current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|16082703|ref|NP_395149.1| plasmid-partitioning protein SopA (YPCD1.13c) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
# Score Template Links and tools%idFirst MDLKSTLDRCIERGQFMTQEIAKSQFGNDSPAARTITRRWRITEAAELVGVTPQTIRNYEDSGKLPPPDTAMIGRVEQRTGYSIQQINDMRDVFKTRLSKPKGENPVVLAIAAHKGGAYKTSTSVHIAQWMALQGLRVLLIDATDPQATASLYHGYVPDLHIHEEDTLLPYYLGQRDDAAYAIKPTCWPNLEVIPSCLAVHRIESEIYGLHDQGKLPVAPHLLLRAAIESVWDSYDVVVLDSAPNLGIGTINVVCAADVIVVPTPAELYDYVSTLQFFTMLRDLMSNIDLNGFEPDVRVLITKFSNAIGSQSQWMDDQIRNAWGGMVLKEVVRVTDEVGKGQVRMRTVFEQAANQRSTPAAWRNAVSIWEPVCAEIFNRLVKPRWENALast
1 -75.5003ez9_A mol:protein length:403 ParA  ali model follow..  18  1MMMKRDYGGVGTIALRASALLKAMSQDIKEFNQTEYYQTFTRNAVAKLPKLSRRIVDQAIKEMEEDGYQFNKKQVGNEQYALTIQNVIDIYAHRKIPKYRDIHKSPYVIFVVNLKGGVSKTVSTVTLAHALRVHDLRILVID-LDPQASSTMFLDHTHSIGSILETAAQAMLLDAETLRKEVIRPTIVPGVDVIPASIDDGFVASQWRELVEEHPGQNQYEILRRNIIDRVADDYDFIFIDTGPHLDPFLLNGLAASDLLLTPTPPAQVDFHSTLKYLTRLPEMLEQLGVEPRLSASIGFMSKMTGK--RDHETSHSLAREVYASNILDSSLPRLDGFERCGESFDTVISANPQSPGSAEALKKARTEAERFTKAVFDR-IEFVRGEA 402
2 -74.5003ez2_A mol:protein length:398 Plasmid partition protein A  ali model follow..  20  1MSDSSQLHKVAQRANRMLNVLTEVQLQKDELHANEFYQVYAKAALAKLPLLTRANVDEMEEKGYVFDKRPAGSSM---KYAMSIQNIIDIYEHRGVPKYRDRYSEAYVIFISNLKGGVSKTVSTVSLAHAMRMEDLRILVID-LDPQSSATMFLSHKHSIGIVNATSAQAMLVSREELLEEFIVPSVVPGVDVMPASIDDAFIASDWRELCNEHPGQNIHAVLKENVIDKLKSDYDFILVDSGPHLDAFLKNALASANILFTPLPPATVDFHSSLKYVARLPELVKLIDEGCECQLATNIGFMSKLSNKADHKYCHSLAKEVFGGDMLDVFLPRLDGFERCGESFDTVISANPATVGSADALKNARIAAEDFAKAVFDR-IEFIRSN. 398
3 -74.4003ez7_A mol:protein length:398 Plasmid partition protein A  ali model follow..  19  1MSDSSQLHKVAQRANRMLNVLTEVQLQKDELHANEFYQVYAKAALAKLPLLTRADVDYAVSEMEEKGYVFDKRPASSMKYAMSIQNIIDIYEHRGTPKYRDRYSEAYVIFISNLKGGVSQTTSTVSLAHAMRMEDLRILVID-LDPQSSATMFLSHKHSIGIVNATSAQAMLVSREELLEEFIVPSVVPGVDVMPASIDDAFIASDWRELCNEHPGQNIHAVLKENVIDKLKSDYDFILVDSGPHLDAFLKNALASANILFTPLPPATVDFHSSLKYVARLPELVKLIDEGCECQLATNIGFMSKLSNKADHKYCHSLAKEVFGGDMLDVFLPRLDGFERCGESFDTVISANPATVGSADALKNARIAAEDFAKAVFDR-IEFIRSN. 398
4 -68.0001wcv_1 mol:protein length:257 SEGREGATION PROTEIN  ali model follow..  24  4.......................................................................................................AKVRRIALANQKGGVGKTTTAINLAAYLARLGKRVLLVD-LDPQGNATSGLGVRAE------RGVYHLLQGE--PLEGLVHPV--DGFHLLPATPDLVGATVELAG----------APTALREALR--DEGYDLVLLDAPPSLSPLTLNALAAAEGVVVPVQAEYYALEGVAGLLATLEEVRAGLNPR--LRLLGILVTMYDGRT-LLAQQVEAQLRAHFGEKVFWTVIPRNVRLAEAPSFGKTIAQHAPTSPGAHAYRRLAEEVMARVQEA............. 249
5 -66.1004pfs_A mol:protein length:273 Cobyrinic Acid a,c-diamide synthase  ali model follow..  22  2.......................................................................................................AMTRVLAVANQKGGVAKTTTVASIGAALTEQGRRVLLVD-LDPQGCLTFSLGHDPD---KLPVSVHEVLLGD-VEPSAALVRTD-EGMTLLPANIDLAGAEAMLLMR-------AGREYALKRALAKLDGDFDVVIIDCPPSLGVLTLNGLTAAHDVIVPLQCETLAHRGVGQFLRTISDVQQITNPD--LKLLGALPTLYDSRT-THSRDVLLDVADRYELPVLAPPIPRTVRFAEASASGSSVL-AGRKSKGAIAYREFADALLRHWKSG............. 256
6 -61.4003k9g_A mol:protein length:267 PF-32 protein  ali model follow..  19  16....................................................................................................MDNKKPKIITIASIKGGVGKSTSAIILATLLS-KNNKVLLID-MDTQASITSYFYEKIEKL-FTKFNIYEILKEN-VDIDSTIINVD-NNLDLIPSYLTLHNFSEDKIE---------HKDFLLKTSLGTLYYKYDYIVIDTNPSLDVTLKNALLCSDYVIIPMTAEKWAVESLDLFNFFVRKLNLFL------PIFLIITRFKKNRT-HKTLFEILKTKDRFLGTISER-EDLNRRIAENN-------NFDLNKDYIKEYENILEIFLKKI................ 261
7 -57.1005u1j_B mol:protein length:322 Uncharacterized protein  ali model follow..  15  2.................................................................................................SSPSSSMIAKVITIHNFKGGVGKTTTTAIIAMGLGAMGKRVLLID-FDAQMSLTQIFVREEDRDVTQDKSAFALLRTMEPARIKFFHKGVKFGIDVIPGS------YMSIFKLMFEGYIPIQSEWNILRMLDLYRDQYDYILIDTAPSDTVTIKPILRASHYLLIPEDGTPEAFTAMRIFLNELPRPEGGFYKY--PRILGVILTRVRRN----STAILMKHNKILEEELSNSELKDHVIYPPYFGADKDN----PEDYILSSRKEYLSDLIWR................. 274
8 -54.8002oze_A mol:protein length:298 Orf delta`  ali model follow..  16  31....................................................................................................SNKNEAIVILNNYFKGGVGKSKLSTMFAYLTDKLNLKVLMID-KDLQATLTKDLAKTFKVE-LPRVNFYEGLKNG--NLASSIVHLT-DNLDLIPGTFDLMLLPKLTRSWTFENE-----SRLLATLLAPLKSDYDLIIIDTVPTPSVYTNNAIVASDYVMIPLQAEEESTNNIQNYISYLIDLQEQFNPG--LDMIGFVPYLVDTDS-ATIKSNLEELYKQHKELVFQNIIKRSNKVSTWSKNGITEHKG-YDKKVLSMYKNVFFEMLERIIQ.............. 292
9 -52.5003pg5_A mol:protein length:361 Uncharacterized protein  ali model follow..  17  1.........................................................................................................MRTISFFNNKGGVGKTTLSTNVAHYFALQGKRVLYVD-CDPQCNATQLMLTEEQTESSLAKTVYAIFVESQIAAEITPMRSERFGVDVLPGHPALSQIEDLMSDSWQSALGRQTGPFRRIHWAGQLDDRYDVIFFDVGPSLGPFNRTVLLGCDAFVTPTATDLFSFHAFGNLARWFDAWVTQYAEI--HEGNMAEWKKYSADV-EAKTRPLRLGGFDGEGLRYLGYTTLEYVKRRANGQEQLVGAFERRGRFAAEAERISNSLSKHSNSTLLGHV........ 297
10 -46.5001g3q_A mol:protein length:237 CELL DIVISION INHIBITOR  ali model follow..  16  1........................................................................................................MGRIISIVSGKGGTGKTTVTANLSVALGDRGRKVLAVDGDLTMANLSLVLGVDDP-----DVTLHDVLAGEA-NVEDAIYMTQFDNVYVLPGAVDWEHVLKA-------------DPRKLPEVIKSLKDKFDFILIDCPAGLQLDAMSAMLSGEEALLVTNPEISCLTDTMKVGIVLK--------KAGLAILGFVLNRYGRS----DRDIPPEAAEDVMEVPLLAVIPEDPAIREGTLEGIPAVKYKPESKGAKAFVKLAEEIEKL................. 236
11 -46.4001ion_A mol:protein length:243 PROBABLE CELL DIVISION INHIBITOR MIND  ali model follow..  15  1........................................................................................................MTRIISIVSGKGGTGKTTVTANLSVALGEMGRKVLAVDGDLTMANLSLVLGVDD-----VNITLHDVLAGDA-KLEDAIYMTQFENVYILPGAVDWEHVIKA-------------DPRKLPEVIKSLKGKYDFILIDCPAGLQLRAMSAMLSGEEAILVTNPEISCLTDTMKVGMVLK--------KAGLAILGFILNRYGRS----ERDIPPEAAQDVMDVPLLAVIPEDPVIREGTLEGIPAVKYKPESKGAQAFIKLAEEVDKLAGIK............. 240
12 -45.8002xit_A mol:protein length:294 MIPZ  ali model follow..  13  2.......................................................................................................AETRVIVVGNEKGGAGKSTIAVHLVTALLYGGAKVAVID-LDLRQRTSARFFENRRAWLDNKKIEL-----------------------PEPLALNLSDNDVALAERPEEEQV-----AGFEAAFARAMAECDFILIDTPGGDSAITRMAHGRADLVVTPMNDSFVDFDMLGTVDPVTLELTKALSGQRQAMDWVVLRNRLATTEARNRKRLEDRLNALAKRVRIGPGLRDRVIYRELFPFGLTIADLSPQVRPVPQHLAARQELRALMHS.............. 263
13 -45.7002xj4_A mol:protein length:286 MIPZ  ali model follow..  13  2.......................................................................................................AETRVIVVGNEKGGAGKSTIAVHLVTALLYGGAKVAVID-LDLRQRTSARFFENRRAWLDNKKIEL-----------------------PEPLALNLSDNDVALAERPEEEQV-----AGFEAAFARAMAECDFILIDTPGGDSAITRMAHGRADLVVTPMNDSFVDFDMLGTVDPVTLELTKALSGQRQAMDWVVLRNRLATTEARNRKRLEDRLNALAKRVRIGPGLRDRVIYRELFPFGLTIADLSPQVRPVPQHLAARQELRALMHS.............. 263
14 -44.8001cp2_A mol:protein length:269 NITROGENASE IRON PROTEIN  ali model follow..  14  1.........................................................................................................MRQVAIYG-KGGIGKSTTTQNLTSGLHAMGKTIMVVGC-DPKADSTRLLLGGLA-----QKSVLDTLREEGEDVEDSILKEGYGGIRCVESGGPEPGVGCAGRGIITSIN--------MLEQLGAYTDDLDYVFYDVLGDVVFAMPIREGKAQEIYIVASGEMMALYAANNISKGIQKYAKSGG-------VRLGGIICNSRKVANEYELLDAFAKELGSQLIHF-VPRSPMVTKAEINKQTVIEYDPTCEQAEEYRELARKVDANELFVIPKPMTQERLEE. 263
15 -42.2001de0_A mol:protein length:289 NITROGENASE IRON PROTEIN  ali model follow..  14  2.........................................................................................................MRQCAI-YGKGGIGKSTTTQNLVAALAEMGKKVMIVGC-DPKADSTRLILHSKA-----QNTIMEMAAEAEDLELEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITAIN--------FLEEEGAYEDDLDFVFYDVLGDVGWAMPIRENKAQEIYIVCSGEMMAMYAANNISKGIVKYANSGS-------VRLGGLICNSRNTDREDELIIALANKLGTQMIHF-VPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDN................. 250
16 -41.9003fwy_A mol:protein length:314 Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein  ali model follow..  16  13....................................................................................TGADGEGSVQVHLDEADKITGAKVFAVYG-KGGIGKSTTSSNLSAAFSILGKRVLQIGC-DPKHDSTFTLTGSLV------PTVIDVLKDVDFHPEELFVFEGFNGVMCVEAGGPPAGTGCGGYVVGQTVK-------LLKQH--HLLDDTDVVIFDVLGDVVCGGFAALQHADQAVVVTANDFDSIYAMNRIIAAVQAKSKNYK----VRLAGCVANRSRATDE------VDRFCKETNFRRL-AHMPDLDAIRRSRLKKKTLFEMDEDQDVLAEYIRLAESLWRG................. 279
17 -41.8002ynm_A mol:protein length:301 LIGHT-INDEPENDENT PROTOCHLOROPHYLLIDE REDUCTASE IRON-SULFUR ATP-BINDING PROTEIN  ali model follow..  13  1.........................................................................GPLGSMTTTLANRPDGEGSVQVKLDPKVNIEEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKKVLQIGC-DPKHDSTFTLTHKMVPTVIDILEEVDFHSEELR---QDFMFEGFNGVQCVESGGPPAGTGCGGYVTGQT-------VKLLKEH--HLLEDTDVVIFDVLGDVVCGGFAALQHANYCLIVTANDFDSIFAMNRIVAAINAKAKNYK----VRLGGVIANRSAELD------QIEKFNEKTGLKTM-AHFRNVDAIRRSRLKKCTIFEMDPEEEGVLEVQNEYLSLAKKMIDN............. 280
18 -39.9003q9l_A mol:protein length:260 Septum site-determining protein minD  ali model follow..  15  1........................................................................................................MARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFAIGLRNLDLIMGCERRVVY----DFVNVIQGDATLNQALIKDKRTENLYILPASQTRDKDALTREG--------------VAKVLDDLKADFEFIVCDSPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRRAENGEEPIKEHLLLTRYNPGRVSRGDMLSMEDVLEILRIKLVGVIPEDQSVLRASNQGEPVI-LDINADAGKAYADTVERLLGE................. 249
19 -37.8003kje_A mol:protein length:254 CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC  ali model follow..  13  1..........................................................................................................MKLAVAG-KGGVGKTTVAAGLIKIMASDYDKIYAVDG-DPDSCLGQTLGLSIEEAYAITPLIEMKDEIREKTGDGGLLILNPKVDGDLDKYGRYIDDKIFLIRMGEIKKGGSQENSFLGSVVSALLDKKEAVVMDMGAGIEHLTRGTAKAVDMMIAVIEPNLNSIKTGLNIEKLAGDL--------GIKKVRYVINKVRNIKEE------KLIKKHLPEDKILGIIPYNELFIELSLKGEEIWQ--STNPAFVNLHDIYQKLRLEV................ 253
20 -35.0003cwq_A mol:protein length:209 ParA family chromosome partitioning protein  ali model follow..  20  1..........................................................................................................MIITVASFKGGVGKTTTAVHLSAYLALQG-ETLLIDG-DPNRSATG------------------------------------------------------------GKRGSLPFKVVDERQAAKYAPKYQNIVIDTQARPEDEDLELADGCDLLVIPSTPDALALDALMLTIETLQKLGNN---------FRILLTIIPPYPSKDGDEARQLLTT-AGLPLFKRGIKRYSAFQKASLNGVVVSEVSDSKAGI------AWSDYKATGKEIVEEI........ 199
21 -33.2005u1g_D mol:protein length:214 ParA  ali model follow..  20  1.........................................................................................................MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDT-DPQMSLTNWSKAGKA------------------------------AFDVFTAA-----------------------SEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQAYSRKVE-----ARFLITRKIEMA-TMLNVLKESIKD-TGVKAFRTAITQRQVYVKSILDGDSVFESSDGA---------AKGEIEILTKEIVRIF........ 205
22 -30.5001hyq_A mol:protein length:263 CELL DIVISION INHIBITOR (MIND-1)  ali model follow..  16  1........................................................................................................MVRTITVASGKGGTGKTTITANLGVALAQLGHDVTIVDADITMANLELILGMEGL-----PVTLQNVLAGEARIDEAIYVGPG--GVKVVPAGVSLEGLR----------------PEKLEDVLTQIMESTDILLLDAPAGLERSAVIAIAAAQELLLVVNPEISSITDGLKTKIVAERL--------GTKVLGVVVNRITTLGIEMAKNEIEAILEA-----VIGLIPEDPEVRRAAAYGKPVVLRSPNSPAARAIVELANYIAGGAKKK............. 239
23 -29.7004rz2_A mol:protein length:295 Site-determining protein  ali model follow..  14  6....................................................................................DQAEQLRLKLS---RLRQQPSPRTIAVTSGKGGVGKSNVSLNFSLSLSKLGFRVLLLDMDIGMGNIDILLGESSSLALAD-------WFSARLPLSELVKSGP-EHLSYIAGGTGAAQW----------QGLDTASIDRFLTELQAVASQYDYLIFDMGAGASGERLYFLKSVDDVFVVTTPEPTAMTDAYAMMKYMHAAGSEAP-------FSVIVNRA--GKEREGYEVFERLKHVTGRFLLLGIIPEDRTVARAVVSQTPFVLLDPAAKASKAVRQMAFRYAPQREEG............. 271
24 -29.4005j1j_A mol:protein length:285 Site-determining protein  ali model follow..  18  4..............................................................................................GSMKQMGSMHPVQVIAVTGGKGGVGKTNVSVNLALALADLGRRVMLLDADLGLANVDVLLGLTPKRTLAD-------VIEGRCELRDVLLLGP-GGVRIVPAASGTQSM----------VHLSPMQHAGLIQAFSDISDNLDVLVVDTAAGIGDSVVSFVRAAQEVLLVVCDEPTSITDAYALIKLLNR-------DHGMTRFRVLANMAHSPQRNLFAKLTKVTDRFLDVALYVGVIPYDESVRKAVQKQRAVYEAFPRSKASLAFKAVAQKVDSWPLPANPRGHLEFFVER. 274
25 -28.9004v02_A mol:protein length:258 SITE-DETERMINING PROTEIN  ali model follow..  15  1........................................................................................................MAEVIVITSGKGGVGKTTLTANIGTALAKLGKKVLLIDAAIGLRNLDMILGLENRIVYDILD-----VLEGRVPYEKALVKDK-RGLSLWLLPANQRANKDVIDIEKWN----------KTVEEIKNSGNYDYILVDSPAGIEKGFQIAVSPADKALIVVNPEVSSIRDADRVIGLLESM--------DKRNYKVIVNRIKWEMVKRGAMLVEDIVDILKAEIIG-IIPEEPKLVDFTNRGEPIV-LDEKFPASQAIIDTARRLMGE................. 242
26 -28.9003ea0_A mol:protein length:245 ATPase, ParA family  ali model follow..  14  1......................................................................................................SNAKRVFGFVSAKGGDGGSCIAANFAFALSQEDIHVLAVDISLPFGDLDMYLSGNTH-----SQDLADISNASDRLDKSLLDTHISPSLDLIPSPATFEKIVNIEPER-------------VSDLIHIAASFYDYIIVDFGASIDHVGVWVLEHLDELCIVTTPSLQSLRRAGQLLKLCKEFEKPISR------IEIILNRADTNSRITSDEIEKVI----GRPISKRIPQDEDAMQESLLSGQSVLKVAPKSQLSKTIVDWALHLN................... 243
27 -22.9004jmp_A mol:protein length:269 C-terminal fragment of CapA, Protein tyrosine kinase  ali model follow..  12  56.......................................................................................EKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDMRKPTQHYIFNLPNNEGLSS-------LLLNWSTYQDSIISTEIEDLDVLTS------------GPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLFSKTGNVVYVVNSENNNKDEVKKGKELIEATGAKL--------LGVVLNRMPKDKSA.............................................................................. 252
28 -22.6004jlv_A mol:protein length:269 C-terminal fragment of Membrane protein CapA1, Putative uncharacterized protein capB1  ali model follow..  16  58.......................................................................................EKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDMRKPTQNYIFNEQNNNGLSS-------LIIGRTTMSEAITSTEIENLDLLTA------------GPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLYARIKDSLLVIDNEKNDKNEVKKAKALMEKAGSNI--------LGVILNKTKVDKSS.............................................................................. 254
29 -22.6003cio_A mol:protein length:299 Tyrosine-protein kinase etk  ali model follow..  18  75......................................................................................VEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSE-------YLAGKDELNKVIQHFGKGGFDVITR------------GQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNI--------KGAILNGVIKRAST.............................................................................. 272
30 -22.5002ved_A mol:protein length:271 MEMBRANE PROTEIN CAPA1, PROTEIN TYROSINE KINASE  ali model follow..  12  58.......................................................................................EKFRGIRSNIMFANPDSAVQSIVITSEAPGAGMSTIAANLAVAYAQAGYKTLIVDGDMRKPTQHYIFNLPNNEGLSS-------LLLNWSTYQDSIISTEIEDLDVLTS------------GPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLFSKTGNVVYVVNSENNNKDEVKKGKELIEATGAKL--------LGVVLNRMPKDKSA.............................................................................. 254
31 -22.0003la6_A mol:protein length:286 Tyrosine-protein kinase wzc  ali model follow..  15  67......................................................................................IEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGMTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSE-------ILIGQGDITTAAKPTSIAKFDLIPR------------GQVPPNPSELLMSERFAELVNWASKNYDLVLIDTPPILAVTDAAIVGRVGTTLMVARYAVNTLKEVETSLSRFEQNGIPV--------KGVILNSIFRRASA.............................................................................. 264
32 -20.7003fkq_A mol:protein length:373 NtrC-like two-domain protein  ali model follow..  12  133.....................................................................................................ENDKSSVVIFTSPCGGVGTSTVAAACAIAHANMGKKVFYLN-IEQCGTTDVFFQAEGNATMSDVIYSLKSRKANLLLKLESCIKQSQEGVSYFSSTKVALDILE--------------SYADIDTLIGNIQGNYDEIIVDLPFSLEIEKLKLLSKAWRIIVVNDGSQLSNYKFMRAYESVVLLEQN-DDINIIRNMNMIYNKFSNKNSEMLSNISIKTIGGAPRYEHATVRQIIEALTKMEFFEEIL........................................ 366
33 -20.2003vx3_A mol:protein length:248 ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog  ali model follow..  13  20..........................................................................................................RIIPVVSGKGGVGKSLVSTTLALVLAEKGYRVGLLDLDFHGASDHVILGFEPKEFPEEDRG---------------VVPPTVHGIKFMTIAYYTEDRPTPLRGKEISD--------ALIELLTITRDELDYLVIDMPPGLG-LDVLRFLKRGEFLVVATPSKLSLNVVRKLIELLKEE--------GHKVIGVVENMKLRSEQLDDEKDVEKLAEEFGVPYLVG-IPFYPDLDAKVGNVEEL----MKTEFAGKVRELAGRL.................... 248
34 -19.7002ph1_A mol:protein length:262 Nucleotide-binding protein  ali model follow..  13  19..........................................................................................................SRIAVMSGKGGVGKSTVTALLAVHYARQGKKVGILDADFLGPSIPILFGLRNARIAVSAEGLEPVLTQKY-------------GIKVMSMQFLLPKENTPVI-------RGPLIAGMIREFLGRVAGELDHLLIDLPPGTG-LTVMQDAKPTGVVVVSTPQELTAVIVEKAINMAEETNTSV--GLVENMSYFVCPNCGHKSYIFGEGKGESLAKKYNIGFFTS-IPIEEELIKLADSGRIEEYEKDWFESAPFL........................... 255
35 -19.3003kb1_A mol:protein length:262 Nucleotide-binding protein  ali model follow..  13  19..........................................................................................................FRIAVMSGKGGVGKSTVTALLAVHYAKQGKKVGILDADFLGPSIPHLFGLEKGKVAVSDEGLEPVLTQRL-------------GIKVMSIQFLLPKRETPVIWRGPLIAG------MIREFLGRVAGELDYLLIDLPPGTG-LTVMQDAKPNGAVIVSTPQELTAAVVEKAITMAEQTKTAV--GIVENMAYFECPNCGERTYLFGEGKASELARKYKIEFITE-IPIDSDLLKLSDLGRVEE-YEPDWFEFFPYLE......................... 256
36 -17.3003iqw_A mol:protein length:334 Tail-anchored protein targeting factor Get3  ali model follow..  13  12.....................................................................................................DQRSLRWIFVGG-KGGVGKTTTSCSLAIQLAKVRRSVLLL-STDPAHNLSDAFSQKEARLVEGFDNLYAMEIDPNGSMQDLLAGQTGDGDAGMGGVGVMQDLAYAIPGIDE--------AMSFAEVLKQVNSSYETIVFDTAPT----TLRFLQFPTVLEKALAKVSQLSGQYGSLLNGILGGSGTLPNGQTLSDVMEKLDSLRVTISEVNAQFKDERLTTF----VCVCIPEFLSLYETERMIQELANYG.................................... 250
37 -16.8003zq6_A mol:protein length:324 PUTATIVE ARSENICAL PUMP-DRIVING ATPASE  ali model follow..  15  16............................................................................................................FVFIGGKGGVGKTTISAATALWMARSGKKTLVIS-TDPAHSLSDSLEREIGHTPTKITENLYAVEIDPEVAMEEYQAKLQEQAAMNPGMGLDMLQDQMDMASMSPGIDEAAAFDQFLRYMTT--DEYDIVIFDTAPT----TLRLLSFPEIMDSWVGKMIKIRRQIGSMAKAFKNILPFMGDEEEEDRALQDMEATKKQINAAREVMSDPERTSF----KMVVIPEEMSIYESERAMKALEKYS.................................... 250
38 -16.5003a36_A mol:protein length:362 ATPase GET3  ali model follow..  15  20............................................................................................................WIFVGGKGGVGKTTSSCSIAIQMALPNKQFLLIS-TDPAHNLSDAFGEK--MEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMK-HIKRQEQDEGETFDTVIFDTAPT----TLRFLQLPNTL----------LEKFGEITNKLGPMLNSFMGAGNVDISGKL-----NELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYD.................................... 263
39 -16.3003ibg_A mol:protein length:348 ATPase, subunit of the Get complex  ali model follow..  12  22.....................................................................................................SQKTLRWIFVGG-KGGVGKTTTSCSLAIQLAKVRKSVLLI-STDPAHNLSDAFGQKEARLVDGYSNLSAMEIDPNGSIQDLLASGDSQGDDPLAG-----LGMGNMMQDLAFSIPGVDEAMSFAEVLKQVKSSYEVIVFDTAPT----TLRFLQFPTVLEKALAKLSQLSSQFGPMLNSILGARGGLPGGQNIDELLQKMESLRETISEVNTQFKNPDMTTF----VCVCIAEFLSLYETERMIQELTSYG.................................... 263
40 -16.1005bw8_A mol:protein length:373 ATPase GET3  ali model follow..  15  33............................................................................................................WIFVGGKGGVGKTTSSCSIAIQMALPNKQFLLIS-TDPAHNLSDAFGEK--MEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMK-HIKRQEQGEGETFDTVIFDTAPT----TLRFLQLPNTL----------LEKFGEITNKLGPMLNSFMGAGNVDISGKL-----NELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYD.................................... 276
41 -15.9003ug6_A mol:protein length:349 arsenical pump-driving ATPase  ali model follow..  12  28............................................................................................................YIMFGGKGGVGKTTMSAATGVYLAEKGLKVVIVS-TDPAHSLRDIFEQEEPTKVKGYDNLYVVEIDPQKAMEEYKEKLKAQ------EENPFLGEMLEDQLEMAALSPGTDESAAFDVFLKYMDSEFDVVIFDTAPT----TLRFLGMPEVMDKYMTKLIKLRKQMSGFMKMMKKLLPFGGKDEDIDYDKMLEELEKMKER---VRARNILSDPERTAFRLVVIPEEMSILESERAMKAIVNQLIPEDVQCDFCRARRELQLKRLEMIKEKF........ 304
42 -15.8002woo_A mol:protein length:329 ATPASE GET3  ali model follow..  12  21............................................................................................................WIFVGGKGGVGKTTTSCSLAIQMSKVRSSVLLIS-TDPAHNLSDAFGTKDARKVPGFDNLSAMEIDPNLSIQEMTEQA---------DQQNPNNPLSGMMQDLAFTIPGIDEALAFAEILKQIKSEFDCVIFDTAPT----TLRFLNFPTVL----------LGKLGGLSSRFGPMINQMGSIMGVNANEQDLFGKMESMRANISEVNKQFKNPDLTTFVCVCISEFLSLYETERMIQELTSYELDPNTTCPQCMARRKMQQKYLAQIEELY........ 289
43 -15.7003igf_A mol:protein length:374 All4481 protein  ali model follow..  1........................................................................................................MALILTFLG-KSGVARTKIAIAAAKLLASQGKRVLLAG--LAEPVLPLLLEQTLTPDPQQIAPNLEVVQFQSSVLLERNWEEVKKLEAQYLRTPIIKEVYGQELVVLPGMDSALALNAIREYD----SGKYDTIVYDGTGD----TLRMLGLPESLFRQLFVNSDLGKTIAESPLIQPLISSFFNVNWTADNFAQPTNQVNNF-----DKGKEALADPKRVAAFLVTTADPLEVVSVRYLWGSAQQIGLTIGGVIQVSSQTEGDLSAEFTPL............ 266
44 -15.6003idq_A mol:protein length:369 ATPase GET3  ali model follow..  15  20............................................................................................................WIFVGGKGGVGKTTSSCSIAIQMALPNKQFLLIS-TDPAHNLSDAFGEK-CMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMK-HIKRQEQGEGETFDTVIFDTAPT----TLRFLQLPNTL----------LEKFGEITNKLGPMLNSFMGAGNVDISGKL-----NELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYD.................................... 263
45 -15.3003io3_A mol:protein length:348 DEHA2D07832p  ali model follow..  13  14.....................................................................................................QHDSLKWIFVGG-KGGVGKTTTSSSVAVQLALPNEQFLLI-STDPAHNLSDAFCQKDARKVEGLPNLSCMEIDPEAAMSDLQQQASQYNNDPNDPLKSMMSDMTGSIPGIDEALSKHIKNQKVLEGEDNSNASYKTIIFDTAPT----TLRFLQLPSTL----------LSKFKDLSGKLGPMLSMMGGGQQQDIFEKL-----NEVQKNVSEVNEQFTNPELTTFICVCISEFLSLYETERMIQELMSYN.................................... 259
46 -14.4001f48_A mol:protein length:589 ARSENITE-TRANSLOCATING ATPASE  ali model follow..  13  10............................................................................................................YLFFTGKGGVGKTSISCATAIRLAEQGKRVLLVST-DPASNVGQVFSIGNTIQAIASVPGLSALEIDPQAAAQQYRARIVDPIKGVLPDDVVSSINEQLSGACTTEIAAFDEFTGLLTDASL-LTRFDHIIFDTAPTIRLLQLPGAWSS-DSNPEGASCLGPMAGLEKQREQYAYAVEALSDPKRTRL--VLVARLQKSTLQEVARTHLELAAI-QYLVINGVLPKTEAANDTLAAAIWEREQEALANLPADLAGLPTDTLFLQPVNM............ 282
47 -11.7005hci_A mol:protein length:261 GPN-loop GTPase 1  ali model follow..  10  11...................................................................................................................AGSGKTTFMQRLNSHLRAEKTPPYVIN-LDP---AVLRVPYGANIDIRDSIKYKKVM----------------ENYQLGPNGAIVTSLNLFSTKIDQ-----------VIRLVEQKKDKFQNCIIDTPGQIECFVTESFASSFPTVIAYIVDTPRNSSPTTFMSNM--YACSILYKTKLPMIVVFTDVCKADFAKEWMTDFESFQAAIKEDQDGYMSSLVNSMSLMLEEFYSQLDVVGVSSFTGDGFDEFMQCVDKKVDEYDQY......... 252
48 -10.6001yr6_A mol:protein length:262 ATP(GTP)binding protein  ali model follow..  2....................................................................................................RGSGMASMIVVFVGTAGSGKTTLTGEFGRYLE-DNYKVAYVN-LDT---GVKELPYEPSIDVREFVTVEEIMRE------------------YGPNGAIVESYDRLMEKFNE-----------YLNKILRLEKENDYVLIDTPGQMETFLFHEFGVMENLPYPLVVYISDPEILKKPNDYCFVRFFALLIDLRLGATTIALNKVDLLSEEEKERHRKYFEDI--DYLTARLKLDPSMQGLMAYKMCSMMTEVLPPVRVLYLSAKTREGFEDLETLAYEHY........ 249
49 -9.3801g8y_A mol:protein length:279 REGULATORY PROTEIN REPA  ali model follow..  12  32............................................................................................................VGALVSPGGAGKSMLALQLAAQIALPTGPVIYLPAEDPPTAI-------------------------HHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAPE---------WFDGLKRAAEGRRLMVLD--------TLRRFHIEEE----------ASGPMAQVIGRMEAIAADTGCS--------IVFLHHASKGAAMMGAGDQQQASRGSSVLVDNIRWQSYLSSMTSAEAEEWGVDDDQRRFFVRFGVSKANYGAPFADR............ 250
50 -9.0702obn_A mol:protein length:349 Hypothetical protein  ali model follow..  12  124.............................................................................LQPGQLIWDVRKEPANLDVASGAARTLPCRRVLTVGTDMAIGKMSTSLELHWAAKLRGWRSKFL-ATGQTGVMLEGDGVA---------------------------------LDAVRVDFAAGAVE---------------------QMVMRYGKNYDILHIEGQGSLSTATLPLIRGSTQLVLVHRAG-VPIPPLPEVIRLYETVASGGGAFGTVPVVGIALNT-AHLDEYAAKEAIAHTIAETGLPCTDVVRFGADVLLDA............................................... 345

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 0 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.