current user: public

If you have questions about the server, please let us know.

Query: gi|30260214|ref|NP_842591.1| hypothetical protein (BA_0020) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
1 -52.700IDP02296 hypothetical protein GBAA0020 [Bacillus anthracis str. `Ames Ancestor`] GBAA0020 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  100  1MMRGGMGNMNNMMKQMQKMQKEMAKAQEELGEKTVEGTAGGGMITVIANGHKQILEVKVKEEVVDPEDIEMLQDLVLAATNDALKKADELSNSTMGKFTKGLNLPGGMF 109
2 -6.280IDP91908 hypothetical protein SpneCM_07251 [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007251 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  120....GLDKYKKLLEDAVSETTDLEKRYEKYAKAQAWSTDSSLLMPTASSGGFPVVSMKLQKDIVTTKEYNEVFKKWQKEKLESNSKYQKELEKYIK............. 234
3 -5.930IDP95337 hypothetical protein [Vibrio cholerae] AHX36902 [Vibrio cholerae]  ali follow..  132........KQLSATEVSYTRSDGAVFESCYRTRFVFGLLPNGRAKVWLSDCGETIYLT---ELAPDQTPDRDSNGFKADTYKESSYIRNIQQRAKDAGVELEPIP.... 225
4 -5.820IDP02610 hypothetical protein Cj1417c [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1417c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  142.......................FAIEKLGEDLVELCLAKDNTIEAFKHKYENIFGIMWHIERENGLNNIQILKEWFSLIKE........................... 200
5 -5.820IDP95346 conserved hypothetical protein [Vibrio cholerae MZO-3] EDT88112 [Vibrio cholerae MZO-3]  ali follow..  129........KQLSATEVSYTRSDGAVFESCYRTRFVFGLLPNGRAKVWLSDCGETIYLT---ELAPDQTPDRDSNGFKADTYKESSYIRNIQQRAKDAGVELEPIP.... 222
6 -5.760IDP95334 conserved hypothetical protein [Vibrio cholerae 1587] EAY35202 [Vibrio cholerae 1587]  ali follow..  129........KQLSATEVSYTRSDGAVFESCYRTRFVFGLLPNGRAKVWLSDCGETIYLT---ELAPDQTPDRDSNGFKADTYKESSYISNIQQRAKDAGVELEPIP.... 222
7 -5.670IDP01858 gene: def; peptide deformylase [Coxiella burnetii RSA 493] CBU_0993 [Coxiella burnetii RSA 493]  ali follow..  12........LKTAAQRVEKFDDALQKMIDEMFETHYAATNCAALAATQLDMENPKHITVIDFSPNKDQPLCLVNAEIIERSGEHTEE-------------GCMSVGGGTF 100
8 -5.550IDP00779 gene: sirR; iron-dependent repressor SACOL0691 [Staphylococcus aureus subsp. aureus COL]  ali follow..  12  26.........KILSQFLNIKPPSVSEMVGRLEKAGYVETKPYKGVRLTEDGLTHTLDIIKRHRLLELFLIEILKYNWEEVHQEAEILEHRISDLFVERLDSLLNFP.... 121
9 -5.530IDP91194 Stage III sporulation protein AH BAS4090 [Bacillus anthracis str. Sterne]  ali follow..  139.........ATEKSKAKDNFDAITTMETKQELLETVIKSQGGYKDALVRADGTDIKVTVKAAKHSQKEANKIIQLVRSEGGSKDVGVK..................... 217
10 -5.530IDP05572 stage III sporulation protein AH [Bacillus anthracis str. Sterne] BAS4090 [Bacillus anthracis str. Sterne]  ali follow..  139.........ATEKSKAKDNFDAITTMETKQELLETVIKSQGGYKDALVRADGTDIKVTVKAAKHSQKEANKIIQLVRSEGGSKDVGVK..................... 217

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24