current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|16082715|ref|NP_395161.1| secreted effector protein (YPCD1.26c) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .
# Score Template Links and tools%idFirst MFINPRNVSNTFLQEPLRHSSNLTEMPVEAENVKSKTEYYNAWSEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNSLTELPELPQSLKSLLVDNNNLKALSDLPPLLEYLGVSNNQLEKLPELQNSSFLKIIDVDNNSLKKLPDLPPSLEFIAAGNNQLEELPELQNLPFLTAIYADNNSLKKLPDLPLSLESIVAGNNILEELPELQNLPFLTTIYADNNLLKTLPDLPPSLEALNVRDNYLTDLPELPQSLTFLDVSENIFSGLSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALPPRLERLIASFNHLAEVPELPQNLKQLHVEYNPLREFPDIPESVEDLRMNSERVVDPYEFAHETTDKLEDDVFELast
1 -73.6001g9u_A mol:protein length:454 OUTER PROTEIN YOPM  ali model follow..  94  1MFINPRNVSNTFLQEPLRHSSNLTEMPVEAENVKSKTEYYNAWSEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNSLTELPELPQSLKSLLVDNNNLKALSDLPPLLEYLGVSNNQLEKLPELQNSSFLKIIDVDNNSLKKLPDLPPSLEFIAAGNNQLEELPELQNLPFLTAIYADNNSLKKLPDLPLSLESIVAGNNILEELPELQNLPFLTTIYADNNLLKTLPDLPPSLEALNVRDNYLTDLPELPQSLTFLDVSENIFSGLSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALPPRLERLIASFNHLAEVPELPQNLKQLHVEYNPLREFPDIPESVEDLRMNSHLAEVPELPQNLKQLHVETNPLR 409
2 -60.9004ow2_A mol:protein length:448 Yop effector YopM  ali model follow..  48  2..................SKTEYYNAWSEWERNAPPGNGEQREMAVS----------------RLRDCLDRQAHELELNNLGLSSLPELPPHLERLVASCNSLTELPELPQSLKSLEVYENNLKALPDLPPLLVDLRVFNNQLEELPELQNLPFLTEIYANNNSLKTLPDLPPSLVDLNVRENYLTALPELDLPPSLVYLDVRDNQLIELPALPSGLERLIASFNHLAELPELDLPPSLVDLNVRKNQLIELPALPPDLERLIASFNHLAELPELPPNLSYLDASRNEISSLCDLPPSLVDLNVRKNQLIELPALPPDLERLIASFNHLAELPELPPNLSYLDASRNEISSLCDLPPSLVELDVRDNQLIELPALPPHLERLIASLNHLAEVPEPQNLKQLHVEHNALR 433
3 -51.6003g06_A mol:protein length:622 SspH2 (Leucine-rich repeat protein)  ali model follow..  29  3.................................................................................................VDPAEYDAVWSAWRRAAPAEESRGRAAVVQKMRNGNAVLNVGESGLTTLPD-CLPAHITTLVIPDNNLTSLPALPPELRTLEVSGNQLTSLPVPPGLLELSIFSNPLTHLPALPS---GLCKLWIFGNQLTSLPVL--PPGLQELSVSDNQLASLPALPSELCKLWAYNNQLTSLPMLPSGLQELSVSDNQLASLPTLPSELYKLWAYNNRLTSLPALPSGLKELIVSGNRLTSLPVLPSELKELMVSGNRLTSLPMLPSGLLSLSVYRNQLTRLPESLIHLSSVNLEGNPLSE.................. 298
4 -46.1004ecn_A mol:protein length:876 Leucine-rich repeat protein  ali model follow..  15  336KGRVPDAIGLTELKVLSFGTHSETVSGRLFGDEELTPDMSEERKHRIRMHYKKM---NRITFISKAIQRLTKLQIIYFANSPFTYDNIAVDWEDANSDYAKQYENEELSWSNLKDLTDVELNCPNMTQLPPELQSLNIACNRGISAAQEDTGPKIQIFYMGYNNLEEFPASMVKLGLLDCVHNKVRHLEAFGTNVKLTDLKLDYNQIEEIPEFTDQVEGLGFSHNKLKYIPNAKSVYVMGSVDFSYNKIGSEGRNISNASTVTLSYNEIQKFPTELSPISTIILSNNLMTSIPENTYLLTTIDLRFNKLTSLSDTLPYLSNMDVSYNCFSSFPTQPLNSSQLKAGNRILRQWPTGITSLIQLQIGSNDIRKVDKLTPQLYILDIADNPNISIDPYIEAGMYVLLYDKTQ 864
5 -44.5004u09_A mol:protein length:401 LIC12759  ali model follow..  23  2................EEIQKPYKNLAKALQNPADVRNLDLSFQGL-KTLPNKIGQL-------------KNLQKLDLGGNEPTILSKEIWDLQKLNLNNNKLTVLPKEIGQLQNLQELSLHSNELVNLPKNLQKLNLDNNKLTVLPEIGQLQNLQELSLLSNKLISLPTEIESLKNLDLNHNEFTTVSEVMLLETLENLDLRSNKLKTIPKEIRSLKVLMLTGNQLTSLPEIEQLQNLKTLNLGENRFQIFPVEILNLLELNLYYNQLVEFPKEVGQLK-----------------SLKYLSLYHNQITTLPVQLPDLQELHLSGNKITILPKEILNLEWLSLSNNKLNALPKEIGKLQRLELGNNQLTTLPKEIEQLKNLQLDSNPISPKEKLLPKCEIDFEGGGGE 401
6 -44.3003j0a_A mol:protein length:844 Toll-like receptor 5  ali model follow..  18  16LTQVPQ--VLNTTERLLLSFNYIRTVTASFPFLEQLQLLELGSQYTPLTIDKEFRNLPNLRILDLGSSKIYHLFELRLYFCGLSDAVRNLKALTRLDLSKNQIRSLYPSFGKLNSLKSIDFSSNQIFLVCETLSFFSLAANSLYSRVSLILAHHIMGAGFGFHNIKDPDQNTSSVRHLDLSHGFVFSLNSFETLKDLKVLNLAYNKINKIADELDNLQVLNLSYNLLGELYSFYGLPKVAYIDLQKNHIAIIQDQLEKLQTLDLRDNALTTIHFI-PSIPDIFLSGNKLVTLPKINLTANLIHLSENRLENLDILVPHLQILILNQNRFSSCSSENPSLEQLFLGENMLQLAWETLSHLQVLYLNHNYLNSLPPGLTALRGLSLNSNRLTVLSHPANLEILDISRNQLL 539
7 -44.0004u08_A mol:protein length:398 LIC11098  ali model follow..  26  1..............QSNEAQTYYRNITEALKNPQNVRILNLSGSKL-TTLPGEIGKL-------------QNLQLLNLDDNQLIALPKEIGNLQQLHLSKNQLMALPEEIGQLQNLQKLKLYENQLTAIPKNLQELNLAHNQLATLPDIEQLQRLQTLYLGHNQFNSILKEIGNLESLGLDHNQLNVLPEIGQLRNLESLGLDHNQLNVLPKEIGNLQILHLRNNQLTTLPEIGQLQNLQKLLLNKNKLTTLPKEIGNLQKLKLYENQLTTLPKEIGNLQELDLDGNQLTTLPENIGRLQTLYLGNNQLNFLPKELRNLESLDLEHNQLNALPKEIGKLQTLNLKYNQLATLPEEIKNLKKLYLHNNPLPSKIARIRKLLPQC.......................... 392
8 -42.7004kt1_A mol:protein length:504 Leucine-rich repeat-containing G-protein coupled receptor 4  ali model follow..  21  2.PLCAAPCSCDGDRRVDCSGKGLTAVPEGL--SAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSELKVLTLQNNQLKTVPSELSALQSLRLDANHITSVPESFEGLVQLRHLWLDDNSLTEVPPTLQALTLALNKISSIPDFTNLSSLVVLHLHNNKIRSLSQHLDNLETLDLNYNNLGEFPQIKALPSLKELGFHSNSISVIPD-NPLLRTIHLYDNPLSFVGNFHNLSDLHSLVIRGASMVQQFPNLTHLESLTLTGTKISSIPN-QKMLRTLDLSYNNIRDLPSFCHALEEISLQRNQIYQIKE-LISLRILDLSRNLIHEIHS-LGPITNLDVSFNELTSFPTDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNSLQDHSVTADAANVTSTLENEE 489
9 -42.2005ijb_A mol:protein length:594 Toll-like receptor 4, Variable lymphocyte receptor B chimera  ali model follow..  16  19LSKVPDDI-PSSTKNIDLSFNPLKILSYSFSNFSELQWLDLSRCEIETIEDKAWHGLHHLSNLILTGNPIQSLENLVAVETKLASLESFLITLKKLNVAHNFIHSCPAYFSNLTNLVHVDLSYNYIQTITVVNLSLDMSLNPIDFIQDLQNLAGLHVHRLILGEFKDERNLLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPLDLPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGCCTNSLRHLDLSFNGAIIMSANLEELQHLDFQHSTLKRVTEFLEKLLYLDISYTNTKIDFDGLTSLNTLKMAGNSFKDNTANTTNLTFLDLSKCQLEQISW-LHRLQLLNMSHNNLLFLDSSLYSLKELALDTNQLKSVPDLTSLQKIWLHTNPWD 554
10 -42.1004puf_A mol:protein length:637 E3 ubiquitin-protein ligase SlrP  ali model follow..  26  1..................................................................................MRGSGSK-DAVNYELIWSEWVKEAPAKEAANREEAVQRMR----DCLKNNKTELRLKILGLTTIPA-YIPEQITTLILDNNELKSLPNLQGNIKTLYANSNQLTSIPA-TLPDTIQEMELSINRITELPERLPSLQSLDLFHNKISCLPE-NLPEELRYLSVYDNSIRTLPHLPSEITHLNVQSNSLTALPTLPPGLKTLEAGENALTSLPSLPPELQVLDVSKNQITVLPELPPTITTLDVSRNALTNLPNLPAALQIMQASRNNLVRLPESLPHFRGPQPTRIIVEYNPFSERTIQNMQ.......................... 302
11 -41.4003vq1_A mol:protein length:606 Toll-like receptor 4  ali model follow..  16  23LSKVPDDI-PSSTKNIDLSFNPLKILSYSFSNFSELQWLDLSRCEIETIEDKAWHGLHHLSNLILTGNPIQSLENLVAVETKLASLESFLITLKKLNVAHNFIHSCPAYFSNLTNLVHVDLSYNYIQTITVNNLSLDMSLNPIDFIQDLQNLAGLHVHRLILGEFKDERNLLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPTLLPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGCCTNSLRHLDLSFNGAIIMSANLEELQHLDFQHSTLKRVTEFLEKLLYLDISYTNTKIDFD-LTSLNTLKMAGNSFKDN-ANTTNLTFLDLSKCQLEQISW-LHRLQLLNMSHNNLLFLDSSLYSLSTLDCSFNRIETSKGPKSLAFFNLTNNSVA 558
12 -41.2005zsu_A mol:protein length:818 Volume-regulated anion channel subunit LRRC8A  ali model follow..  18  347........SLKKYSFESIRYSDIPDVKNDFAFMLHLIDQYDPLYSKRFAVFLSEVSENKLRQLNLNNEWTNAQDKLELHLFMLSGIPDTVFELEVLKLELIPDVTIPPSIAQLTGLKELWLYHTAAKIEAPNLRALHIKFTDIKEIPWIYSLKTLEELHLTGNLSAEVIDGLRELKRLKV-KSNLSKLPVVTDVVHLQKLSINNEGTKLIVKKMANLTELELIRCDLERIPSIFSLHNLQEIDLKDNNLKTIEEIISRLTCLKLWYNHIAYIPIQITNLERLYLNRNKIEKIPTQLRKLRYLDLSHNNLTFLPADLQNLQNLAITANRIETLPPELRKLRALHLGNNVLQSLPSRVGNLTQIELRGNRLECLPVELGECPLLKVEEDLFNTLPERLWRADKEQAGTEN. 814
13 -41.0004li1_B mol:protein length:432 Leucine-rich repeat-containing G-protein coupled receptor 4  ali model follow..  20  10....PAPCACDLDGGADCSGKGLVTVPDGL--SVFTHSLDLSMNNITKLPEGAFKGF-------------PYLEELRLAGNDLSIIHPMLKELKVLTLQNNQLKTVPESLKGLVSLQSLRLDANHIVTVPEQLRHLWLDDNSLTEVPILSNLPSLQALTLALNKISHIPD-LSSLVVLHLHNNKIRTLGPFHGLDNLEALDLNYNNLIDFPDSLPNLKELGFHSNSITIIPDFVKNPLLRTIHLYDNPLSFVGNSLSDLHFLIIRGASNVQWFPNTNNLESLTLTGTKIRSIPI-QKMLRTLDLSYNEISALVGFCSSLEEVYLQNNQIQEVQN-LAALRMLDLSRNRIHTIHK-LKALTNLDLSFNDLTAFPTGLHGLNQLKLTGNPNFKET................ 430
14 -40.7002z7x_A mol:protein length:549 Toll-like receptor 2, Variable lymphocyte receptor B  ali model follow..  17  1......SLSCDRNGICKGSSGSLNSIPSGL--TEAVKSLDLSNNRITYISNSDLQRCVNLQALVLTSNGINSLEHLDLSYNYLSNLSSSLSSLTFLNLLGNPYKTLGELFSHLTKLQILRVGNMDTFT--TFLEELEIDASDLQSYEPLKSIQNVSHLILHMKQHILLLEITSSVECLELRDTDLDTFHEFDDCTLNGVGNFRASDNDRVIDPTLTIRRLHIPRFYLFYDLSYSLTERVKRITVENSKVFLVPQHLKSLEYLDLSENLMVEEYDAWPSLQTLILRQNHLASLEKTLKNLTNIDISKNSFHSMPETPEKMKYLNLSSTRIHSVTGIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLMTLPDLLPMLLVLKISRNQLKSVPDLTSLQKIWLHTNPWD 510
15 -40.4005d3i_A mol:protein length:568 Toll-like receptor 2  ali model follow..  17  3....QESLSCDASGVCDGRSRSFTSIPSGL--TAAMKSLDLSFNKITYIGHGDLRACANLQVLILKSSRINSLEHLDLSDNHLSSLSSSLSSLKYLNLMGNPYQTLGSLFPNLTNLQTLRIGNVETFS--TSLNELEIKALSLRNYQSLKSIRDIHHLTLHLSESAFLLEILSSVRYLELRDTNLARFQSFNELLKLLRYILELSEVEFDD-ETVTIRRLHIPQFYLFYDLSYSLLEKVKRITVENSKVFLVPQHLKSLEFLDLSENLMVEEYGAWPSLQTLVLSQNHLRSMQKTLKNLTSLDISRNTFHPMPDSPEKMRFLNLSSTGIRVVKTIPQTLEVLDVSNNNLDSFSLFLPRLQELYISRNKLKTLPDAFPVLLVMKIRENAVSTFSKFPKLETLEAGDNHFV 514
16 -40.1003a79_A mol:protein length:580 Toll-like receptor 2, Variable lymphocyte receptor B  ali model follow..  16  29........SCDASGVCDGRSRSFTSIPSGL--TAAMKSLDLSFNKITYIGHGDLRACANLQVLILKSSRINSLEHLDLSDNHLSSLSSSLSSLKYLNLMGNPYQTLGSLFPNLTNLQTLRIGNVETFSE-TSLNELEIKALSLRNYQSLKSIRDIHHLTLHLSESAFLLEILSSVRYLELRDTNLARFQSFNELLKLLRYILELSEVEFDDCTTVTIRRLHIPQFYLFYDLSYSLLEKVKRITVENSKVFLVPQHLKSLEFLDLSENLMVEEYGAWPSLQTLVLSQNHLRSMQKTLKNLTSLDISRNTFHPMPDSPEKMRFLNLSSTGIRVVKTIPQTLEVLDVSNNNLDSFSLFLPRLQELYISRNKLKTLPDLFPVLLVMKIASNQLKSVPDLTSLQKIWLHTNPWD 536
17 -39.8005yq5_A mol:protein length:430 Osteomodulin  ali model follow..  17  1.................MRVLVLLACLAASNAGSQYETYQWDEDYDQEPDDDYQTGFPFRQNVDYGVPFTNFPSSMYCDNRKLKTIPNIPMHIQQLYLQFNEIEAVTNSFINATHLKEINLSHNKIKSQKPNLLQLHLEHNNLEEFP-FPLPKSLERLLLGYNEISKLQTNLVNLTMLDLCYNYLHDSKIFAKMEKLMQLNLCSNRLESMPPLPSSLMYLSLENNSISSIPEFDKLPKLHTLRMSHNKLQDIPYNLPNIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNL-YHHLTYIRVDQNKLKEPISSFPHIHTIYYGEQRSTNGQTIFPDDDDESEDHDDPDNAHESPGAEGHFDLHYYENQEAAA................................... 422
18 -39.5003oja_A mol:protein length:487 Leucine-rich Immune Molecule 1  ali model follow..  14  1.AIHEIKQNGNRYKIEKVTDSSLKQAASLRQSAWNVKELDLSGNPLSQISAADLAPF-------------TKLELLNLSSNVLYETLDLLSTLRTLDLNNNYVQELLVGP-SIETLHAANNNISRVSSRGQGKKNIYLANNKITMLRDEGCRSRVQYLDLKLNEIDTVNASSDTLEHLNLQYNFIYDVKGQVVFAKLKTLDLSSNKLAFMGPEAAGVTWISLRNNKLVLIEKLRFSQNLEHFDLRGNGFHCGTLFSKNQRVQTVAKQTVKKLTGQCTVPTLGHYGAYCCEDLPPFADRLIALKRKEHALLSGQERLECERENQARQREIDALKELDEQVSNGRRAHAELDGTLQQAVELQHATEEQSPLQLLRAIVKRYEEMYVEQQSVQN.................. 431
19 -39.3004bsr_A mol:protein length:539 LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUPLED RECEPTOR 5  ali model follow..  22  30........DGRMLLRVDCSDLGLSELPSNL--SVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTSLKVLMLQNNQLRHVPTELRSLQSLRLDANHISYVPPCFSGLHSLRHLWLDDNALTEIPSALQAMTLALNKIHHIPDFGNLSSLVVLHLHNNRIHSLGKKLHSLETLDLNYNNLDEFPTIRTLSNLKELGFHSNNIRSIPEKNPSLITIHFYDNPIQFVGRFQHLPELRTLTLNGASQITEFPDTANLESLTLTGAQISSLPQ-LPNLQVLDLSYNLLEDLPSFCQKLQKIDLRHNEIYEIKV-LLSLRSLNLAWNKIAIIHP-LPSLIKLDLSSNLLSSFPTGLHGLTHLKLTGNHALQSLPELKVIEMPYAYQCCAFGVCENQWNKGDNSSMDDLH 494
20 -39.2005mx0_A mol:protein length:362 Fibromodulin  ali model follow..  23  4........................................................................AQYEDDPHWWFHYLRQQSTSSDPSDPSPSETSEPPSGVDEGPASTSGSPSPPDPRDCPQFPTAMYCDNRNLKYLPF--VPSRMKYVYFQNNQITSIQE-ATGLLWIALHGNQITSDKVFSKLRHLERLYLDHNNLTRMPPLPRSLRELHLDHNQISRVPNLEGLENLTALYLQHNEIQEVGSSLRSLILLDLSYNHLRKVPDLPSALEQLYMEHNNVYTVPD-APKLLYVRLSHNSLTNNG-NSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSI-FSKLQVLRLDGNEIKRSAMPADAPLCLR.......................... 355
21 -39.1004ufr_A mol:protein length:484 LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUPLED RECEPTOR 5  ali model follow..  21  15........DGRMLLRVDCSDLGLSELPSNL--SVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTSLKVLMLQNNQLRHVPTELRSLQSLRLDANHISYVPSCFSGLHSLRHLWLDDNALTEIPSALQAMTLALNKIHHIPDFGNLSSLVVLHLHNNRIHSLGK-LHSLETLDLNYNNLDEFPTIRTLSNLKELGFHSNNIRSIPEKNPSLITIHFYDNPIQFVGRFQHLPELRTLTLNGASQITEFPDTANLESLTLTGAQISSLPQTLPNLQVLDLSYNLLEDLPSFCQKLQKIDLRHNEIYEIKV-LLSLRSLNLAWNKIAIIHPNLPSLIKLDLSSNLLSSFPTGLHGLTHLKLTGNHALQSLISFPELKVIEMPYAYQCCAFGGNNGDSVQCSPS... 472
22 -38.9004kng_A mol:protein length:531 Leucine-rich repeat-containing G-protein coupled receptor 5  ali model follow..  20  14........DGRMLLRVDCSDLGLSELPSNL--SVFTSYLDLSMNNISQLLPNPLPSL-------------RFLEELRLAGNALTYIPK-LYSLKVLMLQNNQLRHVPEALQNLRSLQSLRLDANHISYVPPSLRHLWLDDNALTEIPVFRSLSALQAMTLALNKIHHIPD-LSSLVVLHLHNNRIHSLGKFDGLHSLETLDLNYNNLDEFPTALSNLKELGFHSNNIRSIPEFVGNPSLITIHFYDNPIQFVGRSLPELRTLTLNGASQITEFPDTANLESLTLTGAQISSLPQ-LPNLQVLDLSYNLLEDLPSFCQKLQKIDLRHNEIYEIKV-LLSLRSLNLAWNKIAIIHP-LPSLIKLDLSSNLLSSFPTGLHGLTHLKLTGNHALQSLELKVIEMPYAYQCCAF 453
23 -38.6005il7_A mol:protein length:447 Rab family protein  ali model follow..  22  37.YKLDKDQRVTAIGLYDCGSDTLDRIIQPLESLKSLSELSLSSNQITDISPLA---------------SLNSLSMLWLDRNQITDIAPLLNSLSMLWLFGNKISDIAPL-ESLKSLTELQLSSNQITDIAPSLTELSLSGNNISDIAPLESLKSLTELSLSSNQITDIAPLLKSLTELSLSSNQISDIAPLESLKSLTELQLSRNQISDIAPLLKSLTELQLSSNQITDIAPLASLKSLTELQLSRNQISDIAPLLNSLSKLWLNGNQITDIAPLLNSLTELELSSNQITDIAPLLKSLSTLWLSSNQISDIAPLLESLSELSLSSNQISDISPLLNSLTGFDVRRNPIKRLPETFSSSGFITFFDNPLESPPPEGKEAVRQYFQSIEEA................... 446
24 -38.5004b8c_D mol:protein length:727 GLUCOSE-REPRESSIBLE ALCOHOL DEHYDROGENASE TRANSCRIPTIONAL EFFECTOR  ali model follow..  13  8VNSIGMVPTVGTPVNINVNASNPLLHP----HLDDPSLLNNPIWKLQLHLAAVSAQS-------------LGQPNIYARQNAMKKYLATQQAQQQAQQQAQQQVPGPFGPGPQAAPPALQPTDFQQSHIAEDCTKQALMEMADTLTDKTAKKQQPTGDSTPSGTATNSAVSTPLTPKIELFANGKDEANALLQHKKLSQYSIDEDDDIEMPKDSKYDDQLDLSNLQIFNISNIFKYDFLTRLYLNGNSLTELPAEIKNLS-----------------NLRVLDLSHNRLTSLPAELGSCF-----------------QLKYFYFFDNMVTTLPWEFGNLC-----------------NLQFLGVEGNPLEKQFLKILTEKSVT.......................... 342
25 -38.4004u06_A mol:protein length:344 LIC10831  ali model follow..  23  4.DLTKALQNPLEVRVLDLSRQELKTLPIEIGKLKNLQRLYLHYNQL-TVLPQEIEQL-------------KNLQLLYLRSNRLTTLPKEIENLQVLDLGSNQLTVLPQEIGQLKNL-----------------QLLYLHSNRLTTLSDIEQLQNLKSLDLSNNQLTTLPNEIENLKSLYLSENQFATFPEIGQLQNLKVLFLNNNQITILPNEIAKLQYLYLSDNQLITLPEIEQLKNLQTLDLSYNQLMILPKEVGNLQTLDLRNNQLKTLPKEIEQLK-----------------NLQTLFLSNNQLTILPQELKNLLWLSLVYNQLTTLPNEIENLQTLYLNNNQFSSQEKKLLPKCQIYFD............................................ 344
26 -37.6004qxe_A mol:protein length:443 Leucine-rich repeat-containing G-protein coupled receptor 4, linker, Variable lymphocyte receptor B  ali model follow..  19  3.PLCAAPCSCDGDRRVDCSGKGLTAVPEGL--SAFTQALDISMNNITQLPEGAFKNF-------------PFLEELQLAGNDLSFIHP-LKELKVLTLQNNQLKTVPEAIRGLSALQSLRLDANHITSVPVQLRHLWLDDNSLTEVPVLSNLPTLQALTLALNKISSIPD-LSSLVVLHLHNNKIRSLSQFDGLDNLETLDLNYNNLGEFPQALPSLKELGFHSNSISVIPDFDGNPLLRTIHLYDNPLSFVGNSLSDLHSLVIRGASMVQQFPNTVHLESLTLTGTKISSIPN-QKMLRTLDLSYNNIRDLPSFCHALEEISLQRNQIYQIKE-LISLRILDLASNQLKSVPD-LTSLQKIWLHTNPWDCSCPRIDYLSRW........................... 414
27 -37.5004r6g_A mol:protein length:464 leucine rich repeats DLRR_K  ali model follow..  26  1..............TITVSTP----IKQIFPDDAFAETIKANLKKKSVTDAVTQNEL-------------NSIDQIIANNSDIKSVQGILPNVRYLALGGNKLHDISAL-KELTNLGWLNLSNNQLETLPQNLTTLNLSNNQLTSLPQFERLASLTTLNLSNNNLANLNDRLTNLTTLNLSNNNLARLWKLKGLTNLTTLNLSNNGFDELPKELTSLTTLNLSNNQLTSLPQFERLTNLTTLNLSNNQLTSLPQGLTNLTTLNLSNNQLTSLPQGLTSLTTLNLSNNQLTSLPK-LTNLKTLNLSNNQITKEVKQAASLHELHLSNNNIGEEGAAGSTLETLDLSNCNLTKEAKQATTLHELHLSNNNIGEEGAAGSTLETLDLSNCNLTKEAQATSLHELHLSNNNIG 463
28 -37.3006fnw_A mol:protein length:417 Volume-regulated anion channel subunit LRRC8A  ali model follow..  17  20.DKLRQRLTKNAQDKLELHLFMLSGIPDTVFDLVELEVLKLELIPD-VTIPPSIAQLTGLKELWLYHTLRENLRALHIKFTDIKEIPLWIYSLKTLESAENNRYIVIDGLRELKRLKVLRLKSNVVTDVGVHLQKLSINNEGTKLINSLKKMVNLTELELIRCDLERIPHSIHNLQEIDLKDNNLKTIEEFQHLHRLTCLKLWYNHIAYIPIQIGNLERLYLNRNKIEKIPQLFYCRKLRYLDLSHNNLTFLPADIGNLQNLAVTANRIEALPPELFQCR-----------------KLRALHLGNNVLQSLPSRLTNLTQIELRGNRLECLPVELGECPLL---------------KRSGLVVEEDLFSTLPPEVKERLWRA.......................... 411
29 -37.2004r5c_A mol:protein length:304 Leucine rich repeat protein  ali model follow..  26  3.........................................................................................................................................TVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQLNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALLTNLGWLNLSNNQLETLPQFEKLTNLTTLNLSNNQLTSLPERLASLTTLNLSNNQLTSLPQ-LTNLTTLNLSNNQLTSLPQ-LTNLTTLNLSNNQLTSLPQGLTSLHTLDLSNNGITDISALLDNLHTLDLSNNGITDISALLDNLHTLDLSNNGITDISALLTSLHTLDLSNNGITDISNLDNLETLDLRNNGI. 304
30 -37.2004g8a_A mol:protein length:635 Toll-like receptor 4  ali model follow..  16  43FYKIPDNL--FSTKNLDLSFNPLRHLSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLQKLVAVETNLASLENFLKTLKELNVAHNLIQSFPEYFSNLTNLEHLDLSSNKIQSIYCT--SLDLSLNPMNFIQDKSALEGLCNLTIEEFRLAYLDYYLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCTISLKYLDLSFNGVITMSSNLEQLEHLDFQHSNLKQMSEFLRNLIYLDISHTHTRVAFNGLSSLEVLKMAGNSFQE--TELRNLTFLDLSQCQLEQLSPTLSSLQVLNMSHNNFFSLDTFLNSLQVLDYSLNHIMTSKK-SSLAFLNLTQNDFA 580
31 -36.9002z63_A mol:protein length:570 Toll-like receptor 4, Variable lymphocyte receptor B  ali model follow..  17  19FYKIPDNL-PFSTKNLDLSFNPLRHLSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLQKLVAVETNLASLENFLKTLKELNVAHNLIQSFPEYFSNLTNLEHLDLSSNKIQSIYCTNLSLDLSLNPMNFIQPLEGLCNLTIEEFRLAYLDYYLDDLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCTTSLKYLDLSFNGVITMSSNLEQLEHLDFQHSNLKQMSEFLRNLIYLDISHTHTRVAFN-LSSLEVLKMAGNSFQEN-TELRNLTFLDLSQCQLEQLSPTLSSLQVLNMASNQLKSVPDGLTSLQKIWLHTNPWD................... 531
32 -36.9004eco_A mol:protein length:636 Uncharacterized protein  ali model follow..  18  79........SNGRVTGLSLEGFGASGVPDAIGQLTELEVLALGSHGEKVNERLFGPKGISANMSDEQKQKMRREDFSDLIKDCINSDPQQIKKSSRITLKDNNITFVSKAVMRLTKLRQFYMGNSPFVAENKDLTDVEVYNPNLTKLPTLKALPEMQLINVACNRGISGEQLKEKIQIIYIGYNNLKTFPSLQKMKKLGMLECLYNQLEGKLPAFGKLASLNLAYNQITEIPACGFTEQVENLSFAHNKLKYIPNIVSVMSAIDFSYNEIGSVDGKGINVSSINLSNNQISKFPKTGSPLSSINLMGNMLTEIPKNTYLLTSIDLRFNKLTKLSDTLPYLVGIDLSYNSFSKFPTQPLNSSTLK-GNRTLREWPEGITSLTQLQIGSNDIRKVNETPNISVLDIKDNPN. 599
33 -36.8001o6s_A mol:protein length:466 INTERNALIN A  ali model follow..  18  1..........GPLGSATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVS--QTDLDQVTTLQADRLGIKNLTQINFSNNQLTDITPLLTKLVDILMNNNQIADITPL-ANLTNLTGLTLFNNQITDIDPNLNRLELSSNTISDISALSGLTSLQQLSFG-NQVTDLKPLLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLLTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLLTKLTELKLGANQISNISPLLTALTNLELNENQLEDISPILKNLTYLTLYFNNISDISPVLTKLQRLFFYNNKVSDVSSLLTNINWLSAGHNQISDLTPLLTRITQLGLNDQAWTNAPANVSIPNTVKNVTGALIAPATISDGGSYT....... 424
34 -36.8004z0c_A mol:protein length:709 Toll-like receptor 13  ali model follow..  19  81........GLENLTLLNLVENKIQSVNNSFEGLSSLKTLLLSHNQITHIHKDAFTPLIKLKYLSLSRNNISCLERLDLTNNSIMYLDHSLVSLTHLSFEGNKLRELNFSALSLPNLTNLSASRNGNKVIQNQLKSLNLSGTVIKLENSAKHLQNLRAMDLSNWELRHGHGNLPKLETLVFQKNVTNAEGQLAKCTRLLFLDLGQNSLIYLNDSLPSLQKLNLNKCQLSFINNWSSLQNLTSLDLSHNKFKSFPDFLKHLEFLSLSRNPITELNNLLFALKELNLAACWIVTIDRYFPNLEVLDLGDNNIRTLNHGLKKLQSLILSHNCLKILEPNLTNLRSLDLMYNSLSYFHEHLEKLLILKLGFNKITYETTRLKSLKQLNLEGQRHGFFQGLGSLQELLLGKNPSV 564
35 -36.8003cvr_A mol:protein length:571 Invasion plasmid antigen  ali model follow..  35  1MSIMLPINNNFSLSQNSFYNTISGTYADYFSAWDKWEKQALPGEN------------RNEAVSLLKECLINQFSELQLNRLNLSSLPDLPPQITVLEITQNALISLPELPASLEYLDACDNRLSTLPELPASLKHLDVDNNQLTMLPEL--PALLEYINADNNQLTMLPELPTSLEVLSVRNNQLTFLPEL--PESLEALDVSTNLLESLPAVPVRNHHFRCRENRITHIPEILSLDPTCTIILEDNPLSSRI............................................................................................................................................................ 246
36 -36.7003t6q_A mol:protein length:606 CD180 antigen  ali model follow..  16  24LNEIPGTL-PNSTECLEFSFNVLPTINTTFSRLINLTFLDLTRCQIYWIHEDTFQSQHRLDTLVLTANPLIALKHLFFIQTGISSIDFIQKTLESLYLGSNHISSILPKGFPTEKLKVLDFQNNAIHYLSKTNLSLNLNGNDIAGIEPNSTIQSLWLGTFEDMDDEDISPAVMSVESINLQKHYFFNISSFHCFSGLQELDLTATHLSELPSGLSTLKKLVLSANKFENLCQLENLENLRELDLSHDDIETSDRNLSHLQSLNLSYNEPLSLKTECPQLELLDLAFTRLKVKDAQLHLLKVLNLSHSLLDISSEQLPALQHLNLQGNHFPKGNIQLGRLEILVLSFCDLSSIDQHLKMMNHVDLSHNRLTSSSIEA-KGIYLNLASNHISIILPLSQQRTINLRQNPLD 560
37 -36.6004nkg_A mol:protein length:246 E3 ubiquitin-protein ligase sspH1  ali model follow..  27  1...........................................................................................................................................GAEYDAVWKWERDAPAGESPGRAAVVQEMRDLNNGNPVLNVGASGLTTLPD----PHITTLVIPDNNLTSLPELPEGLRELEVSGN---------------------LQLTSLPSLPQGLQKLWAYNNWLASLPTLPPGLGDLAVSNNQLTSLPEMPPALRELRVSGNNLTSLPALPSGLQKLWAYNNRLTSLPEMSPGLQELDVSHNQLTRLPQSLSSAARVYLDGNPLSALRDIIGHRIHFDMAGPSVPREAR............... 246
38 -36.5005gmf_A mol:protein length:817 Toll-like receptor 7  ali model follow..  19  103........GLTYLKSLYLDGNQLLEIPQGL--PPSLQLLSLEANNIFSIRKEQLTELANIEILYLGQNCLTKLKVLSLKDNNVTTVPTLPSTLTELYLYNNMIAEIEDDFNNLNQLQILDLSGNCPRCYNAPFPCTPCKNNSPLQIPVFDALTELKVLRLHSNSLQHVPPRINNLQELDLSQNFLAKEIGLHFLPNLIQLDLSFNFELQVYRALKSLKILRIRGYVFKELKSLHNLQNLEVLDLGTNFIKIANKQFKRLKVIDLSVNKISPSGDSYKYGQTLDLSKNSIFFIKS-LSFLKCLNLSGNLISQT-QPLAELRYLDFSNNRLDLLHSTLRKLEVLDISSNSHYFQSEGLKVLQKLMMNDNDISSSTSRTESLRTLEFRGNHLDVLWRLLKLEELDISKNSLS 641
39 -36.4004fmz_A mol:protein length:347 Internalin  ali model follow..  18  1.......................................................................GAATLATLPAPINQIFPDLAEGIRAVLQKASVTDVVTQ-EELESITKLVVAGEKVASIQGNLEYLNLNGNQITDISPLSNLVKLTNLYIGTNKITDISALLTNLRELYLNEDNISDISPLANLTKMYSLNLGANHNLSDLSPLSGLNYLTVTESKVKDVTPIANLTDLYSLSLNYNQIEDISPLLTSLHYFTAYVNQITDITPVMTRLNSLKIGNNKITDLSPLLSQLTWLEIGTNQISDINAVLTKLKMLNVGSNQISDISVLLSQLNSLFLNNNQLGNEDGGLTNLTTLFLSQNHITDIRPLLSKMDSADFANQVIKK.................. 347
40 -36.3003rg1_A mol:protein length:612 CD180 molecule  ali model follow..  16  23LREIPDTL--NTTEVLEFSFNFLPTINTTFSRLINLIFLDLTRCQINWVHEDTFQSHHQLNTIVLTGNPLIFLKHLFLTQTGISNLEFILENLESLHLGSNHISSILPENFPTQNLKVLDFQNNAIHYISRTNLSLNFNGNDIKGIEPNSTLQSLWLGTFEDTDDQYLTSAT-SVESINLQKHRFSDLSSFRCFTRVQELDLTAAHLNGLPSGMNSLKKLVLNANSFDQLCQLEKLENLQKLDLSHSDIEASDKNLRHLQYLNLSYNEPLGLED-CPQLELLDVAFTHLHVK-QNLHLLRVLNLSHCLLDTSNQHLQDLRHLNLQGNSFQDGSQMVGSLEILILSSCNLLSIDQQLRNVNHLDLSHNSLTGDSMDA-KGLYLNMASNNIRIIPPLSQQSIINLSHNPLD 559
41 -36.2005zln_A mol:protein length:793 Toll-like receptor 9  ali model follow..  19  1LGTLPAFLELKPHGLVDCNWLFLKSVPSAAASCSNITRLSLISNRIHHLHNSDFVHLSNLRQLNLKWNCMRTLEELNLSYNGITTVPRLPSSLVNLSLSHTNILVLANSLAGLYSLRVLFMDGNCYYKNPSNLTHLSLKYNNLTKVPR-QLPPSLEYLLVSYNLIVKLGPELTSLRVLDVGGNCRRC-ETFHHLSHLEGLVLKDSSLHTLNSSLVNMSVLDLSENFLYESNAFQNLTRLRKLNLSFNYRKKVSKNLVSLQELNMNGIFFRSLNKYLPKLHTLHLQMNFINQAQGTFRALRFVDLSDNRISGMDRCKNFKFTMDLSRNNLVTIKPELSRLQCLSLSHNSIAQAVQGLTNLQVLDLSHNKLDLYHSELPQLQALDLSYNSQPFSMKLSMLHSLSLAHNDIH 564
42 -36.2005kh1_A mol:protein length:591 Invasion plasmid antigen  ali model follow..  26  5....................................................................................................................................SPEFMLPTNNNHRLINSFSTYSIDTSRAYENYLTHWTEWKNNRIQEEQRDIAFQRLVSCLQ-NQETNLDLSELGLTTLPEIPPGIKSINISKNNLSLISPL--PASLTQLNVSYNRLIELPALPQGLKLLNASHNQLITLPTLPISLKELHVSNNQLCSLPVLPELLETLDVSCNGLAVLPPLPFSLQEISAIGNLLSELPPLPHNIHSIWAIDNMLTDIPYLPENLRNGYFDINQISHIPESILNLRNIDISDNPLSS.................. 264
43 -36.0003oja_B mol:protein length:597 Anopheles Plasmodium-responsive Leucine-rich repeat protein 1  ali model follow..  21  2..........................................................................GGQQRYNVKPRQPEYSNLQYDCVFYDVHIDMQTQDVYFGFEDITL-----------NNQKIVTFKNSTMRKLPALDSFRQVELLNLNDLQIEEIDTYAHTIQKLYMGFNAIRYLPPFQNVPLLTVLVLERNDLSSLPR-TPKLTTLSMSNNNLERIEDFQATTSLQNLQLSSNRLTHVDSLIPSLFHANVSYNLLSTLAI-PIAVEELDASHNSINVVRPVNVELTILKLQHNNLTDTAWLYPGLVEVDLSYNELEKIMY-MQRLERLYISNNRLVALNLYIPTLKVLDLSHNHLLHVERQFDRLENLYLDHNSIVTLKLHHTLKNLTLSHNDWD 358
44 -35.1003b2d_A mol:protein length:603 CD180 antigen  ali model follow..  15  21LSEIPDTLP-NTTEFLEFSFNFLPTINRTFSRLMNLTFLDLTRCQINWIHEDTFQSHHQLSTLVLTGNPLISLKHLFLIQTGISNLEFILENLESLYLGSNHISSIFPKDFPARNLKVLDFQNNAIHYISRE--SLNFNGNNVKGIEL--CEMSVESLNLQEHRFSDISSTFTQLQELDLTATHLKGLPSMKGLNLLKKLVLSVNHFDQLCQIFPSLTHLYIRGNVKKGVGCLEKLGNLQTLDLSHNDIEASDKNLSHLQTLNLSHNEPLGLQSQCPQLELLDLAFTRLHIN-QNLHFLQVLNLTYCFLDTSNQHLPVLRHLNLKGNHFQDGTITVGSLEVLILSSCGLLSIDQQLGKMSHVDLSHNSLTCDIDSLSHLKGLNLAANSINIISPLSQQSTINLSHNPLD 557
45 -35.0004r6f_A mol:protein length:331 Leucine rich repeat DLRR_I  ali model follow..  23  1.............................................................................................ATITVSTPIKQIFPDDA---------------------FAETIKANLKKKSVTDAQNELNSIDQIIANNSDIKSVQGILPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQ-LTNLTTLNLSNNQLTSLPQFERLASLTTLNLSNNNIANINDQLTNLTTLNLSHNNLARLWKHLTNLTTLNLSSNGFDEIPR-LTSLTTLNLSNNNIANIND-LTNLTTLNLSHNNLARLWK-LTNLTTLNLSSNGFDEIPR-LTSLTTLNLSNNQLTSLPQ-LTNLKTLNLSNNQLQS.................. 331
46 -34.8004xgo_A mol:protein length:356 Anopheles Plasmodium-responsive Leucine-rich repeat protein 1B  ali model follow..  23  22.....................................................................FHKVEVLNLNGLQIEEIDTNAHTIQKLYMRFNVIRYLPPVFQNVPLLTVLMLDRNDLSSLPPKLTMMSMSNNNLERIEDFQATTALQNLQLSSNRLTHVDALIPSLFHVNVSYNLLSTLAI---PIAVEELDASHNTINVVRPVNVELTILKLQHNNLTDTAWLLNYPGLVDVDLSYNQLEKITYQMQRLERLYVSNNRLVALDFYIPTLKVLDLSHNHLMWVEH-FDKLQYLYLDHNSIVTFKSTSHTLKNLTLSHNDWDCNSALFRNVAQPAVHDADQHCKIDYGLCCKESDKPYLD......................................... 350
47 -34.7003o53_A mol:protein length:317 Protein LRIM1  ali model follow..  19  10..................................................................................................................................NRYKIEKVTDSSLKQALARQSAWNVKELDLSGNPLSQISAAFTKLELLNLSSNVLYETLDLESLSTLRTLDLNNNYVQELLVGP-SIETLHAANNNISRVS-CSRGQGKKNIYLANNKITMLRDLRSRVQYLDLKLNEIDTVNASSDTLEHLNLQYNFIYDVKGQFAKLKTLDLSSNKLAFMGPEAAGVTWISLRNNKLVLIEKALQNLEHFDLRGNGFHCGTLFSKNQRVQTVAKQTVKKLTGQCTVPTLGHYGAYCCEDLPA............... 301
48 -34.6003wpb_A mol:protein length:802 Toll-like receptor 9  ali model follow..  17  15........ELQPHGLVNCNWLFLKSVPSAAAPRDNVTSLSLLSNRIHHLHDSDFAQLSNLQKLNLKWNCVPTLEELNLSYNGITTVPALPSSLVSLILSRTNILQLPTSLTGLHALRFLYMDGNCYYKNPGNLTHLSLKYNNLTTVPR-SLPPSLEYLLLSYNHIVTLAPELTALRVLDVGGNCRRC-DTFSHLSRLEGLVLKDSSLYQLNPRLGNLTVLDLSENFLYDCKAFQGLAQLRRLNLSFNYHKKVSGSLLSLQELDMHGIFFRSLSQKLPMLQRLYLQMNFINQAQKDFPGLRYIDLSDNRISGAVEEVDGGKKVWLTSRDLTPMPSCKNLSFTLDLSRNNLVTVQPELSRLQCLRLSHNSISQAVNPLTSLQVLDLSHNKLDLYHGLPRLEALDLSYNSQP 537
49 -34.5004lxr_A mol:protein length:783 Protein toll  ali model follow..  20  51.........MCNLTDTTDYQQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMGLKRFRFTTRRLTHIPANMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRKLKQLNLWSNQLHNLTKFEGATSVLGIDIHDNGIEQLPH-LTNVTDINLSANLFRSLPQFDHNKHLNEVRLMNNRVPRLFANQPELQILRLR-AELQSLPGFEHSTQITNISLGDNLLKTLPATQVNLLSLDLSNNRLTHLPDSTTNLTDLRLEDNLLTGISG-LGNLVTLVMSRNRLRTIDVSTNGLRHLHLDHNDIDLQQPLMHGLLTLNLRNNSIIFVYN-MLQLRELDLSYNNISSLGYLSQNRLHVNMTHNKIRRIAYNNNLVHVDLNDNPLV 537
50 -34.5004u7l_A mol:protein length:456 Leucine-rich repeats and immunoglobulin-like domains protein 1  ali model follow..  20  14.......................................................DCGGRGLAALPGDLPSSTRSLNLSYNKLSEIDPALPNLQEVYLNNNELTAVPSLGAASSHVVSLFLQHNKIRSVEGSLEVLDLSLNNITEVRNFPHGPPIKELNLAGNRIGTLELLSRSLLTLRLSKNRITQLPRAFKLPRLTQLDLNRNRIRLIEGLLNSLEVLKLQRNNISKLTDFWGLSKMHVLHLEYNSLVEVNSGLTALHQLHLSNNSIARIHR-CQKLHELVLSFNNLTRLDE-LSSLSVLRLSHNSISHIAE-LRSLRVLDLDHNEISGTIEDLDSLSKLTLFGNKIKSVAK-LEGLEHLNLGGNAIRSVQF-MKNLKELHISSDSFLCDCQLTCAHPESLKGQSIF 441
51 -34.4003wpf_A mol:protein length:803 Toll-like receptor 9  ali model follow..  20  15........ELKPHGLVDCNWLFLKSVPSAAASCSNITRLSLISNRIHHLHNSDFVHLSNLRQLNLKWNCMRTLEELNLSYNGITTVPRLPSSLVNLSLSHTNILVLANSLAGLYSLRVLFMDGNCYYKNPSQLTHLSLKYNNLTKVPR-QLPPSLEYLLVSYNLIVKLGPELTSLRVLDVGGNCRRC-ETFHHLSHLEGLVLKDSSLHTLNSSLVQLSVLDLSENFLYESNAFQNLTRLRKLNLSFNYRKKVSKNLVSLQELNMNGIFFRLLNKYLPKLHTLHLQMNFINQAQGTFRALRFVDLSDNRISGMDRCKNFKFTMDLSRNNLVTIKPELSRLQCLSLSHNSIAQAVN-LTNLQVLDLSHNKLDLYHWKLPQLQALDLSYNSQPFSMKLSMLQSLSLAHNDIH 568
52 -34.3005kzs_A mol:protein length:340 Putative cell surface protein, similar to internalin proteins  ali model follow..  15  2......................................................................NAASDLYPLPAPIIDV-EGLAKDMAKNLNKDSVNDVIDQLDALTGLGFETETIDSMQLLERNIVSVMEFGEDLTEFPDISTIPHLNTLFFNTPPEGVTRNLYPEMVTITMSGSNLIGIPDFTGMPDLSQLYMADMMITSDDHTIPKLSTLDLSHNQLTNLPDFQNLTNLAELNLSFNNLTNTMTNLSNLNNLNLDYNHLNELPSNVLNSIFIE---NQSGTVPDQIIKQGETCTIQLPIYFQLAEINMLVNPTVLGSYSADIPVEVVTTTNADTESITLDTS-ELSPGVYNFNVQFNDAYPITQEGCVYDWV........................... 336
53 -34.2003w3g_A mol:protein length:811 Toll-like receptor 8  ali model follow..  21  101........NLKNLRELLLEDNQLPQIPSGL--PESLTELSLIQNNIYNITKEGISRLINLKNLYLAWNCLTNLELLSLSFNSLSHVPKLPSSLRKLFLSNTQIKYIEEDFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRFQNLTQLRYLNLSSTSLRKINAAMPHLKVLDLEFNYLVGE--LTMLPRLEILDLSFNYIKGSYSKLLSLRALHLRGYVFQELRELMQLPNLSTINLGINFIKQIDFKFSNLEIIYLSENRISPLVKCAAYGKALDLSLNSIFFIGP-LPDIACLNLSANSNAQVLSAIPHVKYLDLTNNRLDFDNASLSDLEVLDLSYNSHYFRIAGFTNLKVLNLSHNNIYTLTDKSKSLVELVFSGNRLDILWNLKNLTRLDLSLNRLK 630
54 -34.2003wpe_A mol:protein length:801 Toll-like receptor 9  ali model follow..  18  15........ELQPHGQVDCNWLFLKSVPSAGAPRANVTSLSLISNRIHHLHDSDFVHLSNLRVLNLKWNCVPTLEELNLSYNGITTVPALPSSLVSLSLSHTSILVLPTHFTGLHALRFLYMDGNCYYMNPGNLTHLSLKYNNLTEVPR-RLPPSLDTLLLSYNHIVTLAPELTALRVLDVGGNCRRC-DTFSHLSRLEGLVLKDSSLYKLEKDLGRLQVLDLSENFLYDY--FNDLTQLRRLNLSFNYHKKVSGSLVSLEKLDMHGIFFRSLTNILPKLQSLHLQLNFINQAQGAFPSLLFVDLSDNRISGAAPSCNLNFTLDLSRNNLVTIQQELSRLQCLRLSHNSISQA-VPLTSLRVLDLSHNKLDLYHGRLPQLEALDLSYNSQPFSMQLPSLRYLSLAHNGIH 566
55 -34.0004r6j_A mol:protein length:254 Lucine rich repeats DLRR_H  ali model follow..  29  1............................................................................................................................................................TITVSTPIKQIFPDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGILPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQGLTNLTTLNLSNNQLTSLPQ-LASLTTLNLSNNNLANLND-LTNLTTLNLSNNNLARLWKHLTNLTTLNLSNNGFDEFPK-LTSLTTLNLSNNQLTSLPQ-LTNLKTLNLSNNQLQSLPT................................... 253
56 -33.9003cig_A mol:protein length:697 Toll-like receptor 3  ali model follow..  16  95........FCTNLTELDLMSNSIHKISNPFKNQKNLIKLDLSHNGLSSTKLGTGVQLENLQELLLAKNKILSLRKLDLSSNPLKEFSPGIGKLFALLLNNAQLNPHLTWELSNTSIQNLSLANNQLLATSENLTQLDLSYNNLHDVGNFSYLPSLRYLSLEYNNIQRLSPRLSNLRYLSLKRAFTKQSFSFQWLKYLEYLNMDDNNIPSTKSNTSPLLTLNLTKNHISKIANFSWLGQLRILDLGLNEIEQK-RGLRNIFEIYLSYNKYLQLSTSVPSLQRLMLRRVALKNVDRPLRNLTILDLSNNNIANINEDLENLEILDFQHNNLARLWKRLSHLHILNLESNGLDEIPV-LFELKSINLGLNNLNKLEPFQTSLRSLNLQKNLITSVEKFQNLNSLDMRFNPFD 622
57 -33.6003a79_B mol:protein length:562 Toll-like receptor 6, Variable lymphocyte receptor B  ali model follow..  16  31..........ELESMVDYSNRNLTHVPKDLPP--RTKALSLSQNSISELRMPDISFLSELRVLRLSHNRIRDLEYLDVSHNRLQNISCPMASLRHLDLSFNDFDVVCKEFGNLTKLTFLGLSAAKFRQLDLSCILLDLVSYHIKGGTESLQIPNTTVLHLVFHPNSQVNMSVNALGHLQLSNIKLNDENQFFWPRPVEYLNIYNLTITERIDREMNIKMLSISDTPFIHMVCPPSPSSFTFLNFTQNVFTDS-STLKRLQTLILQRNGLKNFFKVMSSLETLDVSLNSLNSHAAWAESILVLNLSSNMLTGFRCLPPKVKVLDLHNNRIMSIPKDLQALQELNVASNQLKSVPDRLTSLQYIWLHDNPWD----TCPGIRYLSEWINKHSG.................. 528
58 -33.2005b0n_A mol:protein length:224 E3 ubiquitin-protein ligase ipaH9.8  ali model follow..  31  1.......................STYADYFSAWDKWEKQALPGEERDEAVS------------RLKECLINNSDELRLDRLNLSSLPDNLPAITLLNVSYNQLTNLPELPVTLKKLYSASNKLSELPVLPPALESLQVQHNELENLPALPD--SLLTMNISYNEIVSLPSLPQALKNLRATRNFLTELPAEGNNPVVREYFFDRNQISHIPESILNLRNIHISDNPLSSHA-LPALQRLTSSPDYHGPRIYFSM........................................................................................................................................................... 222
59 -33.1004r5d_A mol:protein length:441 Leucine rich repeat protein  ali model follow..  23  1.............ATITVSTPIKQIFPDD--AFAETIKANLKKKSVTDAVTQN---------------ELNSIDQIIANNSDIKSVQGILPNVRYLALGGNKLHDISAL-KELTNLGWLNLSNNQLETLPQNLTTLNLSNNQLTSLPQFERLASLTTLNLSNNQLTSLPERLTNLTTLNLSNNQLTSLPQFERLTNLTTLNLSNNQLTSLPERLTSLTTLNLSNNQLTSLPDFERLTNLKTLNLSNNQLTKEAKQAASLHELHLSNNNIGELLHPGSTLETLDLSNCNLTKEAKQATTLHELHLSNNNIGELLHPGSTLETLDLSNCNLTKEAKQATTLHELHLSNNNIGELLHPGSTLETLDLSNCNLTKEAKQATSLHELHLSNNNI.................... 440
60 -32.9005b4p_A mol:protein length:261 repebody  ali model follow..  22  1.........................................................................................................................................................ALETITVSTPIKQIFPDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGILPNVRYLALGGNKLHDISALKELTNLTYLFLDFNQLQLPNGVLTNLKELYLSPNQLQSLPD-LTNLTILGLDMNQLQSLPK-LTNLTELDLSYNQLQSLPDKLTQLKDLSLSYNQLKSVPD-LTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVGGPD................................... 243
61 -32.8004psj_A mol:protein length:271 OR464  ali model follow..  27  1..........................................................................................................................................................MGTITVSTPIKQIFPDAFAETIKANLKKKSVTDAVTQNELNSIDQINANNSDIKSVQGILPNVRQLNLGGNKLHDISALKELTNLGWLNLSSNKIEKLPQSLTTLTQLNLSNNQITSLPQ-LASLTQLNLSNNQITSLPQ-LTNLTQLNLSNNQITSLPQ-LTNLTQLNLSNNQITSLPQ-LTSLTQLNLSNNQITSLPQ-LTNLKQLNLSGNQIQSLPQLHESLTQLTGS........................ 259
62 -32.7002a0z_A mol:protein length:705 Toll-like receptor 3  ali model follow..  16  100........FCTNLTELHLMSNSIQKINNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQSLKKLELSSNQIKEFSPGIGRLFGLFLNNVQLGPSLTLELANTSIRNLSLSNSQLSTTSNNLTMLDLSYNNLNVVGNFAWLPQLEYFFLEYNNIQHLFSHLFNVRYLNLKRSFTKQ-FSFQWLKCLEHLNMEDNDIPGIKSNMSPLHILNLTKNKISKIESFSWLGHLEVLDLGLNEIGQE-RGLENIFEIYLSYNKYLQLTRNVPSLQRLMLRRVALKNVDSSPRNLTILDLSNNNIANINDDLEKLEILDLQHNNLARLWKHLSHLHILNLESNGFDEIPVELFELKIIDLGLNNLNTLPASQVSLKSLNLQKNLITSVEKFRNLTELDMRFNPFD 627
63 -32.5002ft3_A mol:protein length:332 Biglycan  ali model follow..  19  13.....................................................................IPDLDSLPPTYSAMCPFGCH-CHLRVVQCSDLGLKAVPK-------------------EISPDTTLLDLQNNDISELRKFKGLQHLYALVLVNNKISKIHE------------------KAFSPLRKLQKLYISKNHLVEIPNLPSSLVELRIHDNRIRKVPKFSGLRNMNCIEMGGNPLENSGFEPGKLNYLRISEAKLTGIPKLPETLNELHLDHNKIQAIEL-YSKLYRLGLGHNQIRMIEN-LPTLRELHLDNNKLSRVPAGLKLLQVVYLHTNNITKVGVKRAYYNGISLFNNPVPYWERCVTDRLAIQFGNYK..................... 331
64 -32.5003ulu_A mol:protein length:694 Toll-like receptor 3  ali model follow..  16  105........FCTNLTELHLMSNSIQKINNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQSLKKLELSSNQIKEFSPGIGRLFGLFLNNVQLGPSLTLELANTSIRNLSLSNSQLSTTSNNLTMLDLSYNNLNVVGNFAWLPQLEYFFLEYNNIQHLFSHLFNVRYLNLKRSFTKQ-FSFQWLKCLEHLNMEDNDIPGIKSNMSPLHILNLTKNKISKIESFSWLGHLEVLDLGLNEIGQE-RGLENIFEIYLSYNKYLQLTRNVPSLQRLMLRRVALKNVDSSPRNLTILDLSNNNIANINDDLEKLEILDLQHNNLARLWKHLSHLHILNLESNGFDEIPVELFELKIIDLGLNNLNTLPASQVSLKSLNLQKNLITSVEKFRNLTELDMRFNPFD 632
65 -32.4001xku_A mol:protein length:330 Decorin  ali model follow..  20  1...................................................................................................DEASGIGPEHFPEVPEIEPMGPVCP------CHLRVVQCSDLGLEKVPK-DLPPDTALLDLQNNKITEIKD-LKNLHTLILINNKISKISPFAPLVKLERLYLSKNQLKELPEMPKTLQELRVHENEITKVRKFNGLNQMIVVELGTNPLKSSGQGMKKLSYIRIADTNITTIPQLPPSLTELHLDGNKITKVDA-LNNLAKLGLSFNSISAVDN-TPHLRELHLNNNKLVKVPGGHKYIQVVYLHNNNISAIGTKKASYSGVSLFSNPVQYWERCVYVRAAVQLGNYK..................... 330
66 -32.3004pq8_A mol:protein length:271 DESIGNED PROTEIN OR465  ali model follow..  29  1..........................................................................................................................................................MGTITVSTPIKQIFPDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGILPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQGLTNLTTLNLSNNQLTSLPQ-LASLTTLNLSNNQLTSLPQ-LTNLTTLNLSNNQLTSLPQ-LTNLTTLNLSNNQLTSLPQ-LTSLTTLNLSNNQLTSLPQ-LTNLKTLNLSNNQLQSLPTVDEKLTQLTGS........................ 259
67 -32.0002z7x_B mol:protein length:520 Toll-like receptor 1, Variable lymphocyte receptor B  ali model follow..  18  1...........SEFLVDRSKNGLIHVPKDLSQ--KTTILNISQNYISELWTSDILSLSKLRILIISHNRIQELEYLDLSHNKLVKICHPTVNLKHLDLSFNAFDALCKEFGNMSQLKFLGLSTTHLEKSSESLHIVFPTNKEFHFI-SVKTVANLELSNIKCVKLQTNPKLSNTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDF-MNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLLTDT-GHLTELETLILQMNQLKELSKIAESLQQLDISQNSVSYDESWTKSLLSLNMSSNILTDFRCLPPRIKVLDLHSNKIKSIPKQLEALQELNVASNQLKSVPDRLTSLQKIWLHTNPWDSCPRIDYLSRWLNKNSQKEQGSAK............... 506
68 -31.9003v47_A mol:protein length:455 Toll-like receptor 5b and variable lymphocyte receptor B.61 chimeric protein  ali model follow..  16  11.......................................................................IGYNAICINRGLHQVPELPAHVNYVDLSLNSIAELNESFSRLQDLQFLKVEQQTPGLV-SSLIILKLDYNQFLQLETFNGLANLEVLTLTQCNLDGAVKPLTSLEMLVLRDNNIKKIQPFLNMRRFHVLDLTFNKVKSICEEDKHFTLLRLSSITLQDMNEPFKNTSITTLDLSGNGFKESMAKAIAGTKIQSLILSNS-------YNMGSSFGHTNFKDPDNFTSGVKTCDLSKSKIFALLKSFTDLEQLTLAQNEINKIDD-LTHLLKLNLSQNFLGSIDS-LDKLEVLDLSYNHIRALGDQLPNLKELALDTNQLKSVPDLTSLQKIWLHTNPWD 408
69 -31.9004aw4_A mol:protein length:311 INTERNALIN B  ali model follow..  17  1...............................................................................................................GAMETITVPTPIKQIFSDDAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGILPNLTSLNLSNNQITDISPIQYLPNVTKLFLNGNKLTDIKPLLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLLPQLESLYLGNNKITDITVLLTKLDTLSLEDNQISDIVPLLTKLQNLYLSKNHISDLRALLKNLDVLELFSQECLNKPNHQSNLVVPNTVKNTDGSLVTPISDDGDYEKPNVKWHLPEFTVSFIFYQPVTIGKAKARFHGRVTQPLK....... 310
70 -30.6004c2a_B mol:protein length:291 PLATELET GLYCOPROTEIN IB ALPHA CHAIN  ali model follow..  22  9.....................................................................VASHLEVNCDKRRLTALPDLPKDTTILHLSENLLYTFSL--ATLMPY--------------TRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLLPALTVLDVSFNRLTSLPLLRGLGELQELYLKGNELKTLPP-TPKLEKLSLANNRLTELPALNGLENLDTLLLQENSLYTIPKGSHLLPFAFLHGNEILYFRRWLQDNAENVYVWKQVVDVKAVVASVQCDNSDKFPVYKYPGKLGDEGDTDLYDYYPEEDTE........................................................................... 285
71 -30.6005gr8_A mol:protein length:710 Leucine-rich repeat receptor-like protein kinase PEPR1  ali model follow..  21  206.SLPESLNLLGNLTTLFVGNNSLQGVRFGSPNCKNLLTLDLSYNEFEGGVPPALGNCSSLDALVIVSGNLSNLTILNLSENRLSSIPAELGNLNLLKLNDNQLVGIPSALGKLRKLESLELFENRFSGEIPSLTQLLVYQNNLTG-VEMTEMKKLKIATLFNNSFYAIPPGLGVLEEVDFIGNKLTG-PNLCHGRKLRILNLGSNLLHTIPASIGHIRRFILRENNLSLLPEFSQDHSLSFLDFNSNNFEPIPGSLGNLSSINLSRNRFTQIPPQLGNLGYMNLSRNLLEGLPAQLSNLERFDVGFNSLNG--SNWKGLTTLVLSENRFSGIPQFLPELSTLQIARNAFGEIPSSIGLIEDLDLSGNGLTEIPAKLGDLTRLNISNNNLTGLKGLTSLLHVDVSNNQFT 683
72 -30.6004qdh_A mol:protein length:438 Variable lymphocyte receptor B, Toll-like receptor 9 chimera  ali model follow..  22  15.......................................................................SGTEIRCNSKGLTSVPGIPSSATRLELESNKLQSLPGVFDKLTQLTKLSLSRNNLVTIKPRLQCLSLSHNSIAQAVNFLPLTNLQVLDLSHNKLDLYHW-LPQLQALDLSYNSQPFSMKVTHLSMLQSLSLAHNDIHTRVSSSNSVRFLDFSGNGMGRMWDFQGLSGLLKLDLSQNNLHILRPLPKSLKLLSLRDNYLSFFNSFLPNLEVLDLAGNQLKALTN-GTLLQKLDVSSNSIVSVVP-AVELKEVNLSHNILKTVDRIVMNLKELALDTNQLKSVPD-LTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSSGKPVRSIICPTASL. 417
73 -30.2006dbf_A mol:protein length:229 Listeria virulence factor InlB  ali model follow..  21  7..................................................................................................................................YFQGETITVSTPIKQIFPDDAFAETIKDNLKKKSVTDAVTQLNSIDQIIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLLKNLGWLFLDENKIKDLSSLKDLKKLKSLSLEHNGISDINGLLPQLESLYLGNNKITDITVLLTKLDTLSLEDNQISDIVPLLTKLQNLYLSKNHISDLRALLKNLDVLELFSQEALNKP............................................................................ 221
74 -30.1003rfj_A mol:protein length:279 Internalin B, repeat modules, Variable lymphocyte receptor  ali model follow..  21  1.....................................................................................................................................ETITVSTPIKQIFPD----AFAETIKANLKKKSVTDNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALLTNLTYLILTGNQLQSLPNFDKLTNLKELVLVENQLQSLPDGLTNLTYLYLYHNQLQSLPK-LTNLTRLDLDNNQLQSLPE-LTQLKQLSLNDNQLKSVPD-LTSLTHIWLLNNPWDCACSDIPGLVFGYLNLDPDSARCS-VRAVTEASTSPSKCP....................................... 272
75 -30.1004fho_A mol:protein length:231 Internalin C2  ali model follow..  16  3..................................................................................................................................EVRAESIAQPTPINVIFPDPALANAVKTATGKSNVTDAVTQLDGIATLSAFNTGVTTIEGIQYLNNLIGLELKDNQITDLTPLLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLLSNLQVLYLDLNQITNISPLLTNLQYLSIGNNQVNDLTPLLSKLTTLRADDNKISDISPLLPNLIEVHLKDNQISDVSPLLSNLFIVTLT................................................................ 231

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 0 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.