current user: public

If you have questions about the server, please let us know.

Query: gi|30260208|ref|NP_842585.1| deoxynucleoside kinase family protein (BA_0014) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTRWSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKGLFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINNFNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVKLast
1 -73.700sp|Q16854|DGUOK_HUMAN Deoxyguanosine kinase, mitochondrial OS=Homo sapiens GN=DGUOK PE=1 SV=2  ali follow..  24  27SSSRGLHAGRGPRRLSIEGNIAVGKSTFVKLLTKTYPTQKACTAQSLGNLLDMMYREPARWSYTFQTFSFLSRLKVQLEPFARKPVQIFERSVYSDRYIFAKNLFENGSLSDIEWHIYQDWHSFLLWEFSRITLHGFIYLQASPQVCLKRLYQRAREEEKGIELAYLEQLHGQHEAWLIHLMNIPVLVLDVND-DFSEEVTKQEDLMREVNTFVKNL..... 277
2 -70.000sp|P27707|DCK_HUMAN Deoxycytidine kinase OS=Homo sapiens GN=DCK PE=1 SV=1  ali follow..  28  11.SFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCDWEVVPEPVARGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTEVPILTLDVNE-DFKDKYESLVEKVKEFLSTL........ 260
3 -69.600sp|O00142|KITM_HUMAN Thymidine kinase 2, mitochondrial OS=Homo sapiens GN=TK2 PE=1 SV=4  ali follow..  23  40.PPDKEQEKEKKSVICVEGNIASGKTTCLEFFSNATDVEVLTEPVSKHNPLGLMYHDASRWGLTLQTYVQLTMLDRHTRPQVS-SVRLMERSIHSARYIFVENLYRSGKMPEVDYVVLSEWFDWILRNM-DVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSAAPVLVIEADH-HMERMLELFEQNRDRILTPENRKH.... 263
4 -59.000sp|O95299|NDUAA_HUMAN(removed signalp:1-20) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens GN=NDUFA10 PE=1 SV=1  ali follow..  21  27.DKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGNGNCSLEKFYDDPRSNSYRLQSWLYSSRLLQYSDALTTGQGVVLERSIFSDF-VFLEAMYNQGFIRKQCVDHYNEVKSVTICDY--LPPHLVIYIDVPVPEVQRRIQKKGDPHEMKITSAYLQDIENAYKKTFLPEMSEKCEVLQYSAREAQDSKKVVEDIEYLKFDKGP....... 262
5 -26.200sp|P23919|KTHY_HUMAN Thymidylate kinase OS=Homo sapiens GN=DTYMK PE=1 SV=4  ali follow..  15  1......MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPLLSSYLQKKSDVEDHSVHLLFSEQVPLIKEKLSQGVTLVVDRYAFSGVAF-------TGAKENFSLDWCKQP------DVGLPKPDLVLFLQLQLADAAKRGAFGHERYEN---GAFQERALRCFHQ-LMKDTTLNWKMVDASK----SIEAVHEDIRVLSEDAIRTAT.... 203
6 -24.900sp|Q5EBM0|CMPK2_HUMAN UMP-CMP kinase 2, mitochondrial OS=Homo sapiens GN=CMPK2 PE=1 SV=3  ali follow..  13  245....KQIQKGKFQVVAIEGLDATGKTTVTQSVADSLKAVLLKSPPSCIGQWRKIFDDEPTIIRRAFYSLGNYIVASEIAKESAKSPVIVDRYWHSTATYAIATEVSGGHLPPAHHPVYQ--------PEDLLKPDLILLLTVSPEERLQRLQGRGMEAELEANSVFRQKVEMSYQRM----ENPGCHVVDASP----SREKVLQTVLSLIQNSFSEP..... 449
7 -21.500sp|Q9Y3D8|KAD6_HUMAN Adenylate kinase isoenzyme 6 OS=Homo sapiens GN=TAF9 PE=1 SV=1  ali follow..  18  6..............ILLTGTPGVGKTTLGKELASKSGLKYI-DLAREEQLYDGYDEEYDCPILDED------RVVDELDNQMREGGVIVDYHGCD---------------------------------FPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPE--ELENNVDQILKWIEQWIKDHN.... 171
8 -20.800sp|Q5T6J7|GNTK_HUMAN Probable gluconokinase OS=Homo sapiens GN=C9orf103 PE=2 SV=1  ali follow..  18  1........MAAPGALLVMGVSGSGKSTVGALLASELGWKFY----DADDYHPEENRRKMGKGIPLN--WLCNLHDILLRDVASGQRVVLACSALKKTY--------RDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKRGHFMPPELLQSQFETLEPPAAP-------ENFIQISVDK--------NVSEIIATIMETLKMK..... 187
9 -19.600sp|Q9BZX2|UCK2_HUMAN Uridine-cytidine kinase 2 OS=Homo sapiens GN=UCK2 PE=1 SV=1  ali follow..  16  9LQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILDSFYRVLTSFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSH----SRKEETVTVYPADVVLFEGIL-AFYSQEVRDLFQMKLFVDTDADTRLSRISERGRDLEQILS-QYITFVKPAFEEFCLPTKKYADVIIPRG----ADNLVAINLIVQHIQDILNGGP.... 233
10 -18.800sp|Q9NPI5|NRK2_HUMAN Nicotinamide riboside kinase 2 OS=Homo sapiens GN=ITGB1BP3 PE=1 SV=1  ali follow..  11  4.............IVGIGGMTNGGKTTLTNSLLRALPNCCVIH-------QDDFFKPQDQIAVSLDMEAMLDTVQAWLS---------------PQKFARAHGVSVQPEASDTHILLLEGFLLYSYKPLVDL--SRRYFLTVPYEECKWRRSTRNYTVP-DPPGLFDGHVWPMYQKYRQEMEANGVEVVYLDGMK--SREELFREVLEDIQNSLLNRSQ... 196
11 -18.600sp|Q9HA47|UCK1_HUMAN Uridine-cytidine kinase 1 OS=Homo sapiens GN=UCK1 PE=1 SV=1  ali follow..  14  21.........QRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRQRKVVILDRFYKVLTAYNFDHPDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTH----SRLPETTVVYPADVVLFEGIL-VFYSQEIRDMFHLRLFVDTDSDVRLSRRVLRDGRDLEQILTQYTTFVKPAFEEFCLPTKKYADVIIPRG----VDNMVAINLIVQHIQDILNG...... 233
12 -18.000sp|Q9NWW6|NRK1_HUMAN Nicotinamide riboside kinase 1 OS=Homo sapiens GN=NRK1 PE=1 SV=1  ali follow..  10  2..........KTFIIGISGVTNSGKTTLAKNLQKHLPNCSVIS-------QDDFFKPESEIETALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFL------------------LFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPP-DSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTK--SEEDLFLQVYEDLIQELAKQK.... 193
13 -17.800sp|Q15126|PMVK_HUMAN Phosphomevalonate kinase OS=Homo sapiens GN=PMVK PE=1 SV=3  ali follow..  11  1...MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQ-DTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVS------DIQWFREAYGAVT---------QTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDF-------------WVIE-NHGVEQRLEEQLENLIEFIRSRL........ 192
14 -15.700sp|Q9NWZ5|UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens GN=UCKL1 PE=1 SV=2  ali follow..  13  90...EHGTQSKEAFAIGLGGGSASGKTTVARMIIEALDVPWVV--------MDSFYKVHNNFNFDHPDAFDFDLIISTLKKLKQGKSVKVPIYDFTTH----SRKKDWKTLYGANVIIFEGIMAFADKTLLEL--DMKIFVDTDSDIRLVRISERGRDIE-GVIKQYNKFVKPSFDQYIQPTMRLADIVVPRGSGNTVAIDLIVQHVHSQLEE.......... 302
15 -15.700sp|P00568|KAD1_HUMAN Adenylate kinase isoenzyme 1 OS=Homo sapiens GN=AK1 PE=1 SV=3  ali follow..  12  2.....EEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDMVAKVNTSKGFLID----------------------------REVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGR--VDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK.... 194
16 -15.600sp|Q00839|HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6  ali   12  37.GPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAELGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLG--KFIEIAARKKRNFILDQT----------------NVSAAAQRRKMCLFAGFQRK--------AVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKE................. 221
17 -15.500sp|P30085|KCY_HUMAN UMP-CMP kinase OS=Homo sapiens GN=CMPK1 PE=1 SV=3  ali follow..  10  2..........KPLVVFVLGGPGAGKGTQCARIVEKYGYERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLID---------FPRNQDNLQGWNKT---------------DGKADVSFVLFFDCNNEICIERCLERGKSSGR--SDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKE..... 195
18 -15.100sp|Q8IYQ7|THNS1_HUMAN Threonine synthase-like 1 OS=Homo sapiens GN=THNSL1 PE=1 SV=2  ali   16  47...YSTHSLVGDKNIILMGPPGAGKTTVGRIIGQKLGCCVILEKTWNMSVSEKLQDVGNEQFLEEEGKAVLNFSASGSVISLTGSNPMHDASM--------WHLKKNG---------------------------IIVYLDVPLLDLICRLKLKTDRIVGQNSGTSMKDLLKFRRQYYKKWYDARVFC---------ESGASPEEVADKVLNAIKRYQ.... 224
19 -14.500sp|Q8IV42|PSTK_HUMAN L-seryl-tRNA(Sec) kinase OS=Homo sapiens GN=PSTK PE=2 SV=2  ali follow..  13  7IRGTGSDGPRKRGLCVLCGLPAAGKSTFARALAHRLQQEVAYDDVMPDAFLAGARARPAPSQWKLLRQELLKYLEYFLMAVINGCQMSVPPNRTEAMWEDFITCLKDQDLIFSAAFEAQSCYLLTKTAVSRPLFLVLLFLDCPLETCLQRNGQR----PQALPPETIHLMGRKLEK--KNAWEHNSLTIPSPACASEASLEVTDLLLTALENPVKYAE.... 255
20 -14.300sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2  ali   10  64..............IIIVGPPKSGKTTVAKKITSEYGLKHL----SIGGALRYVLNNHPETELALMLNWHLHKGMTAPDELAIQ---ALELSLMESVCNTAGVVIDGYPVTKHQMNLLEA---------RSIIPMVIFELSVPSKEIFKRLLLEKENEQRLPSAQIVAVNNVKYRK-YYQEQHQNWYVIDGFH----SKWWVWNEVIKNVQMVNKYMQTYLE 262
21 -13.400sp|Q96EK9|KTI12_HUMAN Protein KTI12 homolog OS=Homo sapiens GN=KTI12 PE=1 SV=1  ali follow..  12  3.............LVVFCGLPYSGKSRRAEELRVALAAEGRAVYVVDDAAVLGAEDPAVYGDSAREKALRGALRASVERRLSRHDVVILD---------------SLNYIKGFRYELYC-------LARAARTPLCLVYCVRPGGPIAGPQVAGANENPGRNVSVSWRPRAEEDGR.............................................. 143
22 -13.400sp|Q16774|KGUA_HUMAN Guanylate kinase OS=Homo sapiens GN=GUK1 PE=1 SV=2  ali follow..  10  1........MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVM----------QRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESS-------------EPGLFDVVIINDSLDQAYAELKEALSEEI.... 189
23 -13.300sp|Q9BSD7|CA057_HUMAN Nucleoside-triphosphatase C1orf57 OS=Homo sapiens GN=C1orf57 PE=1 SV=1  ali follow..  11  2...........ARHVFLTGPPGVGKTTLIHKASEVLKSSGVP-------YTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYV---------VDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRN-----HLLPDIVTCVQSSRK....... 190
24 -12.800sp|Q1KMD3|HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens GN=HNRNPUL2 PE=1 SV=1  ali   13  3............EVILMVGLPGSGKTQWALKYAKELGAETVLNQMRMKGLEEPEMDPKSRDLLVQQASQCLS--KLVQIASRTKRNFILDQC----------------NVYNSGQRRKLLLFKTFSRK--------VVVVVPNEEDWKKRLELRKEVEGDDVPESIMLEMKANFSLPEKCDYMDEVTYGELEKEEAQPIVTKYKE................. 177
25 -12.700sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2  ali   13  20.ETERNFLLSKPVCFVVFGKPGVGKTTLARYITQAWKCPILEEQIAAETESGVMLQSMLISGQSIPDELVIKLMEKLNSPEVCHFGYIIT-----------PSLSQDAMTTLQQIELIKNL----------LKPDVIINIKCPDYDLCQRISQRPEDYLENVENIYKETILQTLEEVMAEHNPQYLIELNGNK--------PAEELFMIVMDRLKYLN.... 288
26 -12.400sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2  ali   14  132...RKKTSYVGLVLVLLRGLPGSGKSFLARTLQEDNPSGVILS-------TDDYFYINGQYQFDVKYLGEAHEQNRAKEAFEKKSPIIIDNT----------------NLQAWEMKPYVALSQKHKYKV------LFREPDTWWKFKPKELARRN---IHGVSKEKITRMLEHYQRIMSSSVPEKIERIELCAYS........................... 300
27 -12.100sp|Q5TBK1|N42L1_HUMAN NEDD4-binding protein 2-like 1 OS=Homo sapiens GN=N4BP2L1 PE=2 SV=1  ali follow..  11  31RGTPPRRHSFRKHLYLLRGLPGSGKTTLARQLQHDFPRALI---FSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNT----------------NLHAWEMKPYAVMALENNYEV------IFREPDTRWKFNVQELARRN---IHGVSREKIHRMKERYEH.............................................. 178
28 -12.100sp|Q9Y6K8|KAD5_HUMAN Adenylate kinase isoenzyme 5 OS=Homo sapiens GN=AK5 PE=1 SV=2  ali follow..  13  374.........RKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHL----STGELLREELASESERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDG----------------REVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLP--VDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDSI..... 561
29 -12.100sp|P09543|CN37_HUMAN 2`,3`-cyclic-nucleotide 3`-phosphodiesterase OS=Homo sapiens GN=CNP PE=1 SV=2  ali follow..  12  40.EDTVATLLECKTLFILRGLPGSGKSTLARVIVDKYRDGTKMVSADA------YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDT----------------NHERERLEQLFEMADQYQYQV------VLVEPKTAWRLDCAQLKEKN---QWQLSADDLKKLKPGLEK.............................................. 183
30 -11.900sp|Q15645|TRP13_HUMAN Thyroid receptor-interacting protein 13 OS=Homo sapiens GN=TRIP13 PE=1 SV=2  ali follow..  12  164...VNSNLITWNRVVLLHGPPGTGKTSLCKALAQKLTIRLSSREINSHSLFSKWFSESGK-----LVTKMFQKIQDLIDDKDALVFVLIDE----ESLTAARNACRAGTEPSDAIRVVNAVLTQI--DQIKRHSNVVILTTSNITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEELMKCQIIYPRQQLLTLRELE...................... 357
31 -11.900sp|Q9UIJ7|KAD3_HUMAN GTP:AMP phosphotransferase, mitochondrial OS=Homo sapiens GN=AK3 PE=1 SV=4  ali follow..  12  5.........ARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSS------------------------DLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLE----TFSGTETNKIWPYVYAFLQTKVPQRSQ... 221
32 -11.900sp|P27144|KAD4_HUMAN Adenylate kinase isoenzyme 4, mitochondrial OS=Homo sapiens GN=AK4 PE=1 SV=1  ali follow..  13  1.......MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSS------------------------HFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLH----QFSGTETNKIWPYVYTLFSNKITPIQS... 219
33 -11.700sp|P54819|KAD2_HUMAN Adenylate kinase 2, mitochondrial OS=Homo sapiens GN=AK2 PE=1 SV=2  ali follow..  12  7...AAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLD---------FPRTVRQAEMLDD-------------LMEKRKEKLDSVIEFSIPDSLLIRRITGRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHS--------IDASQTPDVVFASILAAFSKA..... 230
34 -11.700sp|Q96M32|KAD7_HUMAN Putative adenylate kinase 7 OS=Homo sapiens GN=AK7 PE=2 SV=3  ali   13  56LKEYKQSRGLMPIKICILGPPAVGKSSIAKELANYYKLDVISEAIAKQELLDGIKESMEQNAGQLDDQYIIRFMKELKSMPCRNQGYILDKTYDQAKDLFNQEDEEEEDDVRGRMFPFDK----------LIIPEFVCALDASDEFLKERVINLPESIVAGTHYS--DRFLRALSNYRDINIDDETVFNYFDELEIHPIHIDVGKLEDAQNRLAIKQ..... 300
35 -11.500sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4  ali   11  68.........GAAWGVLLVGGPGSGKTALCTELLWPSSPASLQRGLHRQALAFHFCKAQDSDTLCVGGFIRGLVAQICRSGLLQGYEDKLRDPA-------VQSLLQPGECERNPAEAFKRCVLLPLLGMKPPQQSLYLLVDSVDEGCNITEGEQTSTSLSGTVAALLAGHHEFFPPWLL------LLCSARKQLDDLRKAYIVKDVQQYILHRLDQEEALRQ 282
36 -11.400sp|Q96M69|LRGUK_HUMAN Leucine-rich repeat and guanylate kinase domain-containing protein OS=Homo sapiens GN=LRGUK PE=1 SV=1  ali   104.DSTLPSLDAPYPMLILAGPEACGKRELAHRLCRQFSTYFRYGACHTTRPPYFGEGDRVDYHFISQ--------DVFDEMVNMGK--FILTFSYGNHKYGLNRDTVEGIARDGLASCIHEIEGVRSLKYSYFEPRYILVVPMNKEKYEGYLRRKGLFSRAEIEFA-VSRVDLYIKINQNFPGYFDEVINADD-------DVAYQKLSQLIREYL........ 300
37 -10.900sp|Q92802|N42L2_HUMAN NEDD4-binding protein 2-like 2 OS=Homo sapiens GN=N4BP2L2 PE=1 SV=1  ali follow..  14  392.FQEEKLNKLQKLLILLRGLPGSGKTTLSRILLGQNRDGIVFS-------TDDYFHHQDGYRYNVNQLGDAHDQNRAKQAIDQGSPVIIDNT----------------NIQAWEMKPYVEVAIGKGYRV------EFHEPETWWKFDPEELEKRN---KHGVSRKKIAQMLDRYEY.............................................. 537
38 -10.900sp|Q8N3R9|MPP5_HUMAN MAGUK p55 subfamily member 5 OS=Homo sapiens GN=MPP5 PE=1 SV=3  ali   27.........NRKRPIILIGPQNCGQNELRQRLMNKEKDRFASA-------VPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGK---FIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNN-------------GHYFDTAIVNSDLDKAYQELLRLINKLD.... 213
39 -10.800sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1  ali   65......RLVEQYHNVIFHGPEGSLQDYIVHQLALCLKHRQMAAGFSCEIVRAEVDAGFSKEQLLDLFISSACLIPVKQSPSKKKIIIILENLEKSSLSELLRDFLAPLENRSTESPCTFQKGNGLSECYYFHENCFLMGTIAKACLQGSDLLVQQHFRWVQLRWD-GEPMQGLLQRFLRRK------VVNKFKGQAPSPCDPVCKIVDWALSVWRQLNSCLA 273
40 -10.600sp|P46459|NSF_HUMAN Vesicle-fusing ATPase OS=Homo sapiens GN=NSF PE=1 SV=3  ali   12  93.EIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREP-KVVNGPEILNKYVGESEA---NIRKLFADAEEEQRRLGANSGLHII----IFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKI-DGVEQLNNILVIGMTNRPDLIDEALLRPGREVKMEIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKELEGLVRAAQS.......... 300
41 -10.400sp|O95340|PAPS2_HUMAN Bifunctional 3`-phosphoadenosine 5`-phosphosulfate synthase 2 OS=Homo sapiens GN=PAPSS2 PE=1 SV=2  ali   16  32.QVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYL--------VSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFE--------------IFVDAPLNICESRLYKRARAGE----IKGFTGIDSDYEK-----PETPERVLKTNLSTV---SDCVHQVVELLQE.......... 212
42 -10.300sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2  ali   14  1......................SGKSFLARTLQEDNPSGVILS-------TDDYFYINGQYQFDVKYLGEAHEQNRAKEAFEKKSPIIIDNT----------------NLQAWEMKPYVALSQKHKYKV------LFREPDTWWKFKPKELARRN---IHGVSKEKITRMLEHYQR.............................................. 125
43 -10.200sp|Q96MA6|CI098_HUMAN Putative adenylate kinase-like protein C9orf98 OS=Homo sapiens GN=C9orf98 PE=2 SV=1  ali follow..  14  257VQSNHRTNAPFTPRVLLLGPVGSGKSLQAALLAQKYRL-----NVCCGQLLKEAVADRTTFGELIQPF-----FEKEMAVPDSLLMKVLSQRLDQQDCIQKGWVLHGVPRDLDQAHLLNRL----------YNPNRVFFLNVPFDSIMERLTLRGERYHLMYPKDAEEQVKLKMDLFYRNSADGSAITLNGDQ--------DPYTVFEYIESGIIN...... 472
44 -10.000sp|O43252|PAPS1_HUMAN Bifunctional 3`-phosphoadenosine 5`-phosphosulfate synthase 1 OS=Homo sapiens GN=PAPSS1 PE=1 SV=2  ali   15  42.QVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYL--------VCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFE--------------VFVDAPLHVCEQRLYKKARAGE----IKGFTGIDSEYEK-----PEAPELVLKTDSCDVNDCVQQVVELLQE............. 222
45 -10.000sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2  ali   14  93........TKLKKPILLEGSPGVGKTSLVGALAKASGNTLLSEQTDITDLFGADLEGGKGGEFAWRDGPLLAALKA-------GHWVVLDE------------------LNLASQSVLEGLNACFDHSFQVQHEKTKIFGCQNP--------FRQGGGRKGLPRSFLNRFTQVFVDPLTVIDMEFIASTLFPAIE-KNIVKKMVAFNNQIDHEVTVEKKWGQ 289
46 -10.000sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2  ali   10  25..............VLLEGPIGCGKTSLVEYLAAVTGRTKLGDQTDSKMLLGMYRCTDVPGEFVWQPGTLTQAATM-------GHWILLEDIDYAPLDVVSVLI---PLLENGELLIPGR-------DCLKVAPGFQFFATRRLLSCGGNWYRPLNSHATLLDKYWTK--------HLDNLDKRELNEV------LQSRYPSLLAVVDHLLDIYIQLTGEKH 211
47 -9.890sp|Q5SY16|NOL9_HUMAN Polynucleotide 5`-hydroxyl-kinase NOL9 OS=Homo sapiens GN=NOL9 PE=1 SV=1  ali   11  138LVNVSCEEVDGCPVILVCGSQDVGKSTFNRYLINHISLLNITEPVLGPPFTHLRTPQKMVYSCKNNYENYIDIVKYVFSAYKRESPLIVN---------------TMGWVSDQGLLLLIDLIRLL-------SPSHVVQFRSDHSKYMPDLTPQ.................................................................... 298
48 -9.850sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2  ali   10  106........VQMSWMVILVGPASVGKTSLVQLLAHLTGHTLMNSAMDTTELLGGFEQVDLIRPWRRLLEKVEGTVRALLRDSLLISADDAEVVLRASHFLLTYKPKCLGEGGKAITMEIVNKLEAVLLLMQRLNNKINSYCKAEFAKLVEEFRSFGVKLTQLASGHSHGTFEWVDSMLVQALKSGDWLLMD--NVNFCNPS...................... 300
49 -9.620sp|Q96T60|PNKP_HUMAN Bifunctional polynucleotide phosphatase/kinase OS=Homo sapiens GN=PNKP PE=1 SV=1  ali follow..  10  363.........ASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRD---------------------TLGSWQRCVTTCETALKQGKRVAIDNT----------------NPDAASRARYVQCARAAGVPCR------CFLFTATLEQARHNNRFREDSSHIPVSDMVMYGYRKQFEAPTLAEGFSAILEIPFRLWVEPRLGRLYCQFSE.............. 520
50 -9.480sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2  ali   28  243........TKLKKPILLEGSPGVGKTSLVGALAKASGNTLLSEQTDITDLFGAD........................................................................................................................................................................ 292
51 -9.320sp|Q96S79|RSLAB_HUMAN Ras-like protein family member 10B OS=Homo sapiens GN=RASL10B PE=2 SV=1  ali follow..  10  7..............VAVLGARGVGKSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVNTLQEWADTCCRGLRSVHAYILVY-------DICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDLQRGRVIPRWNVSHLVRKTW------------------KCGYVECSAKYNWHILLLFSELLKSVGCARCK...... 183
52 -9.290sp|Q68D06|SLN13_HUMAN Schlafen family member 13 OS=Homo sapiens GN=SLFN13 PE=2 SV=1  ali   10  136.....SRSLRKNRELFVHGLPGSGKTIMAMKIMEKI--------------RNVFHCEAHRILYVCENQPLRNFISDRNICRAETRETFLREKFEHIQHIVID---EAQNFRTEDGDWYRKA-KTITQREKDCPGVLWIFLDYFQTS-LPPLSAQYPREELTRVVRNADEIAEYIQQEMQLIIE....................................... 300
53 -9.260sp|Q8WVC6|DCAKD_HUMAN Dephospho-CoA kinase domain-containing protein OS=Homo sapiens GN=DCAKD PE=1 SV=1  ali follow..  10  2............FLVGLTGGIASGKSSVIQVFQQ-LGCAVIDVDVMARHVVQPGYPAHRRIVEVFGTEVLINRKVLGDLIFNQPDRRQLLNAITHPEIRKEMMKETFKYFLRGYRYVILDIPLLFETKKLLKYMKHTVVVYCDRDTQLARLMRRNSLNRKDAEARINAQLPLTDKARMARH------VLD-NSGEWSVTKRQVILLHTELERSLEY...... 202
54 -9.250sp|A3KMH1|K0564_HUMAN Uncharacterized protein KIAA0564 OS=Homo sapiens GN=KIAA0564 PE=1 SV=2  ali   106..............VFLIGPPGPLRRSIAMQYLELTKREVLSRDTTETDLKQRREIRAGTAFYI----------QCAVRAATEGRTLILEGLEKAERNVLPVL--REMQLEDGRFLMSAERYDKLLRDHTKKELDSWKIVRVSENRVIALGLPVPRYSGNPLDPPLRSRFQARDIYYLPFKDQLKLLYSIGANVS--------AEKVSQLLSFATTL..... 300
55 -9.230sp|A6NCM1|IQCAL_HUMAN Putative IQ and AAA domain-containing protein 1-like OS=Homo sapiens GN=IQCA1L PE=5 SV=2  ali   15  110............RSILLVGPSGMGKKMLVKAVCTETGANLF--DLSPENLLGKYPGRNGAQMMVHIVFKVARLLQPSVIWIGNAEKNFYKKT------------------KEDKEMDPKRIKKDLTKALRLLTPGMLIGTTSRPQLAEMRGLCRVYERILFMPRPDYASRYVLWKRMIEARGIQPTQHLDISALAKVSDGYTPGHILQAIQSVLSERR.... 299
56 -9.230sp|Q08AF3|SLFN5_HUMAN Schlafen family member 5 OS=Homo sapiens GN=SLFN5 PE=1 SV=1  ali   115.....SKNLRKTRELFVHGLPGSGKTILALRIMEKI--------------RNVFHCEPANILYICENQPLKKLVSFSKK--NICQPVTRKTFMKNNFEHIQHIIIDDAQNFRTEDGDWYGKAKFITQTARDGPGVLWIFLDYFQTY-LPPPSDQYPREEINRVVRNAGPIANYLQQVMQEARQNPPPNLPPGSLVMLYEPK..................... 299
57 -9.220sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2  ali   16  217........VSKGEPVLLVGETGTGKTSTIQYLAHITGHRLRVQQSDTADLLGGYKPVDHKLIWLPLREAFEELFAQTFSKKQN........................................................................................................................................... 295
58 -9.130sp|Q86XH1|IQCA1_HUMAN IQ and AAA domain-containing protein 1 OS=Homo sapiens GN=IQCA1 PE=2 SV=1  ali   12  119............KSLLLAGPSGVGKKMLVHAICTETGANLF--NLSSSNIAGKYPGKNGLQMMLHAVFKVARQLQPSVVWIEDTEKTFYKKVPNAEKMNEPKRLKKLKLLKPDDRILIQSFCKVYQKIILVPRPD----YASRYVLWKQIIERNGGVLTSALNVSCLAKVTDGFT............................................... 292
59 -9.100sp|Q9C093|SPEF2_HUMAN Sperm flagellar protein 2 OS=Homo sapiens GN=SPEF2 PE=1 SV=2  ali   10  32.SQDPQHVFSAGPVSDEVLPETEGETMLSANADKTPKAEEVFLKLTTRAQLGAKSEQLLKKGKSIPDVLLVDIIVNAINEIPVNQDCILDMTLNQAQLLEEALTGCNRNLTEVERKKAQKSTLAIDPATSKEIPDFVILLDVSDTSSMSRMNDIDKDGDQNLRDQIQHRIIGFLDNWWFSEPENILIKINAE----IDKESLCEKVKEILTTEIAKKK.... 286
60 -9.100sp|Q5SY16|NOL9_HUMAN Polynucleotide 5`-hydroxyl-kinase NOL9 OS=Homo sapiens GN=NOL9 PE=1 SV=1  ali   12  1.............VILVCGSQDVGKSTFNRYLINHISLLNITEPVLGPPFTHLRTPQKMVYSCKNNYENYIDIVKYVFSAYKRESPLIVN---------------TMGWVSDQGLLLLIDLIRLL-------SPSHVVQFRSDHSKYMPDLT...................................................................... 146
61 -9.080sp|Q8WVB6|CTF18_HUMAN Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens GN=CHTF18 PE=1 SV=1  ali   12  59...LDPSQRPKQKVALLCGPPGLGKTTLAHVIARHAGYSV----------VEMNASDDRSPEVFRTRIEAATQMESVLGAGGKPNCLVIDEAAINVLLSILNRKGPQEVGPQGPAVPSGGGRRRRAEGGLLMRPIICIFPPTLPSRLVQRLQEVSLRQGMRADPGVLAALCEKTDNDIRA.......................................... 251
62 -9.050sp|Q9BX10|GTPB2_HUMAN GTP-binding protein 2 OS=Homo sapiens GN=GTPBP2 PE=2 SV=1  ali   13  11VRKVPDNQQFLDLRVAVLGNVDSGKSTLLGVLTQ-----GELDNGRGRARLNLFHLHEIQSGRTSSISFEILGFNSKGEVVNYSDSRTAEEICESS----------SKMITFIDLAGHHKYLHTTIFGLTSYCPDCALLLVSANTGIAGTTRE--------------------HLGLALALKVPFFIVV--SKIDLC-AKTTVERTVRQLERVLKQ...... 189
63 -9.050sp|Q9BVQ7|SPA5L_HUMAN Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2  ali   10  74.RALTALGLAVPRGVLLAGPPGVGKTQLVRAVAREAGAELLA--VSAPALQGSRPGETEE---------VRRVFQRARELASRGPSLLFLDEM--------DALCPQRGSRAPESRVVAQVLTLL-DGASGDREVVVVGATNRPDALDPALRRPGRDREVVIGTPTLKQRKEILQVITSKMPISSHVDLG................................ 244
64 -9.040sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2  ali   12  94..............ICLVGPQGSGKTMCGRQLAEKLNIEVLQEKLLLKT-VGPEFEEDSENEQAAKQELEELAIQANVKVEEENTKKQLPEVQLTEEEEVIKSSLMENEPLPPEILE-RYPEEAQFLGDRGFFPDAAVFIQVDDQDIFDRLLPALKQKKKLERKKLIKDMKAKIRV.............................................. 291
65 -9.040sp|Q7Z7L1|SLN11_HUMAN Schlafen family member 11 OS=Homo sapiens GN=SLFN11 PE=1 SV=2  ali   12  136.....SRSLRKNRELFVHGLPGSGKTIMAMKIMEKIRNVFHCEAHR-NQPLRNFISDRNICRAETRKTFLRENFEHIQHIVIDEAQNFRTED--GDWYGKAKSITRRAKGGPGILWIFLDYFQTSHLD----------------CSGLPPLSDQYPREELTRIVRNADPIAKYLQKEMQVIRS....................................... 300

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.