current user: public

If you have questions about the server, please let us know.

Query: gi|30260206|ref|NP_842583.1| seryl-tRNA synthetase (BA_0012) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420
# Score Template Links and tools%idFirst MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQISVLKREKKDAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSIPNIPHESAPVGETEDDNVVARTWGEVKEFAFEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALISFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTNMHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEELEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEAFQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMGGKTVIKLast
1 -117.000sp|P49591|SYSC_HUMAN Seryl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=SARS PE=1 SV=3  ali follow..  32  2VLDLDLFRVDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWG-DCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLG-SRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKDKVEFVHMLNATMCATTRTICAILENYQTEKG-ITVPEKLKEFMPPGLQE. 466
2 -109.000sp|Q9NP81|SYSM_HUMAN Seryl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=SARS2 PE=1 SV=1  ali follow..  29  57QLDIERFCACPEEAAHALELRKGELRDLPAIISTWQELRQLQEQIRSLEEEKAAVTEAVRALLANQDKYQGLRARGREIRKELVHLYPREAQLEEQFYLQALKLPNQTHPDVPVGDESQ-ARVLHMVGDKPVFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTFNKLL-RRGFTPMTVPDLLRGAVFEGCGMTPNANPSQIYNRFKDLNLAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAET-NTGQEPRGLYRVHHFTKVEMFGVTGLEQSSQLLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQ-TEAGELQFAHTVNATACAVPRLLIALLESNQQKDGSVLVPPALQSYLGTDRITA 492
3 -24.200sp|P07814|SYEP_HUMAN Bifunctional aminoacyl-tRNA synthetase OS=Homo sapiens GN=EPRS PE=1 SV=5  ali   16  3.........................................................................................................................................................................AYAIWEAIKDF-FDAEIKKLGVENCYFPMFVSQSALEKKTHVADFAPEVAWVTAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEF----KHPQPFLRTREFLWQEGHSAATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTT-RTIGVMTMVHGDNMG-LVLPPRVACV........ 252
4 -23.100sp|Q7L3T8|SYPM_HUMAN Probable prolyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=PARS2 PE=1 SV=1  ali follow..  18  36....................................................................................................................RGRRLLLSRVFQPQNLREDRVLSLQDKSDDLTCKSQRLMLQVASPGCYHLLPYTVRAMEKLVRV-IDQEMQAIGGQKVNMPSLSPAELWQATNRWDLMGKELLRLRDKEYCLGPTHEEAITALIASQKLSYKQLPFLLYQVTRKFRDEP----RPRFGLLRGREFYMKDMYTFDSSPEAQQTYSLVCDAYCSLFNKLGLPFVKVQADVGTIGGTVSHEFQLPV---TKTKGIEVGHTFYLGTKYSSIFNAQFTNVCGKPTLAE--MGCYGLGVTRILAAAIEVLSTEDC-VRWPSLLAPY........ 370
5 -20.700sp|Q9BW92|SYTM_HUMAN Threonyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=TARS2 PE=1 SV=1  ali   15  1..........................................................................................................................................DHRRIGKEQELFFFHE----LSPGSCFFLPRGTRVYNALVAFIRAEY-AHRGFSEVKTPTLFSTKLWEQSGHWEHYQEDMFAVQPPGSDRPPSSQSDDSTMFAHRPRSWRELPLRLADFGALHRAEASG---GLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLRSVYAVLGFSFRLALSTRPSGFLG-----DPCLWDQAEQVLKQALKEFGEP-FYGPKIDVHLHDALGRPHQ-CGTIQLDFQLPLRFDL----QYKGQAGALERPVLIHRAVLGS.... 291
6 -20.600sp|P26639|SYTC_HUMAN Threonyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=TARS PE=1 SV=3  ali   18  17.....................................................................................................................................EAKNRDHRKIGRDQELYFFHE----LSPGSCFFLPKGAYIYNALIEFIRSEY-RKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSG---ALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLG-----DIEVWDQAEKQLENSLNEFGEKDFQPIRFNLTYVSHDGDDKK-------RPVIVHRAILGSVER......................... 299
7 -20.200sp|P07814|SYEP_HUMAN Bifunctional aminoacyl-tRNA synthetase OS=Homo sapiens GN=EPRS PE=1 SV=5  ali   12  4..LFDKVASQGEVVRKEKAPKDQVDIAVQELLQLKAQYKSLIGV----KDKKKKEKENKSEKQNKPQKQNDGQRKDPSKNQGGGLSSSGAGEGQGPKKQTRLGLEAKKEENLAD-------------------------YSQVITKSEMIEYH-----DISGCYILRPWAYAIWEAIKDF-FDAEIKKLGVENCYFPMFVSQSALEKETHVADFAPEVAWVTAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEF----KHPQPFLRTREFLWQEGHSAATMEEAAEEVLQILDLYAQVYEEL............................................................................................................... 300
8 -19.500sp|A2RTX5|SYTC2_HUMAN Probable threonyl-tRNA synthetase 2, cytoplasmic OS=Homo sapiens GN=TARSL2 PE=1 SV=1  ali   20  96.....................................................................................................................................EAKNRDHRKIGKEQELFFFHD----LSPGSCFFLPRGAFIYNTLTDFIREEY-HKRDFTEVLSPNMYNSKLWEASGHWQHYSENMFEIEKDTFALKPMNCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSG---TLSGLTRVRRFQQDDAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQL------NLSTRPENFLEIEMWNEAEKQLQN........................................................................... 300
9 -16.300sp|A2RTX5|SYTC2_HUMAN Probable threonyl-tRNA synthetase 2, cytoplasmic OS=Homo sapiens GN=TARSL2 PE=1 SV=1  ali   19  1.................................................................................................................................................................................................VLSPNMYNSKLWEASGHWQHYSENMFTFEKDTFALKPMNCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSG---TLSGLTRVRRFQQDDAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPENFLG-----EIEMWNEAEKQLQNSLMDFGEPDFQPIRFNLTYVSKDGDDKKRPVIIHRAILSVERMIAILSENYGGK-----WPFWLSP......... 247
10 -14.300sp|P41250|SYG_HUMAN(removed signalp:1-26) Glycyl-tRNA synthetase OS=Homo sapiens GN=GARS PE=1 SV=3  ali   19  94.........................................................................................................................................................................................................NDLSPPVSFNLMFKTFIGPGGNMPGYLRPTAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEI----SPRSGLIRVREFTMAEIEHFVDPSENNTVLGYFIGRIYLYLTKVGISPRFRQHMENEMAHYACDCWDAESKTS---GWIEIVGCADRSCYDLSC............................................................. 295
11 -13.300sp|Q9BW92|SYTM_HUMAN Threonyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=TARS2 PE=1 SV=1  ali   16  15...............................FFLGKERTIRGSELPVLERICQELTAAARPFRRLEASRDQLRQLFKDNPFKLHLIEEKVTGPTATVYGCGTLVDLCQGPHLRHTGSGAPETLQRVSGIAWREEAELRDHRRIGKEQELFFFHE----LSPGSCFFLPRGTRVYNALVAFIRAEY-AHRGFSEVKTPTLFSTKLWEQSGHWEHYQEDMFRHITDTLALKPMNCPAHCLMFAHRPRSWRELPLRLADFGALHRAEASG---GLGGLTR................................................................................................................................................... 300
12 -12.200sp|P26639|SYTC_HUMAN Threonyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=TARS PE=1 SV=3  ali   18  30........ENGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGIKFQEEAKNRDHRKIGRDQELYFFHE----LSPGSCFFLPKGAYIYNALIEFIRSEY-RKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSG............................................................................................................................................................. 297
13 -10.100sp|P41250|SYG_HUMAN(removed signalp:1-26) Glycyl-tRNA synthetase OS=Homo sapiens GN=GARS PE=1 SV=3  ali   18  1.................................................................................................................................................................................................................................................................GNSFRNEISPR----SGLIRVREFTMAEIEHFVDPSENNTVLGYFIGRIYLYLTKVGISLRFRQHMENEMAHYACDCWDAESKTS---GWIEIVGCADRSCYDLSCNVKRFQKTLYVEEVVPNVIE-PSFGLGRIMYTVFEHTFHVREGFSFPAVVAPF........ 288
14 -9.640sp|Q9UHN1|DPOG2_HUMAN DNA polymerase subunit gamma-2, mitochondrial OS=Homo sapiens GN=POLG2 PE=1 SV=1  ali follow..  10  1........................................................................MRSRVAVRACHKVCRCLLSGFGGRVDGQPELLTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLQQLSRDSLLSGCHPGFGPLGVELRKNLAAWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLRLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTK-QIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSFSSSDCQDEE----GRKGNKLYYNFP---GKELIETLWNLGDHELLHMY-KLHGRDGRKNVVPCVLS-VNGDLDRGMLAYLYDSFQLTENLKLHPCLAPI........ 381

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Reed JC, Doctor K, Rojas A, Zapata JM, Stehlik C, Fiorentino L, Damiano J, Roth W, Matsuzawa S, Newman R, Takayama S, Marusawa H, Xu F, Salvesen G, Godzik A.; RIKEN GER Group; GSL Members. Comparative analysis of apoptosis and inflammation genes of mice and humans. Genome Res. 2003 Jun;13(6B):1376-88.