current user: public

If you have questions about the server, please let us know.

Query: gi|30260205|ref|NP_842582.1| glutamine amidotransferase subunit PdxT (BA_0011) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MVKIGVLGLQGAVREHVKSVEASGAEAVVVKRIEQLEEIDGLILPGGESTTMRRLIDKYDFMEPLRTFAKSGKPMFGTCAGMILLAKTLIGYDEAHIGAMDITVERNAFGRQKDSFEAALSIKGVGEDFVGVFIRAPYVVDVADDVEVLSTHGDRMVAVKQGPFLAASFHPELTDDHRVTAYFVEMVKEAKMKKVVLast
1 -29.200sp|P49915|GUAA_HUMAN GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens GN=GMPS PE=1 SV=1  ali   16  27..AVVILDAGAQYGKVIRRVRELFVQSEIFPLETPAFAIRAIIISGGPNS-----VYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKV--------FGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGSVDKVADGFKVVARSGNIVAGIANESLYGAQFHPEVGNGKVILKNFLYDIAGCSGT... 216
2 -22.800sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3  ali   19  26.PRILALDC-GLKYNQIRCLCQRGAEVTVVPWDHALDSQEGLFLSNGPGDPASYPSVVSTLSRVLSE--PNPRPVFGICLGHQLLAL--------AIGAKTYKMRYGNRGHNQPCLLVGSGRCFLTSQNHGFAVETDSLPA---APLFTNANDGSNEGIVHNSFFSVQFHPEHQAGPSLFDIFLETVKEATAGNPG 216
3 -21.500sp|Q92820|GGH_HUMAN(removed signalp:1-20) Gamma-glutamyl hydrolase OS=Homo sapiens GN=GGH PE=1 SV=2  ali follow..  18  16...IGILMQKCR-ASYVKYLESAGARVVPVRLDLTFKSINGILFPGGSVDLRRSDYAKVA-LSIQSFDDGDYFPVWGTCLGFEELSTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKLKKFFNVLTTNTDGKIEFYKYPVYGVQWHPEKA-AFYLAEFFVNEARKNNHH... 265
4 -21.300sp|P31327|CPSM_HUMAN Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2  ali   15  68.TKVVAVDC-GIKNNVIRLLVKRGAEVHLVPWNHDFTKMDGILIAGGPGNPALAEPLIQNVRKILE--SDRKEPLFGISTGNLITG---------AAGAKTYKMSMANRGQNQPVLNITNKQAFITAQNHGYALDNTLPAGWKPLFVNVNDQTNEGIMHESKPFFAVQFHPEVTPGPILFDSFFSLIKKGKATTI. 256
5 -18.300sp|O15067|PUR4_HUMAN Phosphoribosylformylglycinamidine synthase OS=Homo sapiens GN=PFAS PE=1 SV=4  ali   17  14..RVAILREEGS-REMADAFHLAGFEVWDVSGAIGLDTFRGVAFVGGFSGWAAAVTFHPRAGAELRRFRRPDTFSLGVCNGCQLLALRHNLSGRYESRWASVRVGPGPALMLRGMEGAVLPVWSAHGEGYVAFSSPELQAQIEARGLAPLHWADD-ICSCDGRHLAVMPHPERSPWLQLFINARNWTLEGS..... 287
6 -14.500sp|O15067|PUR4_HUMAN Phosphoribosylformylglycinamidine synthase OS=Homo sapiens GN=PFAS PE=1 SV=4  ali   22  164..RVAILREEGS-REMADAFHLAGFEVWDVSGAIGLDTFRGVAFVGGFSYAAAAVTFHPRAGAELRRFRRPDTFSLGVCNGCQLLAL---------LGWVG............................................................................................... 271
7 -12.800sp|Q99497|PARK7_HUMAN Protein DJ-1 OS=Homo sapiens GN=PARK7 PE=1 SV=2  ali follow..  19  5..RALVILAKGETVIPVDVMRRAGIKVTVAEDAKKEGPYDVVVLPGGNLGA-QNLSESAAVKEILKEQENRKGLIAAICAGPTALLAH............................................................................................................ 115
8 -11.300sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3  ali   25  177..RILALDC-GLKYNQIRCLCQRGAEVTVVPWDHALDSQEGLFLSNGPGDPASYPSVVSTLSRVLSE--PNPRPVFGICLGHQLLA---------AIGAKTYKMRYGNRGHN.................................................................................... 277
9 -11.100sp|P31327|CPSM_HUMAN Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2  ali   18  218.TKVVAVDC-GIKNNVIRLLVKRGAEVHLVPWNHDFTKMDGILIAGGPGNPALAEPLIQNVRKILES--DRKEPLFGISTGNLIT............................................................................................................... 300
10 -10.900sp|Q8NB37|PDDC1_HUMAN Parkinson disease 7 domain-containing protein 1 OS=Homo sapiens GN=PDDC1 PE=1 SV=1  ali follow..  11  39.FNLQVATPGGK-VTESNARWVQDFRLKAYASPAKLESIHALLIPSCP-GALTDLASSGSLARILQHFHSESKPICAVGHGVAALCCATNEDRSWVFD-----------SYSLTGPSVCELVRAPGFAR---LVVEDFVKDSGACFSASEPDAVHVVL---DRHLVTGQNASSTV--PAVQNLLFLCGSRK..... 220
11 -9.780sp|P49915|GUAA_HUMAN GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens GN=GMPS PE=1 SV=1  ali   20  3......................................................................................................................................HGDSVDKVADGFKVVARSGNIVAGIASKKLYGAQFHPEVGNGKVILKNFLYDIAGCSGT... 66
12 -9.730sp|P30042|ES1_HUMAN(removed signalp:1-17) ES1 protein homolog, mitochondrial OS=Homo sapiens GN=C21orf33 PE=1 SV=3  ali follow..  28  107..................................SAANHDAAIFPGGFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRG......................................................................................................... 172
13 -9.010sp|P50747|BPL1_HUMAN Biotin--protein ligase OS=Homo sapiens GN=HLCS PE=1 SV=1  ali   10  14.....ILLYVGSFHEVRSVLADC-LLEDSALRDPWTDNCLLLVIATRES--------PEDLYQKFMAYLSQGGKVLGLSSSFTFGGFQVTSKGALHKTVQNLVFKADQSEVKLSVLSSGCRYQEGPVRLSPGRLQGHLENEDKDRMIVHVPFG-----TRGGEAVLCQVHLELPPSSNIVPEDFNLLKSSNFRRY. 211

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Reed JC, Doctor K, Rojas A, Zapata JM, Stehlik C, Fiorentino L, Damiano J, Roth W, Matsuzawa S, Newman R, Takayama S, Marusawa H, Xu F, Salvesen G, Godzik A.; RIKEN GER Group; GSL Members. Comparative analysis of apoptosis and inflammation genes of mice and humans. Genome Res. 2003 Jun;13(6B):1376-88.