current user: public

If you have questions about the server, please let us know.

Query: gi|30260197|ref|NP_842574.1| DNA polymerase III subunit beta (BA_0002) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .
# Score Template Links and tools%idFirst MRFSIQKDYLVRSVQDVMKAVSFRTTIPILTGIKVVATEEGVTLTGSDADISIESFIPVEEDGKEIVEVKQSGSIVLQAKYFSEIVKKLPKETVEISVENHLMTKITSGKSEFNLNGLDSAEYPLLPQIEEHHVFKIPTDLLKHMIRQTVFAVSTSETRPILTGVNWKVYNSELTCIATDSHRLALRKAKIEGIVDEFQANVVIPGKSLNELSKILDESEEMVDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASLLARDGRNNVVKLSTLEQAMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMDALKALDSTEIKISFTGAMRPFLIRTVNDESIIQLILPVRTYLast
1 -116.000IDP04571 DNA polymerase III subunit beta [Bacillus anthracis str. Sterne] BAS0002 [Bacillus anthracis str. Sterne]  ali follow..  100  1MRFSIQKDYLVRSVQDVMKAVSFRTTIPILTGIKVVATEEGVTLTGSDADISIESFIPVEEDGKEIVEVKQSGSIVLQAKYFSEIVKKLPKETVEISVENHLMTKITSGKSEFNLNGLDSAEYPLLPQIEEHHVFKIPTDLLKHMIRQTVFAVSTSETRPILTGVNWKVYNSELTCIATDSHRLALRKAKIEGIVDEFQANVVIPGKSLNELSKILDESEEMVDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASLLARDGRNNVVKLSTLEQAMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMDALKALDSTEIKISFTGAMRPFLIRTVNDESIIQLILPVRTY 379
2 -105.000IDP90614 DNA polymerase III subunit beta [Vibrio cholerae O1 biovar eltor str. N16961] VC0013 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  26  1MKFTIERSHLIKPLQQVSGTLGGRASLPILGNLLLKVEENQLSMTATDLEVELISRVTLEGE-------FEAGSITVPARKFLDICRGLPDSAVITVLLEGDRIQVRSGRSRFSLATLPASDFPNIEDWQSEVQVSLTQAELRGLIEKTQFSMANQDVRYYLNGMLFEIDGTTLRSVATDGHRMAVAQAQLGADFA--QKQIIVPRKGVLELVKLLDAPEQPVVLQIGHSNLRAEVNHFVFTSKLVDGRFPDYRRVLPQHTSKTLQTGCEELRQAFSRAAILSNE-KFRGVRVN-LADNGMRITANNPEQEEAEELLDVS-FEGEPIEIGFNVSYILDVLNTLRCDNVRVSMSDANASALVENVDDDSAMYVVMPIR.. 365
3 -94.500IDP06076 gene: dnaN; DNA polymerase III subunit beta [Helicobacter pylori J99] NP_223170 [Helicobacter pylori J99]  ali follow..  22  1MKISVSKNDLENTLRYLQAFLDKKDASSIASHIHLEVIKEKLFLKASDSDIGLKSYISTQ-------STDKEGVGTINGKKFLDIISCLKDSNIVLETKDDS-LVIKQNKSSFKLPMFDADEFPEFPVIDPKVSLEINAPFLVDAFKKIAPVIEQTSHKRELAGVLMQFKHQTLSVVGTDTKRLSYTQLEKISIHSEEDISCILPKRALLEILKLF---YENFSFKSDGMLAVVENETHAFFTKLIDGNYPDYQKILPKEYTSSFTLGKEEFKEGIKLCSSLSST-----IKLT-LEKNNALFESLDSEHSETAKTSVEIE-IEKAFHLGVNAKFFLEALNALGTTQFVLKCNEPSSPFLIQEPLDEKISTLMMPIT.. 373
4 -5.040IDP90779 gene: nusA; transcription elongation factor NusA [Yersinia pestis CO92] YPO3497 [Yersinia pestis CO92]  ali follow..  13  2......NKEILAVVEAVSKSLPREKIFEALETALATATKKKY--QEIEVRVSID---------------RKTGDFDTFRRW--VAVDEVTMPTREITLDAAQFEDPSLQLGDYVEDQIESVTFDRITTQTAKQVIV---QKVREAERAMVVEQFRQYLGQIVTGIVKKVSRDSIALDLGHNAEAVIGREDM------------LPRENFRPGDRI-----YDVRPEARGAQLFVSRSRSEMLVELFRIEVPEIGE------------------ELIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAV-SSELGGERIDI---AQFVINAMAPADVASIVVDEDKHTMDVAVEASN.............. 313
5 -4.730IDP04602 transcription elongation factor NusA [Bacillus anthracis str. Sterne] BAS3667 [Bacillus anthracis str. Sterne]  ali follow..  12  2......STELLDALLVLEKGISKDIIIDAIEAALISAYKRNF--QAQNVRVSFN---------------PQVGTIQVLARK--DVVDNVFDPRLEISVEEARQINPNYQDGDVLEIEVTPKDFGRIAAQTAKQVVT---QRVREAERGVIYSEFSDREEDIMVGIVQRQDARFIYV-------------SLGKVEALLPVSEQMPNEQYKPHDRI-----TKVEKTTKGPQIYVSRTHPGLLKRLFEMEVPEIYD------------------GTVEIRSVAREAGDRSKISVHAENIDVDPVGSCVGPKGQRVQRI-VDELKGEKIDI---VEYVANALSPSQVVKVLVDEEEKATTVVVPDHQ.............. 312
6 -4.440IDP04566 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1876 [Clostridium perfringens ATCC 13124]  ali follow..  74STTEFSDSELTDLFI--LALREEPDAIKDLTGLKVDIENDDINIYVDNIPFQGKLTFTAQSKDGKGIFHYKEGFIDISKDTIFKNLQDNSILSFDKT-NGDIILSFKDIIKYLQIKSIKVEN-------KIVIVFNGTIPLLSSIFPN....................................................................................................................................................................................................................................... 219
7 -4.150IDP04654 gene: idh; isocitrate dehydrogenase [Francisella tularensis subsp. tularensis SCHU S4] FTT1526c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  10  1MKFYLQEIFMHKIFYTFTDALATGSFLPIVESFTIELETKDISLSARILANFNDYLTAEQKCSDDLANIIKLPNISASIPQLTAAIKELQSKGYKIPDYPYEPKDDKEQEIKARYAKVLGS--PVLREGNSDRRVADAVKKYAEKHPHSMGEWTKDSKSHV-ADDFYANEKSKIVHIDTKGTQTVLKDN-LALEEKEIIDATKISIKALREFYKIAKAKKEGTLLSLHLKATMMKVSDPILFGHAVEIFFEDIFKKYAKEFKELGVNPRNGWGDAVEKIKQLPQELQDKINAIEKVFAKQPDIAMVNSNKGITNLNVPSDVIIDASMPAAIRSSGKM.......................................... 370
8 -4.030IDP06330 ubiquitin fusion degradation domain-containing protein [Toxoplasma gondii ME49] XP_002365719 [Toxoplasma gondii ME49]  ali follow..  14  35..............................................................................................................................................................................................IGKDEMEKGNKILLPQSALHALARLHISWPMLFEVVNEAKDRRTHTGVLEFVAE--EGTC-----HFPYWMMQNLGLEEGDIVR-VRNISL----PKGTFVELQPVTTEFLQVSNPRAVLEVALRGYAALT-VGDLIYLPFLDKFQLLVTDLRPAPAVSI............................. 182
9 -4.010IDP95088 DNA-binding transcriptional activator AllS [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002918199 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  4..........PETLRTFVSVAETGSFSRAAEKLYKTTATISYRIKLLEDNTGVALF----SRTTRSVLLTPAGMHLLAAREWLGWIDSMPGELQQINDGVERQVNIVVNNLMYDPQAIARQRYPFT-------QFHFSRQIYMGVWDTLLLAIGVTGTEPLAENMAVYLGEVTWLFVMSPHHPLSQQTDPLSEAQLRRYPAVNIEDSARRLTKRVAWRLPGQKEIVVPDIETKVAA............................................................................................................................................... 231
10 -3.860IDP90432 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_865 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  10  3........KIAQSFKPYIMEPGAKILIP--STLYAQVFPSLWRIFSSSHELVNEGRVPIQGPLQRFAVFQNRGGVAVPNGCYTRSIADLPSASFYSGEYVSFGVHKHADLEKIRRRKDLKEILPLLQNQPNLSMEKTEVALLLDTLDAAIAEPNKERVFSLLERFVYAGLSKTLLPRLYDEEYQGIVSEDPRPGNEAVPFSLL--ALSMRRI--FIQESDGVVTLL-------------ALPPEFPCGRWIGLY------LENIGEISFEWSKKTIRRVILKAHVSRELAIISPGVHSSRFRVEEQGRIISCKIKN------LLEKVEIKAGTTYLWDRFC...................................... 328

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.