current user: public

If you have questions about the server, please let us know.

Query: gi|30260212|ref|NP_842589.1| cytidine/deoxycytidylate deaminase zinc-binding domain-containing protein (BA_0018) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst MERDQDIYFMQLAIEEAKKAEAIQEVPIGAVIVLNGEVISAAHNLRETEQRSIAHAELLAIDEACKKLGTWRLEDATLYVTLEPCPMCAGGIVLSRVKRVVYGAGDPKGGCAGTLMNLLTDERFNHQCEVVAGVLEEECGTLLTNFFRELRKKRKAIKKLEKSNENLast
1 -93.600IDP05096 putative cytosine/adenosine deaminase [Clostridium difficile 630] CD0015 [Peptoclostridium difficile 630]  ali follow..  43  3.GIMESSFYMKEALKEAYKAYNKKETPIGAIIVKDNQIIARAHNLTETLKDSTAHAEILAIKQASEKLGGWRLTDCDLYVTMEPCIMCSGAIVNSRIKKLIIGTRHVKNSYIEKQHEFKLDYFNNNNVKVAFDVLQEECSIILQEFFKALRKRD............ 155
2 -87.600IDP92055 tRNA-specific adenosine deaminase, putative [Toxoplasma gondii ME49] TGME49_059570 [Toxoplasma gondii ME49]  ali follow..  30  4YTEADKRLFMSAALEEARLALKEGEVPVGCVLVKTRQVVSRGRNATNRTKNATRHCELEALDAYMALLPPPNISSIDLFVTCEPCVMCAVALQCSGVKRVFYGCGNDRFGGCGSVLSFHKRLSEQWKLECYSGIFREEAIDLLRSFYSRGNPNAPEEKRHRK.... 177
3 -42.300IDP04299 deoxycytidylate deaminase, putative [Vibrio cholerae O1 biovar eltor str. N16961] VCA0840 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  20  1MISKWAQRFFQMAELVGSWSKDP-STQVGAVITKQNRIVSVGFNDRDMKYLKTLHAEENAILFAKR-----DLDGCEIYVTHFPCPNCAAKIIQTGISAVHCPEQSEDFLSRWGDKIKVSQDMFLQAGVKVHWLPLVELKHINTIELPSESSN............. 160
4 -35.500IDP01692 gene: ribD; riboflavin biosynthesis protein ribD [Francisella tularensis subsp. tularensis SCHU S4] FTT1671 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  29  2..KNIDKYYMQQALTLANRGRLTVS-PVGCIIVKNGAIISEGWHET-----GEAHAEVHALTKAVD-----KAKGATAYVTLEPCPPCTDTIIKAGIKKVIIATLDPNPKVAGKGVERLKNAGI----TVEVGLLEKQAQELNKIFFHYQTTKKPFVYAKWAMSLD 160
5 -35.000IDP00091 gene: ribD; bifunctional pyrimidine deaminase/reductase NTL01SF0342 [Shigella flexneri 2a str. 2457T]  ali follow..  29  2....QDEYYMARALKLAQRGRFTTH-PVGCVIVKDGEIVGEGYHQR-----GEPHAEVHALRMAGE-----KAKGATAYVTLEPCPPCCDALIAAGVARVVAAMQDPNPQVAGRGLYRLQQAGI----DVSHGLMMSEAEQLNKGFLKRMRTGFPYIQLKLGASLD 158
6 -34.900IDP90906 gene: ribD; bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase [Yersinia pestis CO92] YPO3183 [Yersinia pestis CO92]  ali follow..  28  2...QPDEFYMARAFELARLGRFTTS-PVGCVLVRDGEIVGEGYHLR-----GEPHAEVHALRMAGE-----KARGATAYVTLEPCPPCADALVAAGVIRVVAAMQDPNPEVAGRGLYKLKQAGI----AVDHGLMLAEAEAVNLGFLKRMRTGFPYVQLKMAASLD 159
7 -34.900IDP90898 gene: ribD; bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase [Salmonella typhimurium LT2] STM0416 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  27  2....QDEFYMARALKLAQRGRFTTH-PVGCVIVNNGDIVGEGYHH----RAGEPHAEVHALRMAGA-----KAKGATAYVTLEPCPPCCDALIAAGVARVVAAMQDPNPQVAGRGLYRLQQAGI----AVSHGLMMSEAEALNKGFLKRMRTGFPYLQLKLGASVD 158
8 -34.800IDP05202 gene: ribD; riboflavin biosynthesis protein [Clostridium difficile 630] CD1700 [Peptoclostridium difficile 630]  ali follow..  33  3.QKEKDIYYMKKAIELAKNGEGFVN-PVGCVIVKDSNIIGKGYHEK-----GSNHAEVNAINSAKQ-----SLKDSTLYVNLEPCPPCVDKIIQNKIKRVVISTLDPNPLVCGNGVKKLKDNNI----DVTVGILEDEARDLNEAFFYHIKNKRPLCIVKSAVSLD 162
9 -34.800IDP90745 gene: ribD; putative riboflavin-specific deaminase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1622 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  29  8.GRQMKEFYMNLALNEAWKYQFLTY-PVGCVILKNEKILAIKAHEK-----GLAHAELNAIAHAFKSLHQGVFKDSIAFVTLEPCPPCAKLFSELGFKKIFISVKDENKIASGGAEFLKKQG-----IEVEFDILKEEGKKLLKPFLKWQKG.............. 178
10 -32.500IDP01615 gene: ribD; riboflavin biosynthesis protein RibD [Coxiella burnetii RSA 493] CBU_0643 [Coxiella burnetii RSA 493]  ali follow..  25  2..NDSSLDYLKKALSLAEIRRGFCA-PVGAVVVKDDKIISTGFHKR-----GLPHAEVEAIKSLGD-----KARGAALYVTLEPCPPCTDLIIQSGIKAVYYGLHDPNLAVCGKGIEQLQRAGV----NCFLIEL-PEINAFYESYRYWIKHKRPWVTAKLALSLD 159
11 -32.500IDP06060 gene: ribD; riboflavin-specific deaminase [Helicobacter pylori J99] NP_224116 [Helicobacter pylori J99]  ali follow..  20  2...RLYESLLEICLNKAWEYQTLAL-PVACMVLKNHEILSLETHKK-----KTPHAEVLAAKSALKILHDNAFKDCVFLITLEPCPACSGLLEILKPKRVIIATEENEAKKGGL------ERLQKAHIETIICHNLENKAKNLLLPFRVMEQKGRFNLFKLALRMN 187
12 -12.700IDP04297 cytidine deaminase [Vibrio cholerae O1 biovar eltor str. N16961] VC1231 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  20  41LLTLSGLEDADLRVALLPIAAAYSYAPVGAIVRGISGRLYLGANMEFTG-GQTVHAEQCAISHAWMK-GEKGVA--DITINFSPCGHCRQFMNE........................................................................ 138
13 -12.200IDP00989 gene: cdd; cytidine deaminase STM2183 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  20  41LKNTAGLDEDALAFALLPLAAACARTDVGAIARGVSGNWYFGANMLGATMQQTVHAEQSAISHAWLR-GEKGLA--AVTVNYTPCGHCRQFMNE........................................................................ 138
14 -11.900IDP00055 blasticidin S deaminase, putative BA_3696 [Bacillus anthracis str. Ames]  ali follow..  15  2...NIEQQLYDVVKQLIEQRYPND--GGAAAIRVEDGTIYTSVAPDVINASTELCMETGAILEAHKF-QKKVTHSICLLKVLSPCGVCQERLFY........................................................................ 98

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 3 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.