current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|16082710|ref|NP_395156.1| YopT chaperone (YPCD1.21) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MQTTFTELMQQLFLKLGLNHQVNENDVYTFTFEVDGHIQVLIACYHQQWVQLFSELGADLPTNDNLFGEHWPAHVQGRLDGKPILWSQQSLVGLDIDEMQAWLERFIDDIEQRKEPQNTKFQPNSTSPILFILast
1 -57.2002bho_A mol:protein length:130 CHAPERONE PROTEIN SYCT  ali model follow..  98  1MQTTFTELMQQLFLKLGLNHQVNEND--VYTFEVDGHIQVLIACYHQQWVQLFSELGADLPTNDNLFGEHWPAHVQGRLDGKPILWSQQSLVGLDIDEMQAWLERFIDDIEQRKEPQNTKFQPNSTSPILFI 130
2 -53.1002bsj_A mol:protein length:133 CHAPERONE PROTEIN SYCT  ali model follow..  96  4GQTTFTELMQQLFLKLGLNHQVNEND--VYTFEVDGHIQVLIACYHQQWVQLFSELGADLPTNDNLFGEHWPAHVQGRLDGKSILWSQQSLVGLDIDEMQAWLERFIDDIEQRKEPQNTKFQPNSTSPILFI 133
3 -41.5003epu_A mol:protein length:144 STM2138 Virulence Chaperone  ali model follow..  17  1MYSRADRLLRQFSLKLNTDSIVFDENR-LCSFIIDNRYRILLTSTNSEYIMIYGFCGKFEFLNANLWFAENPHLCYDNNSQSLLLALNFSLNESSVEKLECEIEVVIRSMENLYHILQDKGITLDTDYT... 138
4 -40.5004jmf_B mol:protein length:116 Probable chaperone  ali model follow..  23  1MNPLYRAAIHQLFLALDLPTPNDEESVLSLQV---GPHLCHLAEHPTDHLLMFTRLEGATANEQNLFSQDPPILGRDPESGERLLWNRQPLQLLDRAQIHHQLEQLVAAAEELR.................. 116
5 -39.3001l2w_A mol:protein length:123 YopE regulator  ali model follow..  21  1MGYSFEQAITQLFQQLSLSIPDTIEPVIGVKV---GEFACHITEHPVGQILMFTLPSLETLLSHNIFSQDIPILSWDEVGGHPVLWNRQPLNSLDNNSLYTQLEMLVQGAERLQTSS............... 122
6 -39.3001k3e_A mol:protein length:156 CesT  ali model follow..  11  1MSSRSELLLEKFAEKIGIGSISFNENR-LCSFAIDEIYYISLSDANDEYMMIYGVCGKLEILNANLWFAENPYLCYEAGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLENEHM... 139
7 -39.0004gf3_A mol:protein length:141 Putative yopH targeting protein  ali model follow..  17  1.MRTYSSLLEEFATELGLEEIETNELG-HGAVTIDKIWVVHLAPINEKELVAFMRAGIYDILRKNLFSPLSGVIRCADKDDHWLLWSQLNINDTSGTQLASVLTSLVDKAVTLSCEPTMKKEEDDHRPS... 135
8 -38.1001n5b_A mol:protein length:132 YOPE regulator  ali model follow..  19  1.MYSFEQAITQLFQQLSLSIPDTIEPVIGVKV---GEFACHITEHPVGQILMFTLPSLETLLSHNIFSQDIPILSWDEVGGHPVLWNRQPLNNLDNNSLYTQLEMLVQGAERLQTSSLISPPRSFSP..... 131
9 -37.9005z38_A mol:protein length:158 CesT protein  ali model follow..  11  3MSSRSELLLDRFAEKIGVGSISFNENR-LCSFAIDEIYYISLSDANDEYMMIYGVCGKLEILNANLWFAENPYLCYESGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLENEHM... 141
10 -37.0001s28_A mol:protein length:132 ORF1  ali model follow..  17  3MKNSFDRLIDGLAKDYGMPGFPEKKHEHEVYCFEFKEVSIRIYQDKFKWVYFLSDIGVQSLLRLNEFNLRTPFFTVGNEKKDGVVHTRIPLLNLDNVEMRRVFEALLNLSGEVKKTFGF............. 131
11 -36.6001k6z_A mol:protein length:141 Type III secretion chaperone SycE  ali model follow..  19  6.MYSFEQAITQLFQQLSLSIPDTIEPVIGVKV---GEFACHITEHPVGQILMFTLPSLETLLSHNIFSQDIPILSWDEVGGHPVLWNRQPLNSLDNNSLYTQLEMLVQGAERLQTSSLISPPRSFS...... 135
12 -36.1005wez_A mol:protein length:139 Tir chaperone  ali model follow..  11  1MASRSELLLDRFAEKIGVGSISFNENR-LCSFAIDEIYYISLSDANDEYMMIYGVCGKLEILNANLWFAENPYLCYESGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLENE..... 138
13 -32.6004g6t_A mol:protein length:128 Type III chaperone protein ShcA  ali model follow..  12  4MSLFYKTLLDDFSRSLEMQPLVFDDHG-TCNMIIDNTFALTLSCDYAERLLLIGLLEPQCLLAGALNPLLNPGLGLDEKSGLYHAYQSIPREKLSVPTLKREMAGLLEWMRGWREA................ 128
14 -32.5003kxy_A mol:protein length:133 Exoenzyme S synthesis protein C  ali model follow..  14  3LTSKVNRLLAEFAGRIGLPSLSLDEEG-MASLLFDEQVGVTLLLLAEERLLLEADVVGRQLASFNRHHRFDLHFGFDELTGKVQLYAQILAAQLTLECFEATLANLLDHAEFWQRLLPCAS........... 133
15 -27.7001xkp_C mol:protein length:143 Chaperone protein yscB  ali model follow..  15  1....MQNLLKNLAASLGRKPFVADKQG-VYRLTIDK-HLVMLAP-HGSELVLRTPIDARSLMQQALAWAKRYPQTLVDDCGQLVLEARLRLQELDTHGLQEVINKQLALLEHLIPQLTPFSVASRVGWN... 137
16 -26.1001jyo_A mol:protein length:130 SicP  ali model follow..  13  1.LQAHQDIIANIGEKLGLP---TFDDNNQCLLLLDSDIFTSIEA-KDDIWLLNGMIIPRQIMVINGELAANGTLAYIDAAETLLL-IHAITDLTNTYHIISQLESFVNQQEALKNILQEYAK.......... 129
17 -18.2001xkp_B mol:protein length:124 Chaperone protein sycN  ali model follow..  1.MSWIEPIISHFCQDLGVPTSSPLSP--LIQLEMAQSGTLQLEQHGATLTLWLADAMVKALTLTAAQKSGALPLRAGLGESQLVLFVSLDERSLTLPLLHQAFEQLLRLQQEVLA................. 122
18 -17.1002plg_A mol:protein length:163 Tll0839 protein  ali model follow..  24AVEIIETVISSLHQGDAPLVGQTDSGKIWMFRYGSAEVFVQLSHTEEDFLTIWSPVLPRKLLTLNWLTTFEAHFAIA--EEQVQVVASRTLGGITAGEISRLITIVATLADDYDDALRAE............ 152
19 -9.5901k3s_A mol:protein length:113 SigE  ali model follow..  15  1....MESLLNRLYDALGLDAPEDEP-----LLIIDDGIQVYF-NESDHTLEMCCPFMPQHFLRLNY--TSAVTIGADADNTALVALYRLPQTS-TEEEALTGFELFISNVKQLKEHYA.............. 113
20 -9.5002fm8_A mol:protein length:135 Surface presentation of antigens protein spaK  ali model follow..  15  2QHLDIAELVRSALEVSGCDPSLIGDSHSTIVLDLFALPSICIS-VKDDDVWIWAQLGADMTIMEGCHFARGGQLLLGEQNGELTLKALVHPDFLDGEKFSTALNGFYNYLEVFSRSLMR............. 135

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 0 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.