current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|40548796|ref|NP_395146.2| hypothetical protein (YPCD1.09c) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst MAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLMEAREQRVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKDTSVLast
1 -38.5003kxe_C mol:protein length:88 Antitoxin protein parD-1  ali model follow..  29  2ASKNTSVVLGDHFQAFIDSQVADGRYGSASEVIRAGLRLLEENEAKLAALRAALIEGEESGFIEDFDFDAFIEERSRA.. 79
2 -31.8005ceg_A mol:protein length:93 Addiction module antidote protein, CopG/Arc/MetJ family  ali model follow..  19  5..EKMSVAVTPQQAAVMREAVEAGEYATASEIVREAVRDWLAKREDIRRLRQLWDEGKASGRPEPVDDALRKEARQKLT. 86
3 -16.3002bj1_A mol:protein length:138 NICKEL RESPONSIVE REGULATOR  ali model follow..  25  4..IRFSISIPSKLLEKFDQIIEEIGYENRSEAIRDLIRDFIIRHE................................... 46
4 -16.0002ca9_A mol:protein length:148 PUTATIVE NICKEL-RESPONSIVE REGULATOR  ali model follow..  25  11..IRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDN................................... 53
5 -16.0001q5v_A mol:protein length:133 Nickel responsive regulator  ali model follow..  32  2..QRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEA................................... 44
6 -15.8002wvb_A mol:protein length:148 PUTATIVE NICKEL-RESPONSIVE REGULATOR  ali model follow..  23  11..IRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAE................................ 56
7 -15.7002wvc_A mol:protein length:148 PUTATIVE NICKEL-RESPONSIVE REGULATOR  ali model follow..  25  11..IRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDN................................... 53
8 -9.1004me7_E mol:protein length:94 Antitoxin EndoAI  ali model follow..  17  8.RTEMKISLPENLVAELD-GVAMREKRSRNELISQAVRAYVSERTT-RHNRDLMRRGYME.................... 64
9 -7.6604p78_A mol:protein length:143 HicB3 antitoxin  ali model follow..  20  93.AVKFNLTMSQNLLTAIDKFIATNRGYNRSQFLAELAREKIISLE................................... 137
10 -7.6505x3t_A mol:protein length:71 Antitoxin VapB26  ali model follow..  18  2..DKTTVYLPDELKAAVKRAARQRG-VSEAQVIRESIRAAVGGAKP.................................. 44

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 0 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.