYSRKQLFGFISRYFDNSFSSLASFFAKESNMTAEELDVLLE....... 114
582 2.000e-31UniRef50_A0A0S8IGH0 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A0S8IGH0_9BACT  ali  23  8..LSPFEWELMNIIWDMKETTVKHVLKIGYPNGEKAYTTVQTIMNILVDKGFLRKEKFGPINIYKPLRKREEAVKKETSIFVDKVFDGSFQKMASFMFGSRDLTDEEIVHVKKLIRQKE. 125
583 2.000e-31UniRef50_UPI00058F1749 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Schlesneria paludicola TaxID=360056 RepID=UPI00058F1749  ali  23  11..LSPLEEEVMDVIWRLGTARADQVREAMHAKHALTDSTIRTLLRRMEAKGFLEHTTEGRTFIYRTSVKPSDMANQAVQQVIDRFCEGSLSSLLIGMAGDHLISADELRELAAEIERAE. 127
584 2.000e-31UniRef50_A0A099BVA2 Uncharacterized protein n=2 Tax=Prevotella TaxID=838 RepID=A0A099BVA2_9BACT  ali  21  11..LTKSEMDVMKILWQRDEATVKDILARYTEPKP-AYTTVATFLKILTAKGYLSESKRGKALYYKPLLSQEEYTSRVMDEVTTDFFGGSVGSLVNFFVREEKISVSEIEKLLQMIKDAE. 130
585 2.000e-31UniRef50_A0A239B2B9 Predicted transcriptional regulator n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A239B2B9_9BACT  ali  19  3.KLTLQEEEAMQVIWELDGGFIKDFLAKLPEPKP-PYTTLASTVKNLEKKGYLQSERLGNVYRYTPLIKAEDYKKRFMKGFVGDYFKNSYKELVAFFAKEKQISAEELKEIIDMIENKK. 119
586 2.000e-31UniRef50_A0A1G7DMI3 Predicted transcriptional regulator n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1G7DMI3_9PROT  ali  26  5IKLSDQQYQLVQALWKLGEGSAKDVQAKL-DNLGLAHTTVGTILSRLEKKGVLASETRGRERVYRPLISEGDVKRSMVSSLVSTLFKGDSKALLAHLVNEGEIEKTELDQIKQLID.... 119
587 2.000e-31UniRef50_A0A160N0Y6 Beta-lactamase n=7 Tax=Xanthomonadales TaxID=135614 RepID=A0A160N0Y6_9GAMM  ali  41  1..........MAVLWEQAPRSSEEIVAALAD-TGWHEKTIRTLLNRLLGKQAVAADRDGRRYLYRPLLSREQWQSQESRSLLDRVFGGRVAPLLAHFSRHEKLSEKDIAELRALIDAIE. 108
588 2.000e-31UniRef50_UPI00085C0B3A transcriptional regulator n=1 Tax=Cellulosilyticum sp. I15G10I2 TaxID=1892843 RepID=UPI00085C0B3A  ali  28  1..........MKIIWKKAPVTSEQIIEDLVPKKEWSSKTVKSFLNRLVKKEAIGYTKAGRNYLYAPILTEEECIGSESQSFLNRVYDGAVEMLFSHYLKKENLSDEEIENLQRILLEKK. 109
589 2.000e-31UniRef50_A0A0F9HDW8 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9HDW8_9ZZZZ  ali  21  8.QPTDSELAVLGVLWELGQGTVRQVHEALASDRDVRYTTTLKIMQVMAAKGLLYRDESRRSHVYRPAVDGRSVRRRLVRELAGQVFGGSTRKLILHALSAGGVSAEEVREIKKVLKEHGD 126
590 3.000e-31UniRef50_A0A2G1WAC0 CopY family transcriptional regulator n=1 Tax=Rhodopirellula bahusiensis TaxID=2014065 RepID=A0A2G1WAC0_9PLAN  ali  17  11.KLGARERQILDAVYHFGRASVSDVRSRLNDPP--SYSSVRTMMGILETKGFLRRDREGVRHLYSATRSREKAGRSALTHLMSTFFEGSPSKMLAALLDDSRLSDEELADLQRSIDQAR. 128
591 3.000e-31UniRef50_R9MY41 Uncharacterized protein n=4 Tax=Lachnospiraceae TaxID=186803 RepID=R9MY41_9FIRM  ali  30  8...SDAELEILEVLWSADPLNAGEIRTRLDENKNWERTTVLTLIQRLLKKGVISQEKRE-VYYYAPHIKREEYVKEETKYFVDKFFKGSSRNLAAALVDSEALTKEDIEELRNYFNQ... 121
592 3.000e-31UniRef50_A9WDA4 Penicillinase repressor n=13 Tax=Bacteria TaxID=2 RepID=A9WDA4_CHLAA  ali  21  20..LGPLETEIMQILWQEGSSTVKKVHRKLAQQRDIAYTTVMTTMSRLADKGVLNRERDGLAYVYTPVISEDEFVNLVVRQVLDGLLDDYSDTAISYMVDYAKNNPAELRRLQREISQR.. 136
593 3.000e-31UniRef50_A0A1G7RIC8 Copper transport repressor, CopY/TcrY family n=1 Tax=Facklamia miroungae TaxID=120956 RepID=A0A1G7RIC8_9LACT  ali  26  10..ISDAEWEIMRIVWSHQPLTSRQIIDIANQFSDWKEATIKTLINRLLQKKHLILTGDQKPYHYQATISEKKANQLVLNSFLQRICNLQKAEAISQLLDQTNLSQEDCQQLISQLLIKKQ 127
594 3.000e-31UniRef50_A0A1W5QCG1 Beta-lactamase repressor n=5 Tax=Staphylococcus TaxID=1279 RepID=A0A1W5QCG1_9STAP  ali  29  8..ISNAEWEIINVLWTQSPLSANHIIEQVQQSKAWNEKTIRTLITRLYKKGLLSREKQDGVYQYTPTVEEDYMKYEKTKTLVNQLYGGDVKSLVLNFVEQKELNEQDLQELHDLLEALD. 124
595 3.000e-31UniRef50_A0A1V6GEC5 Penicillinase repressor n=15 Tax=Bacteria TaxID=2 RepID=A0A1V6GEC5_9BACT  ali  23  6.HLSRRERQIMDVLHRHGRATAAEVQAALPAAPG--YSAVRALLRILEKKGHVRHHRAGASYVYLPRASRATARRSALQRVVATFFQGSVTQAVAALLEDTRLTDAELNKLRQMINQAR. 123
596 3.000e-31UniRef50_A0A1Y4BZ49 Uncharacterized protein n=6 Tax=Clostridiales TaxID=186802 RepID=A0A1Y4BZ49_9FIRM  ali  31  7.KITEAELEVMEVLWDAGPCTLGQIKEALWEKNG---DTTKTLLRRLCAKGAVGQEKRQ-VYWYTPLVSREEVRGSRTKKLIDRLYAGSARNMVADLVRADQLNQEDIAQLRQLLDEMD. 121
597 3.000e-31UniRef50_A0A2V7JRQ1 CopY family transcriptional regulator n=2 Tax=Bacteria TaxID=2 RepID=A0A2V7JRQ1_9BACT  ali  19  8.QLGRRERQIMEIVYRRGSASAAEVLADLPDPP--TYTAVRGMLRLLESKGHLRHEQDGPRYVYHPTADPDRVSKSAVRHLVRTFFDNSASSAVAAMVGEDRWSDEDLDHLERLIDKAR. 125
598 3.000e-31UniRef50_A0A174ZYC9 Methicillin resistance regulatory protein mecI n=20 Tax=Bacteroidales TaxID=171549 RepID=A0A174ZYC9_9BACT  ali  21  4.KLTRREEELMRCFWEHGPLFVRELVALATEPKPH-FNTLSTMVRALEAKGYVAHNTFGSTYQYYPVVTEEEFSRRTLGGVISKYFENSYLGAVSALVEEEKISVDELRELIDHIE.... 117
599 3.000e-31UniRef50_A0A060R9G5 MecI family transcriptional regulator n=1 Tax=Mucinivorans hirudinis TaxID=1433126 RepID=A0A060R9G5_9BACT  ali  20  9.ELTRAELEIMQAIWELGECFLGEITEAIAEPKP-AYNTVASTLKVLVNKGYVGYRVWNKSHQYFAVLRKDDYRATTLRHTLGRFFDNSPAQLVAFLNDSGTLTNKEYEDLREIARQIVE 126
600 3.000e-31UniRef50_A0A2A2WFW1 BlaI family transcriptional regulator n=2 Tax=Planctomycetaceae TaxID=126 RepID=A0A2A2WFW1_9PLAN  ali  22  15MKLGGRQLAVIKLLWERGEMTIAELQGALDVESPLAYSTVATVLARMEKKGLVTHRDEDRTYYYRAAVSQQRAGQTMVGEFVERLFGGKPSELVNHLLDSDQVDSKE............. 121
601 4.000e-31UniRef50_A0A180ETB2 Transcriptional regulator n=3 Tax=Lewinella TaxID=70994 RepID=A0A180ETB2_9BACT  ali  21  4..LTRKEEEILRQLYQLEKAFVKDIIAALPGKKP-AYTTVSTVIRKLEEKGYVDHEQFGTTYRYFPTRPIEELQAKDVGKVLREYFSGSAKELVSHFAKNKHLTRADLEEVMRMIDEQNQ 120
602 4.000e-31UniRef50_A0A0P6S2N5 Uracil phosphoribosyltransferase n=10 Tax=Streptococcus TaxID=1301 RepID=A0A0P6S2N5_9STRE  ali  25  2VQISDSEWEVMRVVWAKGEIKSGEIIRILKQKYQWSDSTIKTLIGRLVDKKALLTQRQGRAYVYQAHLDQEAFQLAALSEVLGKVCQRQHTHLIKGLLEELPMTLRDIQDLQSLLEVKKE 121
603 4.000e-31UniRef50_A0A1I2M3S6 Predicted transcriptional regulator n=2 Tax=Sunxiuqinia elliptica TaxID=655355 RepID=A0A1I2M3S6_9BACT  ali  21  4IQLTKAEEQVMQYVWQLKETVIKDVVDQFDDPKP-AYTTVATVLSVLEKKGFVARRKVGNTNLFTPAISRKDYTKFQFSSLLKNYFNGSFPKMATFF....................... 99
604 4.000e-31UniRef50_A0A285BDR0 Predicted transcriptional regulator n=2 Tax=Thermoanaerobacterium TaxID=28895 RepID=A0A285BDR0_9FIRM  ali  23  3.RMSDSEKKIMEYIWAAGPVTTSEIIKNLPEAAEWKQNTVITFLTRLIRKKILKATRIGKANQYEPCITEQEYRNFEIKQFIKDVHKGSVLGFISSLCDNGDITLEDIESLMK....... 115
605 4.000e-31UniRef50_X0VCI6 Uncharacterized protein n=4 Tax=root TaxID=1 RepID=X0VCI6_9ZZZZ  ali  25  6IELTEGEWAIIQAVWENEPCAAPTVQEQIENRKNWSYSTVKTMMDRMVTKGLLATERIRNLILYRSAITRRQAQKGEITRAIKRAFDGALTPMMQFLLNNNKLSQKQLTELESLI..... 120
606 4.000e-31UniRef50_N9VQF6 Uncharacterized protein n=45 Tax=root TaxID=1 RepID=N9VQF6_9CLOT  ali  27  3MKLVDSEIKVMDVLWKEGDSMAKHVADVMKERYGWNVNTTYTLLKRCIKKGAVERTD--PNFVCHALIKQEQVQAQETDELLHKVFDGSVDKLFASLLGRRNLTAEQVEKLKEMVEELGE 120
607 4.000e-31UniRef50_A0A2N2B3M0 BlaI family transcriptional regulator n=1 Tax=Firmicutes bacterium HGW-Firmicutes-7 TaxID=2013788 RepID=A0A2N2B3M0_9FIRM  ali  21  4ITLFDSEIKIMNIVWEAKIITAKEVSLIAADSIGWNKNTTYTILNKLIQKGAISR--SHPNFTCQPLISKEQVQIKETKKLVQKLYEGSAKIFLSSFIEKENLSDADLQALRDIIDKK.. 119
608 5.000e-31UniRef50_R7ZEF7 CopY family transcriptional regulator n=7 Tax=Firmicutes TaxID=1239 RepID=R7ZEF7_LYSSH  ali  25  3VKLFDSELQVMNILWEEGDLTAKQLSQILNERIGWNKNTTYTVIKKCIKKEAI--ERIEPNFICHPIIKKEQIQEQETTELIDKVFNGSKSLLFASLLDKKKMSASEIDKLKQIVKDLE. 119
609 5.000e-31UniRef50_F4X8V9 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=F4X8V9_9FIRM  ali  29  7.KISSSELEVLEVLWRSGPMPIAAIRAALEKTHSWDASTVKTLLRRLREKGAVDCEKRD-VFYYWPLLCRKDYQRWSTQSFLQRVYQGSARDLVAGLVECCPLSSEDLSELRDIL..... 120
610 5.000e-31UniRef50_Q7UYB1 Similar to beta-lactamase repressor protein n=8 Tax=Rhodopirellula TaxID=265488 RepID=Q7UYB1_RHOBA  ali  15  16..PTDVELQILRILWANGSCGVGVIHEHLHREKGTNYSTTMKMLSVMLGKGLVKRNETQRPHLYRAAWSRERMGKGLLKDLATKVFEGSVSSLVLNALSNSKASQSDIEEIRQILTEME. 132
611 5.000e-31UniRef50_K0B567 Penicillinase repressor BlaI n=107 Tax=Bacteria TaxID=2 RepID=K0B567_CLOA9  ali  36  6.QISESELEVMKLLWESSPLSANEIISSLSDRMNWSHQTIKTFINRLLNKQVISFEKSGRSYLYYPLVSYDQYVKSENKSFLEKVYNGAVSMLFSKFLED.................... 104
612 5.000e-31UniRef50_A0A0R2FYJ8 Uncharacterized protein n=2 Tax=Firmicutes TaxID=1239 RepID=A0A0R2FYJ8_9LACT  ali  21  1MQISNAEWQVMKVIWMRDGLTSSQLHAILAAKFAWSPSTTKTLLRRLVTKGMLVAHKEGNKFHYSALMTEKESICELKDEVQDKTCAMNVKYVVAELIDTGDFTMADLDMLAAKIEAKR. 119
613 5.000e-31UniRef50_A0A2A5H2P9 Transcriptional regulator n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2A5H2P9_9FLAO  ali  24  3.QLAKREDQIMQIVWRLKTVFIRDIIEELPDPKPH-YNTVATMVKILVKKRFLVSEMLGNTHQYSPAVPIEEYRDEHLVNIKKKYFGNSFPKMIAHFAKEEELTDEEVQELVKIIKSQK. 119
614 5.000e-31UniRef50_A0A2N9MWL5 Transcriptional repressor, CopY family n=6 Tax=Acidobacteria TaxID=57723 RepID=A0A2N9MWL5_9BACT  ali  22  15..LTELENEVMRAVWDAGPSTVEAVHLTVSRNRTLKEATIRTLLRRLEQKGYLRHEEDKRAYVYQAVEPARSLAARAVRQIIDRFCQGSVEELVSGMVEARVLSKGELDRLEDFVRSRKQ 132
615 5.000e-31UniRef50_E6LCH1 Copper transport repressor, CopY/TcrY family n=2 Tax=Enterococcus TaxID=1350 RepID=E6LCH1_9ENTE  ali  26  6VKISDSEWEVMRVIWHEDCSDAKGIFDVLGVAKDWKMATIKTLLGRLVKKGALSTEQDGKKFLYRPLVNERQVIHDATSELLSHICAKKIGHTVAEILAQVELTADDIQLIKEQLTQKE. 124
616 6.000e-31UniRef50_A0A2P6C335 Uncharacterized protein n=1 Tax=Salinibacter sp. 10B TaxID=1923971 RepID=A0A2P6C335_9BACT  ali  18  8.KLSRRERQIMEAVYRLGEASVAAVQDELPDDPD--YHAVRVAMAKLEDKGHLCHRREGRRYIYKPEIPREEAKRSALGHLVRTYFSGAPSEVLLTLLNAEDLSTDDIAELEAWIEQAKD 126
617 6.000e-31UniRef50_A0A246AIX0 Transcriptional regulator n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A246AIX0_9FLAO  ali  20  5.QLTKAEEQVMQYLWEIKKGFLKDVLELFPEPKPHT-NTVSTILKVLKEKDFVDYEVHGRQHEYFPLVSKEKYSGKSMKSLVKNYFEGSYKNAVSFLVEKNEMSVEDLEFLLNELKNK.. 120
618 6.000e-31UniRef50_A0A1Y3S391 Uncharacterized protein n=6 Tax=Flavonifractor TaxID=946234 RepID=A0A1Y3S391_9FIRM  ali  30  28.KITEAELEVMEVLWQAEELTLGQIRGALPEKNG---ETVKTLLRRLCAKGAAAQEK-GQVYSYHPLVSREEVGTSRTRKLIDKLYAGSARQMVAALVEHDQLTGADIAQLRELLDSLD. 142
619 6.000e-31UniRef50_A0A0A2WHR5 Transcriptional repressor, BlaI/MecI family n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A0A2WHR5_9GAMM  ali  20  6.HPTEGELALLHVLWATAPMTVREVHAVLSRQKDTAYTTVLKMLTIMADKGLVVRDEAQRTHTYRAVHAEPVVQASLLKDLVRKAFSGSATALVQRALDDAMASPEELDAIAKLIADAK. 124
620 6.000e-31UniRef50_UPI0009FA5AB5 hypothetical protein n=1 Tax=Nitriliruptor alkaliphilus TaxID=427918 RepID=UPI0009FA5AB5  ali  21  216..LGPLEQDVMDVVWRLGDTTVRDVHGDLAARRNIAYTTVMTTMSRLASKGLLVRDTEGLAHRYRPAVSRDRYARSAVHDVLSWLLERYPEPAASYLADVHDIDDVSLDELRAAVERRR. 333
621 7.000e-31UniRef50_A0A2M7KJ06 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20 TaxID=1973912 RepID=A0A2M7KJ06_9BACT  ali  22  11.ELGELQVQVLEALWKLGEGTVYDVLAKFAARKRPKYTTVLTVLRTLEEKGLATHRTEQRTYVFRPTVEQRELRRNVLTDVLGRVFAGSPSDLVAALLDVGQVTPETLAEMKALIAERE. 128
622 7.000e-31UniRef50_A0A1V4ISI6 Penicillinase repressor n=4 Tax=Firmicutes TaxID=1239 RepID=A0A1V4ISI6_9CLOT  ali  27  6.NITDSEIIVMKVIWKKERCTAAKIIAEVSKNSDWHFRTIKTLLRNLVKKEVVGYEHDSRIYHYFPLISEEDYLRQERENFTDLYYDGNVGAVVAGFLKDTKLSKYELQDLKRILNN... 124
623 7.000e-31UniRef50_A0A0W0XKZ1 Penicillinase repressor n=67 Tax=Legionellaceae TaxID=444 RepID=A0A0W0XKZ1_9GAMM  ali  20  16..LTEVELELMNIIWSLGTTTIKEVVSHLSKKRSLAYTTVATVFKVLEKKGFLNCQKSTHAHVFMPAVSKSEYESTCLDHVVANVFDGEPLALVQRLLVANKLQQQDIQAIEKALKQL.. 131
624 7.000e-31UniRef50_UPI000DAC1CE6 BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Phenylobacterium kunshanense TaxID=1445034 RepID=UPI000DAC1CE6  ali  47  5.RISEAESRVMAVIWDGAEAGVEDILAAAGAANGWSETTVRTLIHRLIRKDAVASERRGGLALYTPKVSREAWVTAESQGFLDRLFGGQIAPLVAHFARQRGMDPTDLARLRKLVAELD. 127
625 8.000e-31UniRef50_A0A091C4N4 Uncharacterized protein n=21 Tax=cellular organisms TaxID=131567 RepID=A0A091C4N4_9GAMM  ali  44  6ISISEAESEVMQALWAAGEATAEDLIAAVAGPQGWAEGTVRTLINRLLTKGAISAEREGRRYRYRPLLQRADWMADASTGVVDRLFGGRIAPLVAHFSEQRKLTRADIDELRKLIE.... 121
626 8.000e-31UniRef50_A0A2K9PV47 Penicillinase repressor n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A2K9PV47_9FLAO  ali  23  1MKLSRKEEELINIIWRLGDAYMKDLLNAYPEPKP-ASTTVSTLLKRLINKGVISYRIHGNSRQYYGLINKTEYSSFNLKNMIGTFFQGSSSRFASFFANNMKLTKEELTELRNIIDEK.. 117
627 8.000e-31UniRef50_I7KHG6 Negative transcriptional regulator-copper transport operon n=15 Tax=Lactococcus TaxID=1357 RepID=I7KHG6_9LACT  ali  24  3INISDSEMVVMRAIWTLEQASVDQIACQIAASNDWSVATIKTLLGRLVKKEMLATTKSGRKFIYTPTMSECEAVGLMGQELLDKVCAKKHVDVLVNLIDDAKLTAENLQMIREALAEK.. 120
628 8.000e-31UniRef50_M1MTQ3 Transcriptional repressor, CopY family n=3 Tax=Firmicutes TaxID=1239 RepID=M1MTQ3_9CLOT  ali  20  1.......MEIMKIIWKNRQVTTADILEELPKENSWKITTVMTLISRLTDKGILKVAKLGKLNNYSAKITEEEYKAIQADNFLEDMHNGSVKNFIATLFNNKKISKEDISDLKKWLKD... 111
629 8.000e-31UniRef50_A0A1F2WR34 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1F2WR34_9ACTN  ali  20  1..MGDLEAEIMECVWELGPVSVRDVHRCLEERREIAYTTVMTVMSRLASKGLLVSRPQGRAYIYEAAADREAYCAGVVRDFMSEMLADADKAVLSQFVESTEHDRTQLDMLAQIIEEKR. 118
630 8.000e-31UniRef50_A0A2D6PUS3 CopY family transcriptional regulator n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D6PUS3_9BACT  ali  27  8..LTNLELAVMNVVWGAGPMTVRDVAERLNAERPLAYTTVQTMMRILKEKGVLRSRPGGRAHAFTTRLSRDDMTSTMVGDLVDRLFDGRAQPLLARLIDHDSVTRDELQRLKHLIQ.... 126
631 9.000e-31UniRef50_UPI000D1404AC pyridoxal-phosphate dependent enzyme n=1 Tax=Streptomyces sp. NRRL S-146 TaxID=1463884 RepID=UPI000D1404AC  ali  24  124.RLGDLEAEIMDRLWTNRPATVREVVDDINRTRPIAYTTVMTVTNILYTKGWLLRGKQGRAWLYSPVRSREAYAAALMEDGLGE--SNDRPAALVHFVES--MSEEEVAALREAL..... 234
632 9.000e-31UniRef50_A0A1J5SXA0 Methicillin resistance regulatory protein MecI n=25 Tax=root TaxID=1 RepID=A0A1J5SXA0_9ZZZZ  ali  20  6..LTKAEEQIMQTIWKLDKAYLKDIVDAQPEPKPHS-NTVATILKILIEKGFVDIEVHGRVHQYEAIISKEEYSSSTIRNLVEGYFEGSFADAVSFMLKQKDLKVKDLELLLQQIKHKK. 121
633 9.000e-31UniRef50_A0A2S6I9I0 Putative transcriptional regulator n=1 Tax=Lewinella xylanilytica TaxID=1514080 RepID=A0A2S6I9I0_9BACT  ali  22  7..PSDAELRILQALWEQPGASVHDVHDICTHERALSYTTVLTQLQRMHKKGLVKRGRDGLQHRYSSVPTRSEVEAKLIHRLSNKAFDGSAVRLALKALGTDQPTGEELDELQRWLDAQKD 125
634 9.000e-31UniRef50_A0A0R2JIB7 Uncharacterized protein n=1 Tax=Weissella kandleri TaxID=1616 RepID=A0A0R2JIB7_9LACT  ali  22  6.NISEAEFAVMNLIWAKPGLTSHAISDLLAPDHNWSASTIKTMLARLVKKGFLVTQALGKQYQYTALVDEDHISIEYTQALFKRLCDRHQGNALQELLKMAPISQKDIAAMQDILQ.... 120
635 9.000e-31UniRef50_UPI000CFCA56B BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Vallitalea sp. S15 TaxID=2078660 RepID=UPI000CFCA56B  ali  25  19.KISDSELEVIKVLWESQSMSAIEITEKLNKNMGWENSTVRTLIRRLNQKGFLVQEKKENTFYYLSAVSQEEYMKETTREFVKKTYRGNAKNLVASLFQNKLLSKDDIKELKSFWEQEGD 145
636 1.000e-30UniRef50_A0A0E0USF8 Putative transcriptional regulator, CopY family putative beta-lactamase repressor protein n=24 Tax=Bacilli TaxID=91061 RepID=A0A0  ali  23  6..ISKSELEVMKIIWDFGRAQYADVAGKLEEKYSWKKNTVLTFLTRLVEKNLLSVKKVGRKNEYYALVSENEYLERQTETFVEDIYEGDVKGLITNLVQNDLISPDELEDLQQFWKRMK. 124
637 1.000e-30UniRef50_A0A1E3AWK1 Penicillinase repressor n=11 Tax=Clostridiales TaxID=186802 RepID=A0A1E3AWK1_9FIRM  ali  23  6.KISEAELEIMKIVWERQEAASSDIVGILKKRCGWEDTTVYTMLSKLVKKGALLREKKAVSY-YSAALSEEEYTLEQTERLIDRLFSGDSRQLVSMLVENNKISREDIHSLRQFWED... 121
638 1.000e-30UniRef50_A0A2D0NJ08 Transcriptional regulator n=1 Tax=Lewinella nigricans DSM 23189 = NBRC 102662 TaxID=1122177 RepID=A0A2D0NJ08_9BACT  ali  27  3.RLNEREEQIMQILWRVKNAFVKEILAEMPEPKP-PITTVSSIVRKLETEGIIGHEAFGKTHRYFPILEKSAYRKSFFQRMLNNYFGGSPEQLLSFFVDEQDLPPDELNRLLEKIQQSE. 119
639 1.000e-30UniRef50_UPI0006C826C6 BlaI/MecI/CopY family transcriptional regulator n=2 Tax=Anaeromassilibacillus sp. Marseille-P3371 TaxID=1944639 RepID=UPI0006C  ali  26  4.KLSEAELDVMLVIWAQESLDTGEIVRKLKQGKKL--QAVQVLLGRLVNKGYVSCEKIGRLNYYTPLVPQAAYRAAETETFVEKLYRNSPKSLIAALVQSQPLSKEDLEEIRALLDREEE 121
640 1.000e-30UniRef50_A0A1V4VU32 Penicillinase repressor n=10 Tax=Firmicutes TaxID=1239 RepID=A0A1V4VU32_9FIRM  ali  20  2VNITDAEMEIMRIVWDSGEVTTKDIMEKLPGKKT---TTILTLAGRLINKGVLKSVKLGRAHEYWAGISEEEYQKMQTRNFIRSIHNGSTKSLISALFQDENLTKEDIEELRAFMEK... 118
641 1.000e-30UniRef50_A0A180EMT4 Uncharacterized protein n=2 Tax=Lewinella TaxID=70994 RepID=A0A180EMT4_9BACT  ali  21  6.HPSEAQLEILDLLWTDQPATVQQLHARLADRRQVSYNTVLTQLQRMAKSGLVERNTDQRTHTYVAAHLREAIEQSVFGRLANTAFGGSKVNLALRALGNETPSPAELEELEAWIKKQK. 123
642 1.000e-30UniRef50_A0A257SJL9 Uncharacterized protein n=1 Tax=Gemmatimonadetes bacterium 21-71-4 TaxID=1970514 RepID=A0A257SJL9_9BACT  ali  23  3VHLTRRELDVMSVLWQRGSATVAEARDGIAD--DLAYPTVLTMLRTLEAKGHVRHELEGKGFRYYPVLESDDAGSSAVHRLLDKVYHGSRELLVAGLLSDQSIDEHELLRLRKLVNER.. 118
643 1.000e-30UniRef50_B9YB12 Transcriptional regulator, BlaI/MecI/CopY family n=3 Tax=Holdemania TaxID=61170 RepID=B9YB12_9FIRM  ali  20  1MELSDSEKEIMKLIWDHGGATISELLDQIERTRDWKRTTVRTFISRLIDKGMLISQKEGRGARYVARISEEEYLKTQSVQFVNQVFGGNVSTLLTSLFGQQCLESKDIEELEKFWEQGKE 123
644 1.000e-30UniRef50_A0A2V9DM52 MarR family transcriptional regulator n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9DM52_9BACT  ali  22  16..LAPLELDCMNALWRLGEATVRDIHASLANTRPRAYTTIMTILDRLAQKGVVERKKAGRAWLYKPHLSADQARTHAVARLVEGFFQGSNDALASHL....................... 110
645 1.000e-30UniRef50_UPI0009461315 BlaI/MecI/CopY family transcriptional regulator n=2 Tax=Planctomycetaceae TaxID=126 RepID=UPI0009461315  ali  24  4VSPSERELDILKVLWDRGESKVRDVHEALCRHQQTAFTTVQTLLRIMADKGLVRQRIEGRTLYYAPLHTREQV----SSRFLSRVFDGALDELVLNMLRAEDVSPDEMRDLERLIARAR. 118
646 1.000e-30UniRef50_A0A0H0YJY4 Uracil phosphoribosyltransferase n=10 Tax=Lactobacillus TaxID=1578 RepID=A0A0H0YJY4_LACCA  ali  25  6VDISQSEWEVMRIIWTLGPLKSSTLAAILADKMGWKVATTKTFLGRLVKKGALVTEKQGREFLYHATVGEQASMDAAATELFSHLCQMKIGKTLDHLITHVTLSKQDINDLQQTLTAK.. 123
647 1.000e-30UniRef50_A0A1G7N360 Predicted transcriptional regulator n=1 Tax=Fontibacillus panacisegetis TaxID=670482 RepID=A0A1G7N360_9BACL  ali  23  5LKFSDTELELMETIWECQPVTSSELLRIFGERKHWKSQTISTFLSRLVEKGALRTNRQGRTNSYTPCISQKDYRLQETQTIINGLYEGSVKNMISALYDGERLSDSDITELKQWFSRK.. 125
648 1.000e-30UniRef50_D5BAP1 Putative antibiotic resistance-related regulatory protein n=14 Tax=Flavobacteriales TaxID=200644 RepID=D5BAP1_ZUNPS  ali  20  3.QFSKSELQIMKYLWAIEKGFLKDIVDQFPDPAP-AYTTISTLISRMVKKGYIGFEKYGRDKQYYPKITKTEYFKNHFKEIVSGFFNNSSSQFASFFTKNSDLS................ 104
649 1.000e-30UniRef50_A0A0G7KBV7 Negative regulator of copper transport operon n=7 Tax=Streptococcus TaxID=1301 RepID=A0A0G7KBV7_9STRE  ali  26  4..ISDAEWEVMRVVWANGSMKSSEIIAILHEKHHWSDSTVKTLIGRLVKKKALRADRQGRSYIYQSLLDQDRRQLAMLRERLDGMCQRHHSRLLLALLKDTPMTLEDIQAFQLLLEAKK. 120
650 1.000e-30UniRef50_A0A0S8E9I4 Uncharacterized protein n=1 Tax=Phycisphaerae bacterium SG8_4 TaxID=1703409 RepID=A0A0S8E9I4_9BACT  ali  29  1MKLTQAEWQIMKALWKKHPATARQIMTRLPNGVSWAYTTIKTMLSRLVEKNAVGEQKRGNTSLYEPLLSQRKARLSAFTSMLDQAFDGATGPLVHFL....................... 97
651 1.000e-30UniRef50_UPI00094B9322 BlaI/MecI/CopY family transcriptional regulator n=4 Tax=Bacteroidetes TaxID=976 RepID=UPI00094B9322  ali  21  3.ELTKAEEQIMKYVWKLDKVFLKDIVNEFPEPKP-AYTTISTVVRVLVKKNFLKFETYGKVRQYYPAISKEVYFRNHMKNVIGNFFNGSTSKFASFFTSDEDLS................ 104
652 1.000e-30UniRef50_A0A1T5MMS6 Predicted transcriptional regulator n=2 Tax=Maledivibacter halophilus TaxID=36842 RepID=A0A1T5MMS6_9CLOT  ali  29  4.KLTDSEIIIMNILWESGPLKAGEIAEITLKKKGWKRNTTYTLIQRLIKKDAILRTD--PNFICTPILKQDEIRIEETKTLLDKMYNGSFNLLVKNFIKKESLSQKEIDELRNIIDE... 117
653 1.000e-30UniRef50_A0A1L8QRS1 Copper-responsive repressor CopY n=1 Tax=Enterococcus aquimarinus TaxID=328396 RepID=A0A1L8QRS1_9ENTE  ali  22  7MKISEAEWEVMRVVWTLGEVDAQTISETLSHRMQWKLATIKTLLGRLVKKEALRTQQVGKKFLYSANVSEEETFRSAQVELFSHLCARRVGEQLNQMIEEVPLTQADIDQIRQTLDKK.. 124
654 1.000e-30UniRef50_U5MUS9 Transcriptional repressor, CopY family n=2 Tax=Clostridium saccharobutylicum TaxID=169679 RepID=U5MUS9_CLOSA  ali  24  6..ISESEWKIMSVLWKTPNIELSEIVDKLTEN-EWSYSTIKTLLKRLVNKNVVIVDKSGKNFRYKPAVEEHECKIKEAKNFLSKVFDNSISLFVSTLAKESNLSRKEQQELMNIINKMED 123
655 1.000e-30UniRef50_R9M9K3 Uncharacterized protein n=3 Tax=Oscillibacter TaxID=459786 RepID=R9M9K3_9FIRM  ali  21  7..LSESEMEIMRYVWDSGEAVTTSILLGVFAHKGWKAQTVSTFLTRLADKGALRVEKRGKANVYFSALTEAEYYELEARHLVDSKYHGSVLDFLAAFYGGKGISAQEADALKRWFDK... 121
656 1.000e-30UniRef50_A0A2T6FKU5 Uncharacterized protein n=2 Tax=Cellvibrio TaxID=10 RepID=A0A2T6FKU5_9GAMM  ali  31  6LQLSGSEWDLMKILWDNSPASVNQIAELTPQ---WHPKTVRTMLIRLQKKGAVEYEVIEGIQNFKPVHDREYCESSATQSFMQRVFDGALTPMIAHFTRKQKLTDDEKKALISLLQDNK. 121
657 1.000e-30UniRef50_A0A146G410 BlaI family transcriptional regulator, penicillinase repressor n=1 Tax=Terrimicrobium sacchariphilum TaxID=690879 RepID=A0A146G41  ali  28  6.KISDAEWDVMNVLWEEPGLTAAQVGERLS-GRGWKLNTVRTFLTRLEKKGAVRATEVPEARVFSAVLSREECIHAEGRTFAQRFFQGATGALLVHFAGNTKLSD............... 108
658 2.000e-30UniRef50_A0A2G2KZK4 CopY family transcriptional regulator n=1 Tax=Blastopirellula sp. TaxID=2024826 RepID=A0A2G2KZK4_9PLAN  ali  22  9..LSDLENKVMDAAWAAGSVTADQVRMALEPEQSLKDSTIRTVLRRLEEKGYVTHVVEGRTYIYTPTGGAQAVAADAVRGIIDRFCKGSVEDLLLGLIDREVVSHEELSRLAQRIAKSKE 126
659 2.000e-30UniRef50_UPI0006BBD4DE BlaI/MecI/CopY family transcriptional regulator n=1 Tax=Clostridioides difficile TaxID=1496 RepID=UPI0006BBD4DE  ali  26  4.QLSDAELEIMKII