current user: public

If you have questions about the server, please let us know.

Query: gi|30260202|ref|NP_842579.1| inosine 5`-monophosphate dehydrogenase (BA_0008) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .
# Score Template Links and tools%idFirst MWESKFVKEGLTFDDVLLVPAKSDVLPREVSVKTVLSESLQLNIPLISAGMDTVTEADMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSESGVISDPFFLTPEHQVYDAEHLMGKYRISGVPVVNNLDERKLVGIITNRDMRFIQDYSIKISDVMTKEQLITAPVGTTLSEAEKILQKYKIEKLPLVDNNGVLQGLITIKDIEKVIEFPNSAKDKQGRLLVGAAVGVTADAMTRIDALVKASVDAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAGNVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGVPQLTAVYDCATEARKHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEIYQGRQFKVYRGMGSVGAMEKGSKDRYFQEGNKKLVPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFLRENAQFIRMSGAGLLESHPHHVQITKEAPNYSLLast
1 -130.000IDP01178 gene: guaB; inosine 5`-monophosphate dehydrogenase BA_0008 [Bacillus anthracis str. Ames]  ali follow..  100  1MWESKFVKEGLTFDDVLLVPAKSDVLPREVSVKTVLSESLQLNIPLISAGMDTVTEADMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSESGVISDPFFLTPEHQVYDAEHLMGKYRISGVPVVNNLDERKLVGIITNRDMRFIQDYSIKISDVMTKEQLITAPVGTTLSEAEKILQKYKIEKLPLVDNNGVLQGLITIKDIEKVIEFPNSAKDKQGRLLVGAAVGVTADAMTRIDALVKASVDAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAGNVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGVPQLTAVYDCATEARKHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEIYQGRQFKVYRGMGSVGAMEKGSKDRYFQEGNKKLVPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFLRENAQFIRMSGAGLLESHPHHVQITKEAPNYSL 487
2 -122.000IDP06363 inosine-5`-monophosphate dehydrogenase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] NP_604128 [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]  ali follow..  61  1.MNGKIVKEGITFDDVLLIPAKSDVLPNEVSLKTRLTKKITLNLPILSAAMDTVTESDLAIALARQGGMGFIHKNMSIEEQAAEVDRVKRSESGMITNPITLNKDSRVYQAEELMSRYKISGLPVIEDD--GKLIGIITNRDIKYRKDLDQPVGDIMTSKGLITAPVGTTLEQAKEILLANRIEKLPITDQNGYLKGLITIKDIDNIIQYPNACKDELGKLRCGAAVGVAPDTIERVSALVKAGVDIITVDSAHGHSQGVINMIKEIKKNFPDLDIVGGNIVTAEAAKELIEAGVAAVKVGIGPGSICTTRVVAGVGVPQLTAVNDVYEYCKDKNIGVIADGGIKLSGDIVKALAAGGDCVMLGGLLAGTKEAPGEEIILEGRRFKIYVGMGSIAAMKRGSKDRYFQVDNSKLVPEGIEGRIAYKGSVKDVVFQLAGGIKAGMGYCGTKTIKDLQINGRFVKITGAGLIESHPHDITITKEAPNYS. 486
3 -121.000IDP04376 gene: guaB; inosine 5`-monophosphate dehydrogenase [Clostridium perfringens ATCC 13124] CPF_2558 [Clostridium perfringens ATCC 13124]  ali follow..  67  1..MARILKTAYTFDDVLLVPNKSEVLPNEVSLKTQLTKKIQLNIPLMSASMDTVTESKMAIAMAREGGIGIIHKNMTIEDQAREVDRVKRQENGVITDPIFLSEDHTVREALDLMAQYRISGVPVTREG---KLVGIITNRDIVFETNYDKKVSEVMTKSPLVTAKEGTTLTEALEILKQHKIEKLPLVDDENNLKGLITIKDIEKAKAFPNAAKDEKGRLLCGASIGVTNDMMERVDAVVKAKVDVIVLDTAHGHSKGVIEGVKRIKAKYPELQVIAGNIATPEAVRDLAEAGADCVKVGIGPGSICTTRIVAGVGVPQLTAVMDCAEEGKKLGIPVIADGGLKYSGDIVKALAAGACAAMMGSIFAGCEEAPGAIEIYQGRSYKVYRGMGSLGAMAKGSSDRYFQNGTKKFVPEGVEGRIAYKGHLADTIYQLIGGIKSGMGYLGAPTLENLYENANFVVQTSAGFRESHPHDINITKEAPNYSV 482
4 -120.000IDP06352 gene: guaB; hypothetical protein lmo2758 [Listeria monocytogenes EGD-e] NP_466280 [Listeria monocytogenes EGD-e]  ali follow..  73  1MWETKFAKEGLTFDDVLLVPAKSDVLPNDVDLSVEMAPSLKLNVPIWSAGMDTITEAKMAIAIARQGGIGVVHKNMSIEQQAEEIEKVKRSESGVIIDPFYLTPDHQVFAAEHLMGKYRISGVPIVNNEKERKLVGILTNRDLRFISDYSTVIKDVMTKENLVTAPVGTTLKQAEQILQKHRIEKLPLVDEAGILKGLITIKDIEKVIEFPNSAKDKHGRLLAAAAVGITNDTFVRVEKLIEAGVDAIVIDTAHGHSAGVINKISEIRQTFKDVVIVAGNVATAEGARALFEVGVDIVKVGIGPGSICTTRVVAGVGVPQITAIYDCATVAREFGKTIIADGGIKYSGDIVKALAAGGNAVMLGSMLAGTDESPGETEIFQGRQFKTYRGMGSLAAMEHGSKDRYFQADAKKLVPEGIEGRVPYKGSVADIIFQLVGGIRSGMGYTGSPDLRHLREEAAFVRMTGAGLRESHPHDIQITKEAPNYSI 487
5 -120.000IDP06335 gene: guaB; inosine 5`-monophosphate dehydrogenase [Enterococcus faecalis V583] NP_816888 [Enterococcus faecalis V583]  ali follow..  71  5..ETKFAKKGLTFDDVLLIPAESHVLPNDVDMSVQLAKNIKLNIPLMSASMDTVTDSNMAIAMARQGGLGVVHKNMTVAQQADEVRKVKRSESGVIIDPFFLTPTNLVADAEELMSRYRISGVPIVETMENRKLVGIITNRDMRFVTDYQIKIEEVMTKDHLVTAPVGTSLKDAEKILQKHKIEKLPIVDEAGRLSGLITIKDIEKVIEFPNAAKDEHGRLLVAAAVGVTSDTFERAEALLEAGADAIVIDTAHGHSAGVIRKIKEIRETFPEATLIAGNVATAEATKALYDVGVDVVKVGIGPGSICTTRVVAGVGVPQLTAIYDAASVAREYGKAIIADGGIKYSGDIVKALAAGGHAVMLGSMLAGTDESPGEFEIYQGRRFKTYRGMGSLGAMEKGSSDRYFQNEANKLVPEGIEGRVAYKGSVSDIVFQLIGGLKSGMGYVGAADLKALREEAQFVQMSGNGLKESHPHDVQITKEAPNYSV 492
6 -120.000IDP06346 gene: guaB; inosine-5`-monophosphate dehydrogenase [Francisella tularensis subsp. tularensis SCHU S4] YP_170270 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  54  1..MLRITQQAITFDDVLLSPRYSNVLPHQVDLKTNITRDIQLNIPLVSAAMDTVTESRLAIAIAQEGGIGIIHKNMSIQAQAQEVKKVKRFENGMVIDPITIKQESSIKEIMQLAKEHNFSGFPVVDDN--NKIIGIVTRRDFRFAKDLDEPVSIMTPREKLVTVPEDASQGAIKKKLHEHKIEKLLVVNEQGELVGLITTKDIERSQNKPNACKDSLGRLRVGAAVGTAANTKERVAALAAEGVDIIVVDTAHGHSQGVLDTVKWVKENYPHIQVIGGNIATAEAAKDLVKAGADAVKVGIGPGSICTTRIVAGVGVPQITAIANVAEALKGTGVPVIADGGIRYSGDIAKAIVAGASVVMIGGLFAGTEESPGEVELFQGRSYKSYRGMGSLGAMEKGSSDRQSETEAKKFVPEGVEGRVPYKGLLSAVIHQLIGGLKSSMGYTGSKDIQTMRTEPTFVQITGAGFNESHVHNVTITKEPPNYQ. 485
7 -119.000IDP06357 gene: guaB; inosine 5`-monophosphate dehydrogenase [Haemophilus influenzae Rd KW20] NP_438392 [Haemophilus influenzae Rd KW20]  ali follow..  54  1.MSLRIKQEALTFDDVLLVPAHSTVLPNTANLSTQLTKEIRLNIPMLSAAMDTVTETKLAISLAQEGGIGFIHKNMTIERQADRVRKVKKFESGIVSEPVTVLPNLTLAELAEMVKKNGFAGYPVVDGE--NNLIGIITGRDTRFVKDLSKTVSVMTKKEDLVTVKEGASREEILELMHQHRVEKVLVVNDSFKLKGMITVKDFQKAEQKPNACKDEFGRLRVGAAVGAGAGNEERIDALVKAGVDVLLIDSSHGHSEGVLQRVRETRAKYPNLPIVAGNVATAEGAIALADAGASAVKVGIGPGSICTTRIVTGVGVPQITAIADAAAALKDRGIPVIADGGIRFSGDIAKAIAAGASCVMVGSMFAGTEEAPGEIELYQGRAFKSYRGMGSLGAMAKGSSDRQSDNAADKLVPEGIEGRIPYKGYLKEIIHQQMGGLRSCMGLTGCATIDELRTKAEFVRISGAGIKESHVHDVAITKEAPNYRM 487
8 -119.000IDP06347 gene: guaB; inosine 5`-monophosphate dehydrogenase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001336474 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]  ali follow..  54  1..MLRIAKEALTFDDVLLVPAHSTVLPNTADLSTQLTKTIRLNIPMLSAAMDTVTEARLAIALAQEGGIGFIHKNMSIERQAEEVRRVKKHESGVVTDPQTVLPTTTLREVKELTERNGFAGYPVVTEE--NELVGIITGRDVRFVTDLNQPVVYMTPKERLVTVREGESREVVFAKMHEKRVEKALVVDESFHLRGMITVKDFQKAERKPNACKDEQGRLRVGAAVGAGAGNEERVDALVAAGVDVLLIDSSHGHSEGVLQRIRETRAKYPDLQIIGGNVATGAGARALAEAGCSAVKVGIGPGSICTTRIVTGVGVPQITAVSDAVEALEGTGIPVIADGGIRFSGDIAKAIAAGAAAVMVGSMLAGTEESPGEIELYQGRSYKSYRGMGSLGAMSKGSSDRQSDNAADKLVPEGIEGRVAYKGRLKEIIHQQMGGLRSCMGLTGCGTIDLLRTKAEFVRISGAGIQESHVHDVTITKESPNYRL 486
9 -119.000IDP06364 gene: guaB; inosine-5`-monophosphate dehydrogenase [Coxiella burnetii RSA 493] NP_820331 [Coxiella burnetii RSA 493]  ali follow..  52  2....RVKEEALTFDDVLLLPNYSEVLPKDVSLTTRLTREITLNIPLLSAAMDTVTEARLAIALAEAGGIGILHKNMSPTYQANEVRKVKKFESGVVFDPITVSPESTIGELKKITSEYNISGLPVVEGE---QLIGIITSRDIRFETDMQQKVNLMTPKDRLITIKEGASRDEIINLFRQHRVEKLLVINDRFELRGLITVKDILRSERNPNACKTKSGQLRVGAAVGTGGETPDRVTALAAGGVDVIVVDTAHGHSKGVIEQVKWIKKNYPHIPVIAGNIATASAARALADAGVDAVKVGMGPGSICITRVVAGIGVPQITAINAVAAELKKEDISIIADGGIRFSGDICKAIAAGAHAVMIGGLFAGTEEAPGEEVLYQGRSYKAYRGMGSAGAMFGKYGSQESFDKQEKYVPEGIEGRVPYKGPLRGVVHQLIGGLRSGMGYTGCRTIDEMRTKTKFIRVTNAGVRESHVHDVTVTKESPNYSV 487
10 -119.000IDP01005 gene: guaB; inosine 5`-monophosphate dehydrogenase STM2511 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  54  1..MLRIAKEALTFDDVLLVPAHSTVLPNTADLSTQLTKTIRLNIPMLSAAMDTVTEARLAIALAQEGGIGFIHKNMSIERQAEEVRRVKKHESGVVTDPQTVLPTTTLHEVKALTERNGFAGYPVVTED--NELVGIITGRDVRFVTDLNQPVVYMTPKERLVTVREGEAREVVLAKMHEKRVEKALVVDDNFHLLGMITVKDFQKAERKPNSCKDEQGRLRVGAAVGAGAGNEERVDALVAAGVDVLLIDSSHGHSEGVLQRIRETRAKYPDLQIIGGNVATGAGARALAEAGCSAVKVGIGPGSICTTRIVTGVGVPQITAVSDAVEALEGTGIPVIADGGIRFSGDIAKAIAAGASAVMVGSMLAGTEESPGEIELYQGRSYKSYRGMGSLGAMSKGSSDRQSDNAADKLVPEGIEGRVAYKGRLKEIIHQQMGGLRSCMGLTGCATIDELRTKAEFVRISGAGIQESHVHDVTITKESPNYRL 486
11 -119.000IDP06339 inosine 5`-monophosphate dehydrogenase [Shigella flexneri 2a str. 2457T] NP_838071 [Shigella flexneri 2a str. 2457T]  ali follow..  54  1..MLRIAKEALTFDDVLLVPAHSTVLPNTADLSTQLTKTIRLNIPMLSAAMDTVTEARLAIALAQEGGIGFIHKNMSIERQAEEVRRVKKHESGVVTDPQTVLPTTTLREVKELTERNGFAGYPVVTEE--NELVGIITGRDVRFVTDLNQPVVYMTPKERLVTVREGEAREVVLAKMHEKRVEKALVVDDEFHLIGMITVKDFQKAERKPNACKDEQGRLRVGAAVGAGAGNEERVDALVAAGVDVLLIDSSHGHSEGVLQRIRETRAKYPDLQIIGGNVATAAGARALAEAGCSAVKVGIGPGSICTTRIVTGVGVPQITAVADAVEALEGTGIPVIADGGIRFSGDIAKAIAAGASAVMVGSMLAGTEESPGEIELYQGRSYKSYRGMGSLGAMSKGSSDRQSDNAADKLVPEGIEGRVAYKGRLKEIIHQQMGGLRSCMGLTGCGTIDELRTKAEFVRISGAGIQESHVHDVTITKESPNYRL 486
12 -119.000IDP06354 gene: guaB; inosine 5`-monophosphate dehydrogenase [Streptococcus mutans UA159] NP_722440 [Streptococcus mutans UA159]  ali follow..  69  3NWDTKFLKKGYTFDDVLLIPAESHVLPNEVSMQTKLAKNLTLNIPIITAAMDTVTDSKMAIAIARAGGLGVVHKNMSIKEQAEEVRKVKRSENGVIIDPFFLTPEHKVSEAEELMQRYRISGVPVVETLDNRKLIGIITNRDMRFISDYETPISEHMTSEKLVTAPVGTDLETAERILHEHRIEKLPLIDEKGRLSGLITIKDIEKVIEFPNAAKDEFGRLLVAGAVGVTSDTFERAEALFEAGADAIVIDTAHGHSAGVLRKIAEIRAHFPDRTLIAGNIATAEGARALYEAGVDVVKVGIGPGSICTTRVVAGVGVPQITAIYDAASIAREYGRTIIADGGIKYSGDIVKALAAGGNAVMLGSMFAGTDEAPGETEIFQGRKFKTYRGMGSIAAMKKGSSDRYFQNEANKLVPEGIEGRVAYKGAAADIVFQMLGGIRSGMGYVGAANLKELHENAQFIEMSGAGLIESHPHDVQITNEAPNYSV 492
13 -119.000IDP06336 inosine 5`-monophosphate dehydrogenase [Corynebacterium diphtheriae NCTC 13129] NP_938956 [Corynebacterium diphtheriae NCTC 13129]  ali follow..  55  11DDPNKVALVGLTFDDVLLLPDASEVIPSEVSTSTQLTRNISLNIPVVSAAMDTVTESRMAIAMAREGGMGILHRNLSIEEQAAHVETVKRSESGMVTDPVTCSPDMSISEVDALCARFRISGIPVVDSE--GKLLGICTNRDMRFEQNFDRKVSEVMTPMPLVVAEEGVTKEQALSLLSTNKVEKLPIVDKQGKLVGLITVKDFVKTEQYPNASKDATGRLLVGAGIGVGEESWTRAGSLVDAGVDVLVVDSAHAHSKGVLDMVSRVKQEWGRVDVIGGNLATRSAAKAMIEAGADAIKVGIGPGSICTTRVVAGVGAPQITAIMEASVPAHAAGVPIIADGGMQFSGDIAKALAAGASTVMLGSMLAGTAEAPGDIVVVGGKQYKRYRGMGSMGAMQGYSKDRYFQADEDKLVPEGIEGRVPFRGSIDAITHQLVGGLRAAMGYTGSATINDLW-NARFVQITSAGLKESHPHHIQQTVEAPNYH. 506
14 -117.000IDP04364 gene: guaB; inosine 5`-monophosphate dehydrogenase [Vibrio cholerae O1 biovar eltor str. N16961] VC0767 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  55  1MHMLRIAKEALTFDDVLLVPAHSTVLPNTADLRTRLTKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAQVHQVKIFEAGVVTHPVTVRPEQTIADVMELTHYHGFAGFPVVTEN--NELVGIITGRDVRFVTDLTKSVAVMTPKERLATVKEGATGAEVQEKMHKARVEKILVVNDEFQLKGMITAKDFHKAESKPNACKDEQGRLRVGAAVGAAPGNEERVKALVEAGVDVLLIDSSHGHSEGVLQRIRETRAAYPHLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAAGVANEYGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRGMGSLGAMSKGSSDRQTDNAADKLVPEGIEGRIAYKGHLKEIIHQQMGGLRSCMGLTGSATVEDLRTKAQFVRISGAGMKESHVHDVQITKEAPNYRL 488
15 -117.000IDP06358 gene: guaB; inosine-5`-monophosphate dehydrogenase [Bordetella pertussis Tohama I] NP_881247 [Bordetella pertussis Tohama I]  ali follow..  55  2....RLVQKALTFDDVLLVPAYSEVLPRDTSLTTRLTRNITLNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNLSADDQAKEVARVKRHEFGIVIDPVTVTPDMKVRDAIALQRQHGISGLPVVEGR---KLVGIVTNRDLRFEDRLDQPLRIMTPQDRLVTMKEGATLDEAQALMHKHRLERVLIVNDAFELRGLATVKDIVKNTEHPYACKDSQGQLRVGAAVGVGAGTEERVEKLVAAGVDVIIVDTAHGHSAGVLERVRWVKQNYPKVEVIGGNIATAAAARALVEAGADGVKVGIGPGSICTTRIVAGVGVPQISAISDVAKALEGTGVPLIADGGIRYSGDVAKALAAGAFACMMGGMFAGTEEAPGEVVLFQGRSYKSYRGMGSLGAMADGSADRYFANNADKLVPEGIEGRVPYKGSVLAIIYQLVGGIRASMGYCGCASIDDMRTKTQFVEITSAGVRESHVHDVQITKEAPNYR. 484
16 -117.000IDP06359 inosine 5`-monophosphate dehydrogenase [Burkholderia cenocepacia J2315] YP_002231190 [Burkholderia cenocepacia J2315]  ali follow..  52  2....RLIQKALTFDDVLLVPAFSDVLPRDTSLKTKLTRNISLNMPLVSAAMDTVTEGRLAIAMAQQGGVGIVHKNLTPAEQAREVAKVKRFESGVVRDPITVPPQMKVRDVIALSRQHGISGFPVVEGPQL--VGIVTNRDLRFETRLDEPVKSIMTPRERLVTVKEGTPLAEAKALMHSHRLERVLVVNDAFELRGLMTVKDITKQTEHPDACKDEHGKLRAGAAVGVGPDNEERVELLVQAGVDVIVVDTAHGHSKGVLERVRWVKQNFPHVEVIGGNIATAAAAKALVEYGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAEALKGTGVPCIADGGVRFSGDVSKALAAGANAVMMGSMFAGTEEAPGDVFLYQGRQYKSYRGMGSVGAMKDGAADRYFQANIDKLVPEGIEGRVAYKGSVNAILFQLVGGVRASMGYCGCKTIDELHEKAEFVQITAAGMRESHVHDVQITKEAPNYHV 485
17 -117.000IDP06356 IMP dehydrogenase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] YP_001865 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130]  ali follow..  38  24.......QIGLTYRDFLVLPGFIDFHPSEVELETRLTRNIKLKRPFISSPMDTVTESQMAIAQALMGGIGIIHYNNTIEEQVALVEKVKRFENGFITDPVILGPKNVIRDLDAIKERKGFTGIPVTEDGTRNSKLIGIVTNRDIDFEKNREITLDKVMTTNLITGKEGITLQDANEIIKKSKIGKLPIVDSQGKLVSLVSRSDLKKNKEFPDASKDERKRLRCGAAVSTLLESRDRVAALYEAGVDVIIIDSAQGNSNYQIEMIQFIKKEFKNLDIVAGNVVTRAQAENLIRAGADGLRIGMGPGSICITQDTMAVGRAQATAIYQTAKHSAKYDVPVIADGGISNIGDIANSLAIGASTCMMGFMFAGTTEAPGEYFYENGIRLKKYRGMASIEAMKAGGDKRYFNEGQKVKVAQGVSGSVVDRGSILNFIPYLSQGLRLSFQDMGYKSIPEIHKKLRFERRSESAQAQGSVHGLYSF-SAPTMR. 506
18 -117.000IDP06332 inosine 5`-monophosphate dehydrogenase [Neisseria gonorrhoeae FA 1090] YP_207925 [Neisseria gonorrhoeae FA 1090]  ali follow..  54  2....RIVEKAYTFDDVLLVPAHSTVLPRDVKLQTKLTREITLNLPLLSAAMDTVTEARLAISMAQEGGIGIIHKNMPPEMQARAVSKVKRHESGVVKDPVTVAPTTLIREVLEMRAQRKRKMSGLPVVE-NGKVVGIVTNRDLRFENRVDLPVSAMTPRERLVTVPEGTSIDEARELMHTYKVERVLVLNEKDELKGLITIKDILKTTEFPNANKDSEGRLRVGAAVGTGGDTDERVKALVEAGADVIVVDTAHGHSQGVIDRVRWVKETYPHIQVIGGNIATAKAALDLVTVGADAVKVGIGPGSICTTRIVAGVGVPQLTAIHNVAEALKGTGVPLIADGGIRFSGDIAKALAAGAYSVMLGGMFAGTEEAPGEIELYQGRSYKSYRGMGSLGAMSQGSADRYFQDSTDKYVPEGIEGRVPYKGPIVNIIHQLTGGLRSSMGYLGCANIAEMHEKAEFVEITSAGMSESHVHDVQITKEAPNYH. 486
19 -116.000IDP04126 gene: guaB; inosine 5`-monophosphate dehydrogenase [Yersinia pestis CO92] YPO2871 [Yersinia pestis CO92]  ali follow..  54  1..MLRIAKEALTFDDVLLVPAHSTVLPNTAELGTQLTATIRLNIPMLSAAMDTVTESRLAIALAQEGGLGFIHKNMSIERQAEEVSRVKKHESGVVTEPQTVTPTTTLRQVKELTARNGFAGYPVVTED--YELVGIITGRDVRFVTDLDQPVTAMTPKERLVTVKEGETREVVLQKMHEKRVEKVLVVDDSFHLRGMITVKDFQKAERKPNACKDEHGRLRVGAAVGAGAGNEERIDALVAAGVDVLLIDSSHGHSEGVLQRIRETRAKYPNLQIVGGNVATGAGAKALADAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAVEALEGTGIPVIADGGIRFSGDIAKAIAAGASCVMVGSMLAGTEESPGEIELYQGRSFKSYRGMGSLGAMSKGSSDFQTDNAADKLVPEGIEGRVAYKGLLKEIVHQQMGGLRSCMGLTGCGTINELRTKAEFVRISGAGIQESHVHDVTITKESPNYRM 486
20 -116.000IDP92133 inosine 5`-monophosphate dehydrogenase, putative [Toxoplasma gondii ME49] TGME49_033110 [Toxoplasma gondii ME49]  ali follow..  41  12....NTTVFGFTYDDLILMPGHIDFGVNDVDLSTRITRNLHVRTPIVSSPMDTVTEHRMAIGCALMGGMGVIHNNMETARQVAEVQKVKRYENGFILDPFVLRPSDSVADVYRIKEKYGYSSVPITDTGMGGKLLGIVTSRDIDFLTDVHTPLSEVM-TSDLVVGHEPVQLAEANELLRESKKGKLPIVNDNFELVALISRNDLKKNREFPLASKDSNKQLLVGAAVSTKPHDIERAKALQEAGADVLVVDSSQGDSIYQVDLVKRLKAAFPELQIIGGNVVTARQAKSLIDAGVDGLRIGMGSGSICTTQVVCAVGRAQATAVYHVCKYAREHGLPCIADGGIQNSGHVMKALALGANAVMMGSMLAGTEEAPGEYYFHNGVRVKTYRGMGSLDAMRAGTAARYFAENQTIRVAQGVSGCVVDKGTVMQLIPYVIQGVKHGMQDIGARTLRDLHAQLRFDVRSGAAQREGDVHDLHSFERK..... 548
21 -115.000IDP91646 gene: guaB2; inosine 5`-monophosphate dehydrogenase [Mycobacterium tuberculosis H37Rv] NP_217928 [Mycobacterium tuberculosis H37Rv]  ali follow..  53  35DDPHKVAMLGLTFDDVLLLPAASDVVPATADTSSQLTKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVEMVKRSEAGMVTDPVTCRPDNTLAQVDALCARFRISGLPVVDDD--GALVGIITNRDMRFEVDQSKQVAEVMTKAPLITAQEGVSASAALGLLRRNKIEKLPVVDGRGRLTGLITVKDFVKTEQHPLATKDSDGRLLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRPAGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAMRGRGGATSYSKDRDKLVPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTIEVLQ-QAQFVRITPAGLKESHPHDVAMTVEAPNYY. 527
22 -115.000IDP06349 inosine-5`-monophosphate dehydrogenase [Bacteroides thetaiotaomicron VPI-5482] NP_812756 [Bacteroides thetaiotaomicron VPI-5482]  ali follow..  59  3FIADKIVMDGLTYDDVLLIPAYSEVLPRTVDLSTKFSRNIELKIPFVTAAMDTVTEAKMAIAIAREGGIGVIHKNMSIEEQARQVAIVKRAENGMIYDPVTIKRGSTVSDALGIMAEYKIGGIPVVDDE--GYLVGIVTNRDLRFERDMTKHIDLMTPKERLVTTNQSTDLESAAQILQKHKIEKLPIVGMDGKLIGLVTYKDITKAKDKPMACKDAKGRLRVAAGVGVTADTLDRMQALVDAGADAIVIDTAHGHSMYVIEKLKEAKKRFPNIDIVVGNIATGEAAKALAEAGADAVKVGIGPGSICTTRVVAGVGVPQLSAVYDVAKALKGTGVPLIADGGLRYSGDVVKALAAGGYCVMIGSLVAGTEESPGDTIIFNGRKFKSYRGMGSLEAMENGSKDRYFQSDVKKLVPEGIAARVPYKGTLYEVVYQLSGGLRAGMGYCGAANIEKLH-DAKFTRITNAGVMESHPHDVTITSESPNYS. 489
23 -114.000IDP90781 gene: guaB; inosine 5`-monophosphate dehydrogenase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1058c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  59  2....KIVKRALTFEDVLLRPGYSEVLPKEVKIHTKLTKNITLNMPLISAAMDTVTEHRAAIMMARLGGLGVIHKNMDIASQVREVKRVKKSESGVIIDPIFVSPKASVAEALEIMAEYRISGVPVVDED--KKLIGILTNRDLRFESDFSNLVENVMTKMPLITAPKGCTLDDAEKIFSTNKVEKLPIVDEQGRLEGLITIKDLKKRKEYPDANKDNFGR--LRVGAAIGVGQMDRVDALVEAGVDVVVLDSAHGHSKGIIDTVKAIKAKYPNLDLIAGNIATAAAAKALCEAGVDAVKVGIGPGSICTTRIVSGVGVPQISAIDECVEEANKFGVPVIADGGIKYSGDIAKALAVGASSVMIGSLLAGTDESPGELFTYQGRQYKSYRGMGSLGAMQKGSSDRQQGTAQDKLVPEGIEGRVPYVGSIRSVVHQLLGGLRSSMGYVGAKDIEDFQKRAEFVEITTAGLKESHVHDVTITHEAPNYKV 482
24 -114.000IDP06360 inosine-5`-monophosphate dehydrogenase [Rhodobacter sphaeroides 2.4.1] YP_352930 [Rhodobacter sphaeroides 2.4.1]  ali follow..  54  3......IREALTFDDVLLVPAASSVLPSDADTSTFVTKAIRMNIPLLSSAMDTVTEGRMAIAMAQAGGIGVIHRNLGIEEQAREVSRVKRFESGIVYAPITLRPDQTLADAKALQERYNVTGFPVVDES--GRVVGIVTNRDMRFANDDRTPVKVMMTSDNLAILQEPADRDTAISLMKARRIEKLLVTDGQGKLTGLLTLKDTEKSVLNPNACKDELGRLRVAAASTVGEAGFERSQALIEAGVDMVVIDTAHGHSEGVSLAVERIKAFSNSVQVVAGNVATAEATRALIGAGADAVKVGIGPGSICTTRIVAGVGVPQLTAIMDAAGAAG--DVPVIADGGIKFSGDFAKAIAAGASCAMVGSAIAGTDESPGEVILYQGRSFKSYRGMGSLGAMARGSADRQKDAASDKLVPEGIEGQVPYKGPAAAVIHQMVGGLRAAMGYTGNRTVAEMRQGCRFVRITGAGLKESHVHDVQITRESPNYRL 481
25 -114.000IDP06340 inosine 5`-monophosphate dehydrogenase [Helicobacter pylori 26695] NP_207622 [Helicobacter pylori 26695]  ali follow..  55  2....RILQRALTFEDVLMVPRKSSVLPKDVSLKSRLTKNIRLNIPFISAAMDTVTEHKTAIAMARLGGIGIVHKNMDIQTQVKEITKVKKSESGVINDPIFIHAHRTLADAKVITDNYKISGVPVVDDK--GLLIGILTNRDVRFETDLSKKVGDVMTKMPLVTAHVGISLDEASDLMHKHKIEKLPIVDKDNVLKGLITIKDIQKRIEYPEA--NKDDFGRLRVGAAIGVGQLDRAEMLVKAGVDALVLDSAHGHSANILHTLEEIKK-SLVVDVIVGNVVTKEATSDLISAGADAIKVGIGPGSICTTRIVAGVGMPQVSAIDNCVEVASKFDIPVIADGGIRYSGDVAKALALGASSVMIGSLLAGTEESPGDFMIYQGRQYKSYRGMGSIGAMTKGSSDRQEGVASEKLVPEGIEGRVPYRGKVSDMIFQLVGGVRSSMGYQGAKNILELYQNAEFVEITSAGLKESHVHGVDITKEAPNYY. 480
26 -113.000IDP06341 gene: guaB; inosine-5`-monophosphate dehydrogenase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] YP_095750 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]  ali follow..  55  7.......QQSLTFDDVLLVPAHSTILPKDVSLKTKLTRAIHLNMPLISAAMDTVTEARLAIALAQEGGLGIIHKNMSIADQAEEVRRVKKFESGMVKDPISVTPDLTVKELLAVMTKYNFSGVPVVDGK---HLVGIVTSRDIRFETNMNLTVQVMTPKGRLVTVKEGASREEVRSLLHKHRIEKLLVVNENFELRGLITVKDIQKAKDNPYACKDSFEQLRVGAAVGVGEGTDERVAALVESGVDVIVVDTAHGHSQGVLNRVKWIKKNYPDVQVIGGNIATAAAARDLYEAGADAVKVGIGPGSICTTRIVTGVGIPQISAIANVAQ-ELKGIIPVIADGGIRFSGDVCKALAAGADTVMLGSMFAGTEESPGEIELYQGRTYKNYRGMGSIGAMSLAQGSSDASLGTEKLVPEGIEGRVPYKGPVQTIIHQLLGGLRSCMGYTGCATIEELHSKTEFVQVTNAGMRESHVHDVSITKQAPNYQV 488
27 -112.000IDP06344 inositol-monophosphate dehydrogenase [Staphylococcus aureus subsp. aureus Mu50] NP_370914 [Staphylococcus aureus subsp. aureus Mu50]  ali follow..  71  1MWESKFAKESLTFDDVLLIPAQSDILPKDVDLSVQLSDKVKLNIPVISAGMDTVTESKMAIAMARQGGLGVIHKNMGVEEQADEVQKVKRSENGVISNPFFLTPEESVYEAEALMGKYRISGVPIVDNKEDRNLVGILTNRDLRFIEDFSIKIVDVMTQENLITAPVNTTLEEAEKILQKHKIEKLPLVKDGRLE-GLITIKDIEKVIEFPNAAKDEHGRLLVAAAIGISKDTDIRAQKLVEAGVDVLVIDTAHGHSKGVIDQVKHIKKTYPEITLVAGNVATAEATKDLFEAGADIVKVGIGPGSICTTRVVAGVGVPQITAIYDCATEARKHGKAIIADGGIKFSGDIIKALAAGGHAVMLGSLLAGTEESPGATEIFQGRQYKVYRGMGSLGAMEKGSNDRQEDKAPKKFVPEGIEGRTAYKGALQDTIYQLMGGVRAGMGYTGSHDLRELREEAQFTRMGPAGLAESHPHNIQITKESPNYSF 488
28 -106.000IDP06331 inosine 5-monophosphate dehydrogenase [Listeria monocytogenes EGD-e] NP_463665 [Listeria monocytogenes EGD-e]  ali follow..  34  7.......EPSRTFSEFLLVPGYSSAECTNVSLKTPIVKAITMNIPLVSAIMQAVSDDNMGIALATEGGVSFIFGSQSIESEAAMVSRVKNHKAGFVISDSNISPDKTLQDILDLKEKTGHSTVAVTEDGTHGKLLGIVTSRDYRVTRMSPDEADFMTPFEKLVTANKSTTLKEANNIIWDNKLNALPLVDDNEHLVHMVFRKDYDSNKENKLELLDSSKRY-VVGAGINTRDYEERVPALVEAGADILCIDSSEGYSEWQKRTLDYVRGKYGTVKVGAGNVVDRDGFRYLAEAGADFVKVGVGGGSICITREQKGIGRGQATALIDVAKARDEYFIPICSDGGIVYDYHMTLALAMGADFIMLGRYFSRFDESPTNKVNLNGTYMKEYWGEGANRARNWQR--YDLGGDKKLSFEEGVDSYVPYAGSLKDNVAISLSKVRSTMCNCGALNIPELQQKAKITLVSSTSIVEGGAHDVVVKDASNNLI. 501
29 -104.000IDP06351 IMP dehydrogenase [Acinetobacter baumannii ATCC 17978] YP_001086312 [Acinetobacter baumannii ATCC 17978]  ali follow..  51  1..................................................MDTVTESRMAIAMAQNGGIGILHKNMDIAAQAAEVRRVKKFEAGMVKDPITVSPETTVRELIAITSANNISGVPVVKDG---KVVGIVTGRDTRFETNEQPVSNIMTGQDRLVTVREGESKENIQALLQKHRIEKVLVVGESNELKGLITVTDFRKAESYPNSCKDDLGRLRVGAAVGTGADTPSRVEALVEAGVDVIVVDTAHGHSAGVIERVRWVKQNFPQVQVIGGNIATGDAALALLDAGADAVKVGIGPGSICTTRIVAGIGMPQISAIDSVASALKD-QIPLIADGGIRFSGDMAKAIGAGASTIMVGSLLAGTEEAPGEVEFFQGRYYKAYRGMGSLGAMAGATGSQDSKAGAEKLVPEGIEGRVPYKGPMGNIVHQMMGGLRSSMGYTGSAVIEDLRQNAKFVKITSAGMSESHVHDVTITKEAPNYRV 439
30 -83.900IDP04181 GMP reductase [Vibrio cholerae O1 biovar eltor str. N16961] VCA0197 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  34  1..MRIEQELKLGFKDVLFRPKRSTLKSRSREFTFKHSGRQWSGVPVIAANMDSVGSFAMAKALAEHGVMTAVHKHYTVADWAEFVKSADKATLNNVM-----------------------------------------------------------------------------------------------------------------------------VSTGTSEADFQKTKDVMALSDELIFICIDIANGYSEHLVEYVQRVRAAFPDKVISAGNVVTGDMVEELILAGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECADAAHGLGGRIIGDGGCTCPGDVAKAFGGGADFVMLGGMLAGHEEAGGELIVKDGETFMKFYGMSSKSAMDKHSG-----GVAGYRAAEGKTVLLPYRGSVHGTIQDILGGVRSTCTYVGAAELRELTKRTTFIRVQEQ---ENNVYGR........... 346
31 -81.400IDP92622 gene: cgd6_20; inosine 5`-monophosphate dehydrogenase BAJ78048 [Cryptosporidium parvum]  ali follow..  54  1.MGTKNIGKGLTFEDILLVPNYSEVLPREVSLETKLTKNVSLKIPLISSAMDTVTEHLMAVGMARLGGIGIIHKNMDMESQVNEVLKVKN-------------------------------------------------------------------------------------WISNLEKNESTPDQNLDKESTDGKDTKSNNNIDAYSNENLDNKGRLRVGAAIG--VNEIERAKLLVEAGVDVIVLDSAHGHSLNIIRTLKEIKSKMN-IDVIVGNVVTEEATKELIENGADGIKVGIGPGSICTTRIVAGVGVPQITAIEKCSSVASKFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKELIGDTVYKYYRGMGSVGAMKSGSGDRYFQEPENKMVPEGIEGRVKYKGEMEGVVYQLVGGLRSCMGYLGSASIEELWKKSSYVEITTSGLRESHVHDVEIVKEVMNYS. 399
32 -79.600IDP06176 gene: guaC; guanosine 5`-monophosphate oxidoreductase [Helicobacter pylori J99] NP_223508 [Helicobacter pylori J99]  ali follow..  31  2........KVFDYEDVQLIPNKCIVNSRSECDTTVILGKHAFKMPIVPANMQTIINESIAEFLAENGYFYIMHRFNGSARIPFVKKMKER---------------------------------------------------------------------------------------------------------------------------------QLISSISVGVKKEECLFVEELAKQGLTYITIDIAHGHSNSVIEMIQRIKTRLPETFVIAGNVGTPEAVRELENAGADATKVGIGPGKVCITKIKTGFGTGGWQLAALRWC-AKAARKPIIADGGIRTHGDIAKSIRFGATMVMIGSLFAGHEESSGETKIENGIAYKEYFGSASEFQKGEKK------------NIEGKKIWIQHKGSLKNTLIEMHQDLQSSISYAGGRDLEAIR-KVDYVIVKNSIFNGDTI.............. 325
33 -19.200IDP91254 probable 2-nitropropane dioxygenase [Staphylococcus aureus subsp. aureus Mu50] NT02SA0910 [Staphylococcus aureus subsp. aureus Mu50]  ali follow..  15  1.............................MWNKNRLTQMLSIEYPIIQAGMAGSTTPKLVASVSNSGGLGTI--YFNTQQLEDEIDYVRQLTSNSFGVNVFVPSQQSY-------------------------------------------------------------------------------------------TSSQIENMNAWLKPYRRALHLEEPVVKIIEEQQFKCHIDTIIKKQVPVCCFTFGIQNE----SIIERLKEA-----KLIGTATSVDEAIANEKAGMDAIVAGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVVSIPVIAAGGIMDGRGVLASIVLGAEGVQMGTAFLTSQDSNASELLRDAVVTKAFSGKLARGINNRRKAAANIGDKELTHMWSGQSPRLATTHPANTIMSNIINQINQIMQ........................................... 353
34 -18.100IDP01861 gene: nanE; N-acetylmannosamine-6-phosphate 2-epimerase [Salmonella typhimurium LT2] STM3337 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  16  87........................................................................................................................................................................................................................................FLDDVDALAQAGAAIIAVDGTARQRPVAVEAL--LARIHHHHLLAMADCSSVDDGLACQRLGADIIGTTMSGYTTPDT---------PEEPDLPLVKALHDAGCRVIAEGRYNSPALAAEAIRYGAWAVTVGSAITRLEHICGWY.............................................................................................................. 220
35 -17.600IDP04524 N-acetylmannosamine-6-phosphate 2-epimerase [Salmonella typhimurium LT2] STM1129_1_226 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  17  87........................................................................................................................................................................................................................................YLQDVDALAQAGADIIAFDASRSRPVDIDSLLTRIRLH-----LAMADCSTVNEGISCHQKGIEFI----------TTLSGYTGPITPVEPDLAMVTQLSHAGCRVIAEGRYNTPALAANAIEHGAWAVTVGSAITRIEHICQWFS............................................................................................................. 221
36 -17.000IDP91242 predicted coding region HP0773 [Helicobacter pylori 26695] HP0773 [Helicobacter pylori 26695]  ali follow..  14  5...............................LKPLKIGKHTIKFPIFQGGMGVISWDELAGNVAKEGALGVI--GTGYYKNMRFVERIVAKKPFEALNFYSKKANEIFANARKICGNNPLGANILYAINDYGRVLRDSCEAGA-----------------NIIITGAGLPTNMPEFAKDFSDVALIPIISSAKALKILC-----------------------------------KRWSDRYKRIPDAFIVEGPLS----------------------GGH-------------------QGFKYEDCFKEEFRLENLVPKV-----VEASKEWGNIPIIAAGGIWDRKDIDTMLSLGASGVQMATRFLGTKECDAKVYADVGYPARAINTGVIKRIEEGNAPKIACVSNCVAPCNRGEEAKKVGYCIADGLGRSYLGNREEGLYFTGGYRVDKIISVHELIKELTEG.................... 363
37 -16.700IDP05696 hypothetical protein lmo2170 [Listeria monocytogenes EGD-e] lmo2170 [Listeria monocytogenes EGD-e]  ali follow..  26  2..................................SLTEMLQIKYPILQGAMAQIATYELASAVSNAGGLGII--GMSADALREQIRLCKE------------------------KTTKPFAVNIMLMMPNCPELVDVIIEEDVR--------------------------------------------------------------------------------------------------------VVTTGAGTPKPFMEKFKAA--------KVIAVIPSVKIAQKMEEIGVDAVVAGTEAGG-----------VGETTTMALVRQVVSAVNIPVIAAGGIADGHGMAAVYALGASGVQIGTLFLVAEECPVPASFKQ.......................................................................................................... 206
38 -16.600IDP05756 hypothetical protein lmo0814 [Listeria monocytogenes EGD-e] lmo0814 [Listeria monocytogenes EGD-e]  ali follow..  24  2..................................SITNLLNIKYPIIQGAMAQIAKAPLVAAVSNAGGLGII-GGMTADMLREEIQKTKA------------------------LTDKAFGVNLMLMMTNIAELTEVIIEEKVG--------------------------------------------------------------------------------------------------------IVTTGAGTPKTFMPIWKEA--------IVIPVVPSVMIAKRMEKMGADAVIAGTEAGG-----------VGETTTMALLPQIVDAVTIPVIGAGGIADGRGIVAALALGAKGVQIGTRFLATDECPVHPDFKA.......................................................................................................... 206
39 -14.300IDP02111 gene: lldD; L-lactate dehydrogenase [Salmonella typhimurium LT2] STM3694 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15  41...........DLSQVALRQRVLK-NMSDLSLETTLFNE-TLSMPVALAPVGL-GEVQAAAAADAKGIPFTLSTVSVCP-----IEEVAPTIKRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMP-------------------------------TPGARYRDAHSGMSGPNAAMRRYWQAVMHPKWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSIS-------------------------KDLEWIREFWDGPMVIKG-ILDPEDARDAVRFGADGIVVSNHGG-----RQLDGV-LSSARALPAIADAVKG-DIAILADSGIRNGLDVVRMIALGADTVLLGRAYLYALATAGK---------------------------------------AG----------VANLLDLIEKEMKVAMTLTGAKSISEISGD.............................. 373
40 -12.600IDP05519 gene: thiG; thiazole synthase [Clostridium difficile 630] CD1704 [Peptoclostridium difficile 630]  ali follow..  25  139..........................................................................................................................................................................................................................................................................................DLYAGRRLIEANAAAVMP---------APIGSNRGLQMKEMIRIMIDELD---IPIIVDAGIGKPSQAMEAMEMGADAVLVNTAIASAGD................................................................................................................... 218
41 -10.600IDP01917 gene: hisA; 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase [Bacillus anthracis str. `Ames Ancestor`] GBAA1429 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  18  47....................................................................................................................................................................................................................................................LHIVDLDGAVAGESLNLSVIERICKAVRIPVQVGGGIRSLVAVEKLFSVGVDKVILGIGVQTIVFTDISKD-GTLAGPNIEQLELLQKSVAIRLIASGGVASIQDVKKLNDMNIYGVIIGKAL........................................................................................................................ 222
42 -9.940IDP04319 gene: hisA; phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [Yersinia pestis CO92] YPO1544 [Yersinia pestis CO92]  ali follow..  21  28.....................................................................................................................................................................................................................................GNHPLPRLQDYQQQGAQLVDLTGAKDPAARQIPLLRELLAGVDVPVQVGGGIRNEQDVVALLEAGAARVVVGYGLKHVLCTDILSGSNVELYQEVCQRYP-----QVAFQASGGIGCLDDIARLRGSGVQGVIVGRAL........................................................................................................................ 228
43 -9.730IDP01486 gene: ulaD; 3-keto-L-gulonate-6-phosphate decarboxylase VCA0242 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  1............................................................................................................................................................MTKPMIQIALDQTNLTDAVAVASN--------VASYVDVIEVGTILAFAEGMKAVSTLRHNHPNHILVCDMKTTDGGAILSRMAFEAGADWITV-SAAAHIATIAACKKVADELNGEIQIEIYGNWTMQDAKAWVDLGITQAIYHRS-------RDAELAGIGWTTDDLDKMRQLSALGIELSITGGIV-PEDIYLFEGIKTKTFIAGRALAGAEG................................................................................................................... 199
44 -9.730IDP00985 gene: hisA; 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase STM2076 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  24  29......................................................................................................................................................................................................................................NDPLPRLQDYAAQGAGLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGVGLKHVLCTDILAGSNVSLYEEV-----CARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRAL........................................................................................................................ 228
45 -9.510IDP05512 gene: thiE1; thiamine-phosphate pyrophosphorylase [Clostridium difficile 630] CD1601 [Peptoclostridium difficile 630]  ali follow..  21  69...........................................................................................................................................................................................................................................GVKFIINDRVDIALICDADGVHVGQSDIVREVRKLIGNNKILGVSARTLEEAICAKNDGADYL----GVGSIFTTSTKLDAKSASFETVKEIKEKVD---MPFVLIGGI-NLDNIDKLKCLESDGYAIISAILKAED................................................................................................................... 198

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 3 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.