current user: public

If you have questions about the server, please let us know.

Query: gi|30260214|ref|NP_842591.1| hypothetical protein (BA_0020) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MMRGGMGNMNNMMKQMQKMQKEMAKAQEELGEKTVEGTAGGGMITVIANGHKQILEVKVKEEVVDPEDIEMLQDLVLAATNDALKKADELSNSTMGKFTKGLNLPGGMFLast
1 -44.600[S] COG0718 Uncharacterized protein conserved in bacteria  ali follow..  37  3....GKGGIGNLMKQAQQMQEKMQQMQEEVAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLVEDDKEMLEDLIAAALNDAARRIDETQKEKMASVSNGMQLPPGF. 106
2 -6.100[U] COG5314 Conjugal transfer/entry exclusion protein  ali follow..  12  142......QAFRQTMGVQSQIVENVRGDGDLLADLVNRSQGAAGALQA-SQATNQLLALSTK-------QQMQIQTLLATQFRAEAEDAARKAQSE............... 221
3 -5.540[S] COG1937 Uncharacterized protein conserved in bacteria  ali follow..  13.............EETKLLQNRLRRIEGQIRGIAQMVEDDRYCTDI-------LVQISAANKALKNVGLQVLEHHTAHCVVDAAKNGEDDVMEDLLKAIRQF....... 94
4 -5.370[J] COG2511 Archaeal Glu-tRNAGln amidotransferase subunit E (contains GAD domain)  ali follow..  524....................EHFKGLFAAISNQEIAKEAIQDLLTALAKEPELTVQEAISKLGLSAFDPEEVENFIKQMVMEKGDFIKDKGPSALGPLMGIV....... 605
5 -5.350[K] COG1321 Mn-dependent transcriptional regulator  ali follow..  12  28.......KTKQIAEELNVSSPSVTEMIKKLHSMGFVEYKPYQGVELTEKGAEEAVRIKRKHQVLETFLADVLDFDRKEAHREACELEHAVSDSVLERLYDFLGNP.... 125
6 -5.230[S] COG4737 Uncharacterized protein conserved in bacteria  ali follow..  14  1MRIFKNQWIVKFAKKHKINDSELLEAVERADNGLIDADLGGGVQRIARQGQGRSGGYRS---AFAKNDRENISDKELDVYRKAAAYYLKYTRAELAALK.......... 112
7 -5.160[K] COG2865 Predicted transcriptional regulator containing an HTH domain and an uncharacterized domain shared with the mammalian protein Schlafen  ali follow..  2.......DVSDLIKKGESETIEFKREDSVYKTLSAFANTDGGILLLGVSNDGKVFGFS--------GDLDSLARSIRHNLR............................ 69
8 -5.020[L] COG1074 ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains)  ali follow..  11  7.............ADSTWTDDQWNAIVSTGQDILVAAAAGSGKTAVLVE--------RMIRKITAEENPIDVDRLLVVTFNASAAEMKHRIAEALEKEL.......... 85
9 -4.980[S] COG3091 Uncharacterized protein conserved in bacteria  ali follow..  9..........ALQQAVMQCLRHYLQLANQHLGTAYPEPKVNYHQRGTNAGSAYLQSIRLNPVLLLENKQPFIDEVVPHELAHLL......................... 84
10 -4.770[O] KOG3090 Prohibitin-like protein  ali follow..  142..............NASQLITQRESVSREIRKILTLRAANFHIALDDV----SITGLTFGKEFTAAIEGKQVAAQEAERAKFIVEKAEQDKRSAVIRAEG......... 223

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24