current user: public

If you have questions about the server, please let us know.

Query: gi|30260208|ref|NP_842585.1| deoxynucleoside kinase family protein (BA_0014) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTRWSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKGLFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINNFNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVKLast
1 -92.100IDP05086 deoxynucleoside kinase family protein [Bacillus anthracis str. Ames] BA_0014 [Bacillus anthracis str. Ames]  ali follow..  100  1MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTRWSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKGLFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINNFNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK 222
2 -25.600IDP92081 thymidylate kinase, putative [Toxoplasma gondii ME49] TGME49_106970 [Toxoplasma gondii ME49]  ali follow..  13  1...MAAFTPKRGCLVVFEGIDRSGKSTQARLAYERLAAELIRFPDRTTPILDRFLANASWSSQLTHLLFAANRWERILRALGEGRTVLVDRYSFSGIAYTVGAAPSVAETEATRLRREAEASGDVEKERGLLAPDAVFFLDVAPQETQKRGGYGDEVYEK---LATQERVYQVYRQFDNLPYWRRIAASSLS------IEELHEKLFEQLKSVIEATQ.... 251
3 -25.000IDP90678 gene: tdk; thymidylate kinase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0766c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  18  2.............YVVFEGIDCVGKSTQISLLKEIYKDAIFTLEPGGTELGKHLRETHPINKRAELLLFLADRAQHFEEILKTNQNKL----IISDRSFISGMAYAKDF--------NDLLFALNSFALENFFPQKIIFLKGDANLIQERLSQKELDSIEKRGIEYFLSVQDKLEKVLHFLKEVEILTLDAKE--------SKEKLHQQIKEFLQ....... 192
4 -22.200IDP90611 gene: tmk; thymidylate kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC2016 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  2..........NAKFIVIEGLEGAGKSTAIQVVVETLQITRTREPGGTRALVKEEHPGEELQDITELLLVYAARVQLVENVLARGEWVVGDRHDMSSQAY-------QGGGRQIAPSTMQSLKQTALGDF---KPDLTLYLDIDPKLGLERARGRGELDREKMDISFFERARERYLELANSDDS--VVMIDAAQ----SIEQVTADIRRALQDWLSQVNRV.. 212
5 -16.200IDP01471 phosphoribulokinase VC2613 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  1.......MSAKHPIIAVTGSSGAGTTTTSEAFRKMFNMMSIKPAWVE---GDSFHRQGRHISYFGPQANDFPTLEEFFRQYGKVGTGQVRRYLHTF-QMPGTFTPWQSLPENSDVLFYEGLHGGVVDGDVNVAQDFLIGMVPIVNLYVRDTRDRGHSREAVM--DSIVRSMDDYLKFITPQFSRTHINFQ................................ 206
6 -16.100IDP02096 gene: prk; phosphoribulokinase 1 [Yersinia pestis CO92] YPO0178 [Yersinia pestis CO92]  ali follow..  15  1.......MSTKHPVIAVTGSSGAGTTTTSLAFRKIFQQLDIRAAQIE---GDSFHRQGRHISYFGPEANDFGQLEQSVAEYSKHGTGRSRKYLHTY-QIPGTFTPWEPLPEPTDVLFYEGLHGGVVTEHHDVAKDLLVGVVPIVNLWIQKLVRRGHSREAVM--DSVVRSMDDYINYITPQFSRTHINFQ................................ 206
7 -16.000IDP02159 gene: aroK; shikimate kinase [Coxiella burnetii RSA 493] CBU_1892 [Coxiella burnetii RSA 493]  ali follow..  17  1.......MKKNLTNIYLIGLMGAGKTSVGSQLAKLTKRILYIEKRTGADIAWIFEMEGEAGFRRREREMIEALCKLDNIILATGGGVVLDEK----------------------------------NRQQISETGVVIYLTASIDTQLKRIGQKGEMRRPLFINNSKEKLQQLNEIRKPLYQAMADLVYPTDD---LNPRQLATQILVDIKQTYSDL..... 179
8 -15.900IDP01891 gene: prkB; putative phosphoribulokinase [Salmonella typhimurium LT2] STM3464 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15  1.......MSAKHPVIAVTGSSGAGTTTTSLAFRKIFAQLNLHAAEVE---GDSFHRAGRHISYFGPEANDFSLLEHTFIEYGQTGKGQSRKYLHTY-QVPGTFTPWQPLPEPTDVLFYEGLHGGVVTPQHDVARDLLVGVVPIVNLLIRDTSERGHSREAVM--DSVVRSMDDYINYITPQFSRTHINFQ................................ 206
9 -15.900IDP04090 gene: aroK; shikimate kinase [Clostridium perfringens ATCC 13124] CPF_0694 [Clostridium perfringens ATCC 13124]  ali follow..  13  2..........KKRGVLLIGMPGAGKTTIGRDLSTVLKMNFL--ERSTGKEIKELFAQGEEVFRDLESKSCELLSTLKNVVISSGGGIVTRE-----------------------------------ENMGNFKEFITVFINRPLDLIMEDIDTEGRP----LLWDGKERLTNLYRDRIDLYKKHSDIEIINDG--------TTKEAIREIVKAISELSY... 167
10 -15.600IDP04177 shikimate kinase [Vibrio cholerae O1 biovar El Tor str. N16961] VC2629 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  1........MAEKRNIFLVGPMGAGKSTIGRHLAQQLHMEFIIEERTGADIAWVFDVEGEEGFRKREEAVINDLTEQQGIVLATGGGSVISKE----------------------------------NRNRLSARGIVVYLETTIEKQLART-NRDKKRPLLQTDCPREVLEQLAEDRNPLYEEIADITVRTDD---QSAKVVANQIVKMLEEHI........ 173
11 -15.600IDP01198 Cytidylate kinase (CK) (Cytidine monophosphate kinase) (CMP kinase) BA_1518 [Bacillus anthracis str. Ames]  ali follow..  13  1........MDKRISIAIDGPAAAGKSTVAKVVAKKLSYVYIDTGAMYRTITYAALEQKVDIENEEQLMEVVKNVKIEFQQGENTQLVFLNGQDVSEVI-RVSIVAKHRLVREEMVRRQQELAEK-IGTHVLPDAEVKIFMLASVEERAERRHLENMNKGFDSNLEQLKEEIAQRDKLDSEREVSPLLELDTTSLSI---EEVVQKIMGIVLGVFAK...... 225
12 -15.300IDP90167 Shikimate kinase CD1838 [Peptoclostridium difficile 630]  ali follow..  14  1......MINKTKEKLILIGMPGSGKTTIGKLLAKEYNCSFC--IQISQKSIAELFSEGEDIFRNYETQACRELSISDKTVISTGGGVI---------------------KKDVNMEILKE--------------GIIIFIDRPIQKILEDININSRP----LLKNGKDRLYNLYNERINLYKKFSDIEILNDK----SLNNAVYNITNAVSENFK....... 171
13 -15.200IDP02572 gene: cmk; hypothetical protein lmo1939 [Listeria monocytogenes EGD-e] lmo1939 [Listeria monocytogenes EGD-e]  ali follow..  12  1........MTKKICIAIDGPAAAGKSTVAKIVAKKLRFVYIDTGAMYRAVTYIALKNNIAYEDEKAIAALLQKTVIRFEPGEVQQVFVGSENVTEEVTNHVSIVAAHPSIREALQERQQVFATE-IGTAVLPNAELKIFLLASVEERAERRYKENMAKGFTGDLDQLKKEIEERDHLDYTRTHSPLIEVDTTSMSI---DQVANKILSLAELKINN...... 224
14 -15.200IDP00856 gene: aroL; shikimate kinase II STM0388 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  16  5..............LYLVGPRGCGKTTIGMALAQATGFRFA--QSHVQMSVADIVEKEGWGGFRARETAALEAVSAPSTVVATGGGII---------------------LTEYNRRYMHR--------------GVVIYLCAPVSTLVNRLEAEPEADLRPTGKPLSEEVREVLEQRDALYRETAHYIIDATK--------APAQVVSEIIAALPPSTQRLQ 176
15 -15.100IDP02625 gene: aroK; shikimate kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA4457 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  16  2............KSIYITGYMGAGKTTIGKALSKELHMDVV--EEKQGKVIRDIFAEEGEMAFREYESEMLCSLPVDNVIITTGGGIVEREE----------------------------------NRKWMKENGTVVYLYCDPHVIAERLRETTRPLFQKKDIDAFVTKFESRRAYYEEAH----IHIDTTNKS-------VKQIMNELKEKINE...... 165
16 -14.900IDP90888 RecName: Full=Cytidylate kinase; Short=CK; AltName: Full=Cytidine monophosphate kinase; Short=CMP kinase Q9KQT2 [Vibrio cholerae]  ali follow..  14  1.......MSSHTPVVTVDGPSGAGKGTLCMLLAKKLGFQLLDSGAIYRVLALAALHHGVDLESEDALVPLATHLDVQFIAEGDLVKVILEGEDVSREL-AASKVAALPRVREALLRRQRAFASG-MGTVVFPAAEAKIFLDASAEERARRRFKQLQLKGLDVKFDALLSEIQERDDRDRNRAVAPLLVLDSTTLTI---DEVVEQALQYIESKL........ 224
17 -14.800IDP90561 gene: cmk; cytidylate kinase [Yersinia pestis CO92] YPO1391 [Yersinia pestis CO92]  ali follow..  17  1.......MTAIAPVITVDGPSGAGKGTLCKALAESLNWRLLDSGAIYRVLALAALHHQVDISTEEALVPLAAHLDVRFVSQNGQLQVILEGEDVSNEI-TASQAAAFPRVREALLRRQRAFREA-MGTIVFPDAPVKIFLDASSQERAHRRMLQLQERGFNVNFERLLAEIQERDNRDRNRSVAPLLVLDSTSMSI---EQVIEQALAYAQRILA....... 225
18 -14.800IDP04640 gene: cmk; cytidylate kinase [Francisella tularensis subsp. tularensis SCHU S4] FTT0559c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  15  1........MNNSKIITIDGPSGVGKGTLAKALAKYYDFKLLDSGAIYRLAALHCFKNNASLENEDDVCKTLRNLDISFKIEDDLVKAFLSNQDVTKDI-LASKVAAYPTVRAILLNKQREFATE-MGTVVFPQAQYKFFLDASTEITAKRRYDELKTKGQKPNFEKILADIKQRDFQDRNRKVAPLIIVDTSQLFI---KEVFDSVIKKIT........... 220
19 -14.700IDP91206 shikimate kinase [Bacteroides thetaiotaomicron VPI-5482] BT_3393 [Bacteroides thetaiotaomicron VPI-5482]  ali follow..  16  4..............IFLTGYMGAGKTTLGKAFARKLNVPFIIEERFHKTVGELFTERGEAGFRELERNMLHEVAEFENVVISTGGGAPCFYDNME-----------------------------------MNRTGKTVFLNVHPDVLFRRLRIAKQQLQGKEDDELMDFIIQALEKRAPFYTQAQYIF----NADELEDRWQIESSVQRLQELLE....... 174
20 -14.500IDP90625 gene: coaA; pantothenate kinase [Yersinia pestis CO92] YPO3758 [Yersinia pestis CO92]  ali follow..  17  86.........RIPYVIGIAGSVAVGKSTTARLLQALLSRWPEHRSVE----TDGFLHPNKVLN-SYDMHNLVKFVSEVKSGADYVTAPVYSHLIYDDILILEGLNVLQSGMDYPHDPHHVFVSDFV---------DFSIYVDAPEDLLQSWYINRRQGAFSNPDSYFHNYAKLPETEAIKIATQLWNEINGLNLKQNILPTRERASLI............... 300
21 -14.200IDP02084 gene: adk; adenylate kinase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0639c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  3............ELFLIIGAPGSGKTTDASLIAQADATNITHYSTGD---------------------LLRAEVASGSELGKTIDSFISKGNLVPLDVVINTIVYALKAAPTKTIII-MMEFDKVLSEQNEICLKGVIEVRVSEEVAKERVLGRNRGAD-----DNEEVFYNRMKVYTEPLNEILDFYQKKKLHFIIDGERTIEPIVADMKELIKKIQSI.. 192
22 -14.100IDP02271 gene: aroK; shikimate kinase I [Francisella tularensis subsp. tularensis SCHU S4] FTT1155c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  18  1........MIRTKNIFLIGPVGAGKSTIGKQLAKQLKLEFIIEKKCGVDINWIFDLEGEEGFRKREREVIAEILAEKQNIVLATGGGAI--------------------LDPETRSLLSS--------------GKVVYLEATIEQQLERT-SKDTKRPLLRVDDKRPVLEQLMAEREPLYRSIADVVVETNGAT-------VKNIVNKISTFLVEETIL.. 176
23 -13.600IDP05295 gene: cmk; cytidylate kinase [Clostridium difficile 630] CD1816 [Peptoclostridium difficile 630]  ali follow..  15  2..........GNLVIAVDGPAGAGKSTIAKIVAKKLNINYIDT--------GAMYRAVTYKCLKSGIDVVIQIAENSDIDFKDNNIYLDKEVINEEVSNNVSNVAKIKEVRQLMVEVQRKIGMK-IGSYVFPDADYKFFLVATPEERGNRRYKELCNKGYNTTLEEVIEDIIRRDEIDSNREFAPLVKAN-DALEIDTTGKTIEEVVEEVVSKIN....... 215
24 -13.500IDP02287 gene: adk; adenylate kinase [Francisella tularensis subsp. tularensis SCHU S4] FTT1161 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  3..............IILLGAPGAGKGTQAKIIEQKYNIDMIRETIKSGSALGQELKKVLDAGELVSDEFIIKIVKDRISKNDCNNGFLLD---------VPRTIPQAQELDKLGVNI-----------------DYIVEVDVADNLLIERITGRRTDDNEDTVKQRLSVYHAQTAKLIDFYRNFSSTNTKIPKYIKINGDQAVEKVSQDIFDQLNKR..... 218
25 -13.200IDP00333 gene: coaE; Dephospho-CoA kinase FTT1487 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  14  1......MNFINTYPIGITGGIASGKSTATRILKEKLNLNVVCADTISREITKK---------------------SVIKKIAEKFGDEIVMNKQINRAMLRAIITESKEAKKWLEDYLHPVINKEIKKQVKESDTKKVIVIKADLETRIRRLMERDGKNRQQAVAFINLQISDKEREKIADF------VIDNTELTNQELESKLITTINEITNLTN....... 204
26 -13.100IDP02139 gene: gmk; guanylate kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA4009 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  15  1......MRSRRGLLIVLSGPSGVGKGTVRKELFSHEDTRFQYSISVTTRKPREGEVDGVDYFFKEREEF---------EEMIRNEKLLEWAEFVGNYYGTPIDYVEKTLQEGKDVFLEIEVQGAIQVKKAFPEGVFIFLAPPSLSELKNRIVGRGTETEDVIE----NRLTVAKEE-----------IDMMDAYDYVVENDQVELACERIKAIVVGEH.... 188
27 -13.000IDP06283 gene: gmk; guanylate kinase [Streptococcus pneumoniae TIGR4] NP_346174 [Streptococcus pneumoniae TIGR4]  ali follow..  12  1.......MADRGLLIVFSGPSGVGKGTVRREIFESSENQFQYSVSMTTRAQRPGEVDGVDYFFRTREEF---------EELIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDAVFIFLTPPDLDELQDRLVGRGTDSAEVIA----QRIEKAKEE-----------IALMREYDYAIVNDQVPLAAERVKCVIEAEH.... 187
28 -13.000IDP01611 gene: gmk; hypothetical protein lmo1827 [Listeria monocytogenes EGD-e] lmo1827 [Listeria monocytogenes EGD-e]  ali follow..  14  1.......MTERGLLIVLSGPSGVGKGTVREAVFKDPETSFDYSISMTTRLPREGEQDGVDYYFRSREVF---------EQAIKDGKMLEYAEYVGNYYGTPLEYVEEKLAAGVDIFLEIEVQGAMQVRKAMPEGIFIFLTPPDLSELKNRIIGRGTESMEVVE----ERMETAKKE-----------IEMMASYDYAVVNDVVANAVQKIKGIVETEH.... 187
29 -12.700IDP90623 gene: gmk; guanylate kinase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1177c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  1.......MKLQGFVLLISGPSGAGKSTLLKKLFDEFEDELYFSISSTTRKPREGEKNGIHYHFISHEEF---------QKGIDSDHFLEWARVHENFYGTSLKHTQNALDNGKIVVFDIDVQGFKIARKKMADKIVSVFI--NKDELKKRLIKRNTDTIIQLE----KRLQNASDE-----------MKELSEYDYLIINDELKQSYEALRAILIAHK.... 188
30 -12.700IDP90539 gene: gmk; guanylate kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC2708 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  16.NLSGTESMGKGTLYIVSAPSGAGKSSLIAALLEQNPTYAMKVSVSHTTRGMR--QDGVHYHFVEKEHF---------IELIGKGEFLEYAEVFGNYYGTSRVWIENTLNKGIDVFLDIDWQGARQIRSQMPEAKSIFILPPSKEELERRLNTRGQDSDAVIA----KRMGEAKSE-----------ISHYSEYDYVIINDDFDVALMDFKAIIRAER.... 209
31 -12.300IDP92045 guanylate kinase, putative [Toxoplasma gondii ME49] TGME49_042730 [Toxoplasma gondii ME49]  ali follow..  10  97...KRILRDTAPRILVVAGPSGVGKGTLVKRIFAKCSREEFEKLKKEGHFVENCYGTSF---------------AAVDNVRRGERICLLEIDMAGVLQIQSTPLAQEA---------------------------NFVFI--SIEELKARLRGRRTENEEHIA----KRLAAAQRE---------LALAKETHFDFYLTNDNLEDAWQKLEAQLVQWY.... 291
32 -11.900IDP92034 adenylate kinase, putative [Toxoplasma gondii ME49] TGME49_024900 [Toxoplasma gondii ME49]  ali follow..  12  25LKRRYACLAKPEGRYIFIGAPGSGKGTQSVKLKKSHCLDMLRHAVATGTEYGKQAKAKLDAGELVSDEIVLGLIDEKLKTPECRRGFILD---------FPRNEAQAAGLDN-------------LLKQKNQKLDGVLYFDVPDNILVERVSGRRKDDNEATLKKRLDVFHKETVPVIEHYAKMGLLYMDAAK--------DSTAVTKEMYDFVGKHHK... 253
33 -11.800IDP04500 gene: adk; adenylate kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC0986 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  3..............IILLGAPGAGKGTQAQFIMEKFGIDMLRAAIKAGTELGKQAKAVIDAGQLVSDDIILGLIKERIAQADCEKGFLLD---------FPRTIPQADGLKEMGINV-----------------DYVIEFDVADDVIVERMAGR-----------AHLPSGRTYHVVYNPPKVEGKDDVTGEDL-VIREDDKEETVRARLNVYHTQTAPLIE 180
34 -11.800IDP05129 gene: adk; adenylate kinase [Clostridium difficile 630] CD0091 [Peptoclostridium difficile 630]  ali follow..  10  1.......MEMDNMRIILLGPPGAGKGTQAVGIVEKYNIDIFRKNIKEGTELGKKAKEYMDQGLLVPDELTVGLVTDRISQEDCKNGFMLD---------FPRNVAQGEHLDI-------------FLKNAGISLDKVVNIEVDKSILVSRAVGRRADDNEETVSKRIQVYLDETKPLVDYYSKQGIIA--------IKGDQAIDKVFEDIVAALGSGK.... 221
35 -11.700IDP00480 gene: adk; adenylate kinase YPO3118 [Yersinia pestis CO92]  ali follow..  17  3..............IILLGAPGAGKGTQAQFIMEKYGIDMLRAAVKAGSELGLKAKEIMDAGKLVTDELVIALVKERITQEDCRDGFLLD---------FPRTIPQADAMKEAGIKV-----------------DYVLEFDVPDELIVERIVGR-------------AASGRVYHVKFNPPKVEDKDDVTGEEL-TIRKDDQEATVRKRLIEYHQQTAPLVS 180
36 -11.700IDP91820 gene: adk; adenylate kinase [Escherichia coli str. K-12 substr. MG1655] b0474 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  19  3..............IILLGAPGAGKGTQAQFIMEKYGIDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLD---------FPRTIPQADAMKEAGINV-----------------DYVLEFDVPDELIVDRIVGR-----------VHAPSGRVYHVKFNPPKVEGKDDVTGEEL-TTRKDDQEETVRKRLVEYHQMTAPLIG 180
37 -11.600IDP06121 gene: gmk; guanylate kinase [Helicobacter pylori J99] NP_223024 [Helicobacter pylori J99]  ali follow..  14  1.......MNNDFNLLILSGPSGAGKSTLTKYLQEKIPKTHFSLSTTTRK------VDGLHYNFVSEEEF---------KQGIEKGQFLEWAIVHNHYYGTSKIPVEKALKEGKIVIFDIDVQGHEILKKHYPNACSVFISTKNQEILKERLLLRGTDSKETIE----KRLINAYKE-----------MQCLESFDYLIINEDLEKSKEIILSIAKTLV.... 186
38 -11.400IDP04119 adenylate kinase [Bacillus anthracis str. Sterne] BAS0131 [Bacillus anthracis str. Sterne]  ali follow..  3..............LILMGLPGAGKGTQAEQIVAKYNIDMFRAAMKAETEMGLQAKSFIDKGALVPDEVTIGIVRERLSQEDCVRGFLLD---------FPRTVAQASALEE-------------IMKDLGKKIDYVLNINVDSGLLLKRLTGRRSDDNEETVANRLDVNIKQTKPLLDFYEELGYLQ--------INGEQDINKVFADIDVLIGGL..... 215
39 -11.300IDP90876 pantothenate kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC0320 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  23  141....GNTESAPPFVIGIAGSVAVGKSTTARLLKALLSRWENHPKVE----TDGFLYPNKVLT-SYDIRRLVEFVSEVKAGQPNVTAPVYSHLTY-------DITDEMKVVDRPDVLIIEGLNVLQSGMDYPHDPDFSIYVDADSQLIEKWYIER.................................................................... 302
40 -10.900IDP02377 gene: cysC; adenylylsulfate kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA1442 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  18  15.DERRVKNGHHSFVIWFTGLSASGKSTVANAVARKL--------FEKNIGNYVLDGDNIRHGLNKDLGF-SDRMENIRRIGE-----------------VAKLFVDQGAVVLTAFISPFRVDRKQVRDLLAVDEFIEVFVKCPIEECEKRDPKGLYKKARKGDIKEFTGIDSPYEE-----PEKAELIVETHKYSI-------EECAEQIVKYLQERSLI.. 197
41 -10.900IDP06058 gene: coaE; dephospho-CoA kinase [Helicobacter pylori J99] NP_223488 [Helicobacter pylori J99]  ali follow..  11  1........MILKNAIALTGGIGTGKSTTLKILESQGYKILDADKIAHQLLQEHRLEIAQRFGSDILEKDILNRKKLGAIVFQNANELKWLEDFLHPLIRECMLKKACELEKNHQAYFLDIPLFFEVGGKKRYPVSRVVLIYAPRALQIERLLERDKLKEAEILQRLACQMDIEQKRAMSDY------IID-NSSSLKDLNKQVERFLKTL............ 195
42 -10.700IDP06247 gene: adk; adenylate kinase [Streptococcus pneumoniae TIGR4] NP_344771 [Streptococcus pneumoniae TIGR4]  ali follow..  10  3..............LLIMGLPGAGKGTQAAKIVEQFHV----AHISTGDMFRAAMANQTEMGVLAKSYIDKGELVPDEVTNGIVKERLSQDDIKETGFLYPRTIEQAHALDK-------------TLAELGIELEGVINIEVNPDSLLERLSGRREDDKPETVKRRLDVNIAQGEPIIAHYRAKGLVH--------IEGNQDINDVFSDIEKVLTNLK.... 212
43 -10.400IDP06310 gene: coaE; dephospho-CoA kinase [Streptococcus pneumoniae TIGR4] NP_345452 [Streptococcus pneumoniae TIGR4]  ali follow..  11  3............KIIGITGGIASGKSTVTNFLRQ-QGFQVVDADAVVHQLQKPGGRLFEALVQHFGQEIILNRPLLASLIFSNPDEREWSKQIQGEIIREELATLREQLAQTEEIFFMD--IPLLFEQDYSDWFAETWLVYVDRDAQVERLMKRDQLSKDEAESRLAAQWPLEKKKDLASQ------VLD-NNGNQNQLLNQVHILLEGGRQDDRD...... 201
44 -10.200IDP00325 gene: coaE; dephospho-CoA kinase Cj1530 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  11  3............NAFFVTASIACGKSTFIEIANS-LGFKSISADKIAHKILDENALELEKIFSPFSLKNLLKK-KILGEIVFNNKEAKKILENFTHPKIRAKILEQMQILDKENKAFFVEI-PLFFESGAYENLGKVIVIYTPKELSLKRIMQRDKLSLEAAKARLDSQIDIEEKLKKADF------IIK-NTNSYADFRQECVKVIQEISK.......... 198
45 -10.200IDP06104 hypothetical protein jhp0654 [Helicobacter pylori J99] NP_223372 [Helicobacter pylori J99]  ali follow..  26  20..........FKGVVLLKGVVGSGKTTLVQACLKHLGLDSLMHAYSESVFHYDFYM...................................................................................................................................................................... 73
46 -10.000IDP02800 gene: coaE; dephospho-CoA kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA4828 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  11  3............VVIGLTGGIASGKSTVSQMFRE-LSIPVIDADIIAREVVEKGKPAYNKIVEVFGTEVLQE--PKLGSVVFYNEEKRLQLNKIVHPAVREEMNRQKEMYIKEGMQAVVLDIPLLFESKLTSLVDRVLVVAVKPHTQLERLMKRNNFSEEEATARIQSQMPLEEKVKNADE--------------VINNDGTIMGTKTQLQAILKKWNII.. 199
47 -9.710IDP04485 conserved hypothetical protein [Yersinia pestis CO92] YPO3430 [Yersinia pestis CO92]  ali follow..  11  4.............IVALTGGIGSGKSTVANAFAN-LGVPLVDADIIARQVVEPGTSALAAIASRYGENILQQDGSLNRAALRQ------EKAWLNSLLHPLIQQETQRQLAGIDQPYALWVVPLLVENGLHHRADRVLVVDVTPDIQLARTMARDGITRQQAENILASQVSRQQRLACADD------IID-NSGDPLMIAQHVASLHHRYLKLATAAQQDLH 205
48 -9.700IDP00907 gene: coaE; dephospho-CoA kinase STM0140 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  10  4.............TVALTGGIGSGKSTVADAFAD-LGITVIDADIIARQMVEPGQPALNAIAEHFGSELIAADGTLRRRALRE------EKAWLNALLHPLIQQETQRQFQQATSPYVLWVVPLLVENRLYQKANRVLVVDVTPETQLIRTMQRDDVTREHVEHILAAQATREARLAVAD--------------DVIDNNGAPDAIASDVARLHASYLKLAS 198
49 -9.550IDP01835 gene: coaE; dephospho-CoA kinase [Coxiella burnetii RSA 493] CBU_0152 [Coxiella burnetii RSA 493]  ali follow..  10  3.............RIGLTGGIGSGKSTVANYFAEHFGNAVLTKGLNRTKLRELIFENPDDRQWLENLLHPLIIAKMKTQLKKIKAPYCI---------LAIPLLAEASQSVD----------------------DRILVVDAPETLQIQRTKSRDQLSDQQIQLILQSQSPREKRLAIAD--------------DVIVNDQTIPILRKAVFQLHCKYLQIAQ 198
50 -9.420IDP02513 hypothetical protein GBAA0258 [Bacillus anthracis str. `Ames Ancestor`] GBAA0258 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  25  17LSEKLGELVRAQDVIILEGDLGAGKTTFTKGLAKGLGVK---RVVNSPTFNIIKEYKGRLPLYHMDVYRLAESEEDLDEYFYGEGITVVE.................................................................................................................................... 105
51 -9.270IDP00939 gene: glnQ; glutamine ABC transporter ATP-binding protein STM0828 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  21.....DLNIRQGEVVVIIGPSGSGKSTLLRCINEITSGDLIVDGLKVNDPKVDERLIRQEAGMVFQQFYLFPHLTALENVM---GPLRVRGVKKEEAEKQAKALLAKVGLAERAHHYPSELQRVAIARALAVKPKMML-FDEPTSALDPELRHEVLKVMQDLAEEGMTMVIVTHEIGFAEKVASRLIFIDKGRIAEDGSPQAL................... 223
52 -9.250IDP01414 amino acid ABC transporter, ATP-binding protein VC1359 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  30.....NLNVKKGERIVICGPSGSGKSTMIRCINEHQKGQIIVAGNELTEDLKNIELVRREVGMCFQHFNLFPHLTVLENCT---APIWVKKMPKDKAEEIAMKYLTRVRIPEQADKYPGQLQRVAIARSLCMNPQIML-FDEPTSALDPEMVREVLDVMVELAEEGMTMLCVTHEMGFAKEVADRVIFMDAGEIIEENNPKEF................... 232
53 -9.190IDP01669 ABC transporter ATP-binding protein [Yersinia pestis CO92] YPO3048 [Yersinia pestis CO92]  ali follow..  11  23.....SMELKRGEVVSLLGPSGSGKTTLLRAVASQGHIIIGEKTVYDGSSHSEIPAEERNLGLVFQSYALWPHKTVSENVAYPLKLRKISTSEISQRVQAVLEQLGLGALGNRHPHQLSQQQRVAIGRALVYNPPVIL-LDEPLSNLDAKLREEARVFLRELIMNLLSALMVTHDQNEAMAISDRILLLNNGKIEQQGTPQEM................... 227
54 -9.170IDP01505 amino acid ABC transporter, ATP-binding protein VCA1037 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  11  23.....SLTVNKGEIVVICGPSGSGKSTLIRTVN--------LESIDSGEILDERTRRSGKIGMVFQHFNLFPHLTVLENLT---APIRTLKLSAQEAKERAYHFLQRVKITDQTHKYPIQLQRVAIARSLCMQPEILL-FDEPTSALDPETINEVLEVMVDLAQDGITMMCVTHEMGFARKVAHRVMFMDEGEILEVGSPEQL................... 220
55 -9.130IDP00933 gene: gltL; glutamate/aspartate transporter STM0662 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  21.....STEVKKGEVVVVCGPSGSGKSTLIKTVNPVQKGEITVNGIIVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLT---AQVKVLKRDKAAARDKGLKLLERVGLSAHANKFPAQLQRVAIARALCMDPIAML-FDEPTSALDPEMINEVLDVMVELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKEEF................... 223
56 -9.090IDP01147 amino acid ABC transporter, ATP-binding protein BA_0639 [Bacillus anthracis str. Ames]  ali follow..  10  22.....NVQVKKGEVVVVVGPSGSGKSTLLRCINSITDGELIVQNTEVHNAKTDMNELRRNIGMVFQHFYLYPHKTVLQNIT---APIKVNKISKEEAEKTAMFYLEKVGIPEKANVYPHQLQRVAIARGLAMQPEIML-FDEPTSALDPEMIGEVLDVMKTLAKEGMTMVVVTHEMGFAREVADRILFMDDGKIIEDTTPAQF................... 224
57 -9.040IDP01641 gene: artP; amino acid ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0481 [Coxiella burnetii RSA 493]  ali follow..  11  23.....SFAAKAGEVVTLLGDSGAGKSTLLRCLN---DLEFHFSLTAKKPTRQSLIALRSKVGMVFQQFHLWAHRTILQNLIEAP--CQVLKISKAEAVKKAECLLDQVGILAKKDDYPARLQRAAIARALMMEPEVML-FDEPTSALDPKMITAMRDLIHELAQKGMTIVIATHEMKFAREVAHKTVFLHEGRIVEEGQPEVM................... 232
58 -9.020IDP00731 ABC transporter, ATP-binding protein SACOL2462 [Staphylococcus aureus subsp. aureus COL]  ali follow..  13  22.....SLKVDKGESIAIIGPSGSGKSTFQKQICN------LFSPTSGELYFK--YNDYDPEELRQRISYLMQQSDLFGETIEDNMIFPSLARNDKFDRKRAKQLIKDVGLGHYQLSSE-ERQRIAIARQLMYTPDILL-LDESTSALDVNNKEKIENIIFKLADQGVAIMWITHSDDQSMRHFQKRITIVDGQISNTEELNQHE.................. 220

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.