current user: public

If you have questions about the server, please let us know.

Query: gi|30260197|ref|NP_842574.1| DNA polymerase III subunit beta (BA_0002) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .
# Score Template Links and tools%idFirst MRFSIQKDYLVRSVQDVMKAVSFRTTIPILTGIKVVATEEGVTLTGSDADISIESFIPVEEDGKEIVEVKQSGSIVLQAKYFSEIVKKLPKETVEISVENHLMTKITSGKSEFNLNGLDSAEYPLLPQIEEHHVFKIPTDLLKHMIRQTVFAVSTSETRPILTGVNWKVYNSELTCIATDSHRLALRKAKIEGIVDEFQANVVIPGKSLNELSKILDESEEMVDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASLLARDGRNNVVKLSTLEQAMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMDALKALDSTEIKISFTGAMRPFLIRTVNDESIIQLILPVRTYLast
1 -113.0004tr6_A mol:protein length:380 DNA polymerase III subunit beta  ali model follow..  74  3MKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDDGVSFTGSDSDISIESFIPKEEGDKEIVTIEQPGSIVLQARFFSEIVKKLPMATVEIEVQNQYLTIIRSGKAEFNLNGLDADEYPHLPQIEEHHAIQIPTDLLKNLIRQTVFAVSTSETRPILTGVNWKVEQSELLCTATDSHRLALRKAKLDIPEDR-SYNVVIPGKSLTELSKILDDNQELVDIVITETQVLFKAKNVLFFSRLLDGNYPDTTSLIPQDSKTEIIVNTKEFLQAIDRASLLAREGRNNVVKLSAKPAESIEISSNSPEIGKVVEAIVADQIEGEELNISFSPKYMLDALKVLEGAEIRVSFTGAMRPFLIRTPNDETIVQLILPVRTY 380
2 -105.0003pwe_A mol:protein length:366 DNA polymerase III subunit beta  ali model follow..  25  1MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVAL-------VQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGCSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQSLP--SHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGSDLLKQAFARAAILSNE-KFRGVRLY-VSENQLKITANNPEQEEAEECLDVT-YSGAEMEIGFNVSYVLDVLNALKSENVRMMLTDSVSSVQIEDAASQSAAYVVMPMR.. 365
3 -105.0003f1v_A mol:protein length:366 DNA polymerase III subunit beta  ali model follow..  24  1MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVAL-------VQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAAAAAAYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQSLP--SHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNE-KFRGVRLY-VSENQLKITANNPEQEEAEEILDVT-YSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMR.. 365
4 -104.0006amq_A mol:protein length:366 DNA polymerase III subunit beta  ali model follow..  24  1MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMIARVTL-------SQPHEAGATTVPARKFFDICRGLPEGAEIAVQLEGDRMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGDSLPN--HSVIVPRKGVIELMRMLDGGDTPLRVQIGSNNIRAHVGDFVFTSKLVDGRFPDYRRVLPKNPDKTLEAGCDSLKQAFARAAILSNE-KFRGVRLY-VSENQIKITANNPEQEEAEEILDVT-YAGTEMEIGFNVSYVLDVLNALKCENVRILLTDSVSSVQIEDAASQSAAYVVMPMR.. 365
5 -103.0005x06_A mol:protein length:386 DNA polymerase III subunit beta  ali model follow..  25  15MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVAL-------VQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQSLP--SHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNE-KFRGVRLY-VSENQLKITANNPEQEEAEEILDVT-YSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMR.. 379
6 -103.0004tr8_A mol:protein length:383 DNA polymerase III subunit beta  ali model follow..  25  11MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVVLE-------DAAEPGEITVPARKLMDICKSLPNDVLIDIRVEEQKLLVKAGRSRFTLSTLPANDFPTVEEGPGSLNFSIAQSKLRRLIDRTSFAMAQQDVRYYLNGMLLEVNGGTLRSVATDGHRLAMCSLDAQIPSQD-RHQVIVPRKGILELARLLTEQDGEVGIVLGQHHIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQQLREAFSRTAILSNE-KYRGIRLQ-LSNGLLKIQANNPEQEEAEEEVQVE-YNGGNLEIGFNVSYLLDVLGVIGTEQVRFILSDSNSSALVHEADNDDSAYVVMPMR.. 376
7 -102.0002xur_A mol:protein length:373 DNA POLYMERASE III SUBUNIT BETA  ali model follow..  24  2MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVAL-------VQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNCMLFETEGEELRTVATDGHRLAVCSMPIGQSLP--SHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNE-KFRGVRLY-VSENQLKITANNPEQEEAEEILDVT-YSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMR.. 366
8 -100.0006ap4_A mol:protein length:388 DNA polymerase III subunit beta  ali model follow..  25  1MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNAQALTITGSDLEVELVASTALSE-----GACLEAGETTVPARKLMEICKSLPTAAIDLQITEDQRCILKSGNSRFVLGTLPAEDYPLLTTENSQTQVQVTQRELKRLFEKTAFAMAVQDVRFYLTGTLLEIDENQLRAVTTDGHRLALCEILASSTSSQ-LVQAIVPRKAVGELQRLLSIEDEQLTLLIGRELLNVTINTVRFTTKLIDGKFPDYRRVIPRGGDKHVLIGHDVFKQSLQRVAILSNE-KLRGVFLN-FNQDSLQLRANNPEQDEAIEDLAIQ-YQSAPLEMSFNAQYLLDVLGVLDGDDVNMSMTEANQSVLVQDPAHPDQTYVVMPMR.. 381
9 -100.0002avt_A mol:protein length:378 DNA polymerase III beta subunit  ali model follow..  38  2IQFSINRTLFIHALNTTKRAISTKNAIPILSSIKIEVTSTGVTLTGSNGQISIENTIPVSNENAG-LLITSPGAILLEASFFINIISSLPDISINVKEIEQHQVVLTSGKSEITLKGKDVDQYPRLQEVSTENPLILKTKLLKSIIAETAFAASLQESRPILTGVHIVLSNHKFKAVATDSHRMSQRLITLDNTSAD--FMVVLPSKSLREFSAVFTDDIETVEVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLISNATQNGTVKLE-ITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKAIKSETVKIHFLSPVRPFTLTPGDEESFIQLITPVRT. 377
10 -99.3002awa_A mol:protein length:390 DNA polymerase III, beta chain  ali model follow..  41  8IHFSINKNLFLQALNTTKRAISSKNAIPILSTVKIDVTNEGITLIGSNGQISIENFISQKNEDAG-LLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQNQIVLTSGKSEITLKGKDSEQYPRIQEISASTPLILETKLLKKIINETAFAASTQESRPILTGVHFVLQHKELKTVATDSHRLSQKKLTLEKNSDD--FDVVIPSRSLREFSAVFTDDIETVEIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSMERARLLSSATQNGTVKLE-IKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYLIDSLKALNSEKVTISFISAVRPFTLVPADDEDFMQLITPVRT. 383
11 -98.1001vpk_A mol:protein length:378 DNA polymerase III, beta subunit  ali model follow..  26  7MKVTVTTLELKDKITIASKALAKKSVKPILAGFLFEVKDGNFYICATDLETGVKATVNA-------AEISGEARFVVPGDVIQKMVKVLPDEITELSLEGDA-LVISSGSTVFRITTMPADEFPEITPAESGITFEVDTSLLEEMVEKVIFAAAKDEFMRNLNGVFWELHKNLLRLVASDGFRLALAEEQIEN---EEEASFLLSLKSMKEVQNVLDNTTETITVRYDGRRVSLSTNDVETVMRVVDAEFPDYKRVIPETFKTKVVVSRKELRESLKRVMVIASK-GSESVKFE-IEENVMRLVSKSPDYGEVVDEVEVQ-KEGEDLVIAFNPKFIEDVLKHIETEEIEMNFVDSTSPCQINPLDISGYLYIVMPIR.. 370
12 -94.5006deg_A mol:protein length:381 Beta sliding clamp  ali model follow..  30  3MRITVDRSQFFKSLGRVHRVVERRNTVPILSNVLIDAENGSVQLKATDLDLEVTESFTVN--------IEKAGAITVPAYLLYDIVRKLPDGSLSVDENQASAMSIVSGCTHFQLQCLPKIDFPESLPGQFGCRFFLSASKLKHLLDCTQFAISTEETRYYLNGIYFHIVHDKLRLVATDGHRLAQVDMEAPSGVDG-MPGVIIPRKAVGELQKLLSEEDGDVCIELSETKIRFSLGSVVFTSKLVDGTFPDYQRVIPLGNDRKLIVNRQDFSSAVDRVSTISND-RGRAVKLT-IEHGQLKLVVNNPDSGSAEDQLAAT-YTSEPLEIGFNSRYLLDIAGQLSSDEMVFMLSDAVAPALIRDNNNAEVLYVLMPVR.. 374
13 -94.3003p16_A mol:protein length:408 DNA polymerase III subunit beta  ali model follow..  25  13LTFRLLRESFADAVSWVAKNLPARPAVPVLSGVLLTGSDNGLTISGFDYEVSAEAQVGAE--------IVSPGSVLVSGRLLSDITRALPNKPVDVHVEGNR-VALTCGNARFSLPTMPVEDYPTLPTLPEE-TGLLPAELFAEAISQVAIAAGRDDTLPMLTGIRVEILGETVVLAATDRFRLAVRELKWSASSPDIEAAVLVPAKTLAEAAKAGIGGSDTGPGVGKDGLLGISGNGKRSTTRLLDAEFPKFRQLLPTEHTAVATMDVAELIEAIKLVALVADR--GAQVRME-FADGSVRLSAGADDVGRAEEDLVVD-YAGEPLTIAFNPTYLTDGLSSLRSERVSFGFTTAGKPALLRPVSGDDYVYLLMPVR.. 399
14 -93.9003t0p_A mol:protein length:371 DNA polymerase III, beta subunit  ali model follow..  30  2MKLICSKANLLKGVNIVSKAVPTRTTMAILECILIDASANEIKLMANDMELGIETIIDGT--------IEERGIIALDAKIFSEIVRKLPDNDVTIETDASFKTVISCEKAKFNIIGKSGDDFSYIPYVERNESIVLSQFTLKEVIRQTIFSIADNDNNKLMTGELFEIEENKLRVVSLDGHRISIRYIEMKNHYD--SKKVVVPGKTLQEISKIIGSADEDVVIYITNNHIVFEFENTTVVSRLIEGEYFKIDQMLSSDYDTKVRINKRELLDCIDRATLLVKEGDKKPIIMN-ITDGNMELRI-NSFIGSMNEDIDID-KDGKDIMIGFNPKFFIDALRVIDEEEVNLYMVNPKAPCFIKD-DEGKFIYLILPVNF. 366
15 -93.7006dlk_A mol:protein length:387 Beta sliding clamp  ali model follow..  26  4LKLIVETKTLVQSLGFASSVVEKRNVIPEYANIKLSAQDGNLELSSTNMDLYLSQKIAVQ--------VVSEGECTVSTKTLNDIVRKLPDSELTLTDLGTTGLEIKGKNCKFNLFTLPVSSFPAMDSINPEASFKISCTDFAKIIESTKFSISLDETRYNLNGVYLHIKDKEFCSASTDGHRLSISWVTLEKQIKN--FGVILPQKSAEEILKIVKDPNEDIEILLNSNKIKFICNNTIMLSKLIDGTFPDYSTFIPESSSSKLVINRKMFADSIERIAIITVE-KFRAVKLS-LSRETLEISAVGEARGNAKEVINSSYNSDESLAIGFNPQYLEDVLKAVKSDLVELYFSDVSAPVLIKFPENPKDIFVVMPVK.. 380
16 -93.5005w7z_A mol:protein length:387 DNA polymerase III subunit beta  ali model follow..  26  4LKLIVETKTLVQSLGFASSVVEKRNVIPEYANIKLSAKDGNLELSSTNMDLYLSQKIAVQ--------VVSEGECTVSTKTLNDIVRKLPDSELTLTDLGTTGLEIKGKNCKFNLFTLPVSSFPAMDSINPEASFKISCTDFAKIIESTKFSISLDETRYNLNGVYLHIKDKEFCSASTDGHRLSISWVTLEKQIKN--FGVILPQKSAEEILKIVKDPNEDIEILLSSNKIKFICNNTSMLSKLIDGTFPDYSTFIPESSSSKLVINRKMFADSIERIAIITVE-KFRAVKLS-LSRETLEISAVGEARGNAKEVINSSYNSDESLAIGFNPQYLEDVLKAVKSDVVELYFSDVSAPVLIKFPENPKDIFVVMPVK.. 380
17 -93.2004s3i_A mol:protein length:384 DNA polymerase III subunit beta  ali model follow..  21  3MKISVSKNDLENALRYLQAFLDKKDASSIASHIHLEVIKEKLFLKASDSDIGLKSYIFTQ-------SSDKEGVGTINGKKFLDIISCLKDSNIILETKDDS-LAIKQNKSSFKLPMFDADEFPEFPVIDPKVSIEVNAPFLVDAFKKIAPVIEQTSHKRELAGILMQFKHQTLSVVGTDTKRLSYTQLEKISIHSEEDISCILPKRALLEILKLF---YENFSFKSDGMLAVIENEMHTFFTKLIDGNYPDYQKILPKEYISSFTLGKEEFKESIKLCSSLSST-----IKLT-LEKNNALFESLDSEHSETAKTSVEIE-IEKAFHLGVNAKFFLEALNALGTTQFVLRCNEPSSPFLIQESLDEKISTLMMPIT.. 375
18 -92.2006man_A mol:protein length:387 Beta sliding clamp  ali model follow..  27  4LKVIVETKTLVQALGFASSVVEKRNIISELANIKLLAKDGLLELSSTNMDLYLSQKIGVQ--------VVSEGELTVSTKTLNDIVKKLPDSELTLTDLGTTGLEITGKNCRFNLFTLPVESFPVMDNINPEASFKISCAEFAKIIESTKFSVSLDETRYNLNGIYLHVKDSEFYAASTDGHRLSVSSVVLAEKIED--FGVILPQKSAEEILKIVKDSKNDIEILLSSNKIKFICNNVIMLSKLIDGTFPDYSSFIPENSSSKLVINRKIFADTIERIAIITVE-KFRAVKLS-LSGEALEISAIGEARGNAKEVINSS-KETENLDIGFNPQYLEDVLKAIKSDLVELYFSSVSAPVLIKFPESPKDIFVVMPVK.. 380
19 -91.7006DJK Entity 1(prereleased)  ali follow..  26  4LKLIVETKTLVQSLGFARSVVEKRNVIPEYANIKLSAKDGNLELSSTNMDLYLSQKIAVQ--------VLSEGEITVSTQTLSDIVRKLPDSELTLTELDIMKLEIKGQNCQFNLFTLPVSSFPAMDSIKPEVSFKISCADFAKIIESTKFSISLDETRYNLNGIYLHIKDKEFFAASTDGHRLSISWITLEEKIKN--FGVILPQKSAEEILKIVKDIHEDIEILLSSNKIKFICNNTILLSKLIDGTFPDYSAFIPKSSISKLVINRKIFADSIERIAIITVE-KFRAIKLS-LSRKTLEISAVGEARGNAKEIITASYNCDESLVIGFNPQYLEDVLKAVKSNLVELYFSDASAPVLIKFPQNPKDIFVIMPVK.. 382
20 -91.7006d46_A mol:protein length:389 Beta sliding clamp  ali model follow..  26  4LKLIVETKTLVQSLGFARSVVEKRNVIPEYANIKLSAKDGNLELSSTNMDLYLSQKIAVQ--------VLSEGEITVSTQTLSDIVRKLPDSELTLTELDIMKLEIKGQNCQFNLFTLPVSSFPAMDSIKPEVSFKISCADFAKIIESTKFSISLDETRYNLNGIYLHIKDKEFFAASTDGHRLSISWITLEEKIKN--FGVILPQKSAEEILKIVKDIHEDIEILLSSNKIKFICNNTILLSKLIDGTFPDYSAFIPKSSISKLVINRKIFADSIERIAIITVE-KFRAIKLS-LSRKTLEISAVGEARGNAKEIITASYNCDESLVIGFNPQYLEDVLKAVKSNLVELYFSDASAPVLIKFPQNPKDIFVIMPVK.. 382
21 -91.1005ah2_A mol:protein length:401 DNA POLYMERASE III SUBUNIT BETA  ali model follow..  27  15LKFRVVREDFADAVAWVARSLPTRPTIPVLAGVLLTGTDEGLTISGFDYEVSAEVKVSAE--------IASAGSVLVSGRLLSDITKALPAKPVEVSVEGTR-VSLTCGSARFSLPTLAVEDYPALPALPEE-TGVIASDLFAEAIGQVAVAAGRDDTLPMLTGIRVEISGESVVLAATDRFRLAVRELTWVTTAGDVEAAVLVPAKTLAEAAKAGTDGNQSGASVGKDGLLGIRSEGKRSTTRLLDAEFPKFRQLLPAEHTAVATIGVAELTEAIKRVALVADR--GAQIRME-FSDDTLKLSAGADDVGRAEEDLPVD-FAGEPLTIAFNPTYLTDGLGSLHSERVTFGFTTPSRPAVLRPAGEDDYVYLLMPVR.. 398
22 -90.6005wce_A mol:protein length:379 DNA polymerase III subunit beta  ali model follow..  27  2MKLTIERAALLKALGHVQSVVERRNTIPILSNILLSAEGDRLSFSATDLDMEIIDEGFAQ--------IDVPGQITAPAHTLYEIVRKLPDGDVSLSFSDDPRLVIQAGRSRFNLPVLPAGDFPVMSSDGLSSRIAVDTNELIRLIDKTRFAISTEETRYYLNGLYVHTGETKLRAVATDGHRLALAEMPAPEGAVG-IPGVIVPRKTIAEARRLMESAGETVDLQVSPQKVRFEFGAAALTSKVIDGAFPDYMRVIPRDNAKILTLDNDLFAKAVDRVATISAE-KSRSVKLA-VEPGRITLTVRNMEAGQAVEEVEVD-YDGEPFEIGFNARYLLDVCGQIAGPQAEFRFADPASPTLVVDPVDPGVKYVLMPLR.. 372
23 -89.0006d47_A mol:protein length:410 Beta sliding clamp  ali model follow..  25  15LKFRLVRESFADAVSWVAKNLPTRPAVPVLSGVLLTGSDEGLTISGFDYEVSAEVRVPAE--------IASPGTVLVSGRLLSDITRALPNKPVDFYVDGNR-VALTCGNARFSLPTMAVEDYPTLPTLP-EDTGTLPAELFSEAIGQVAIAAGRDDTLPMLTGIRVEISGEKVVLAATDRFRLAVRELTWNALSPDIEAAVLVPAKTLGEAAKANTDGSEAGMGVGKDGLLGISGDGKRSTTRLLDAEFPKFRQLLPAEHTAVASADVAELTEAIKLVALVAD--RGAQVRME-FADGMLRLSAGADDVGRAEEDIAVE-FAGQPLTIAFNPTYLIDGLASLHSERVSFGFTTPGKPALLRPASAEDYVYLLMPVR.. 401
24 -84.1004trt_A mol:protein length:368 DNA polymerase III subunit beta  ali model follow..  24  2MKANVTKKTLNEGLGLLERVIPSRSSNPLLTALKVETSEGGLTLSGTNLEIDLSCFVPAE--------VQQPENFVVPAHLFAQIVRNLGGELVELELSGQE-LSVRSGGSDFKLQTGDIEAYPPLSFPAQA-DVSLDGGELSRAFSSVRYAASNEAFQAVFRGIKLEHHGESARVVASDGYRVAIRDFPASGD----GKNLIIPARSVDELIRVLKDGE--ARFTYGDGMLTVTTDRVKMNLKLLDGDFPDYERVIPKDIKLQVTLPATALKEAVNRVAVLADKNANNRVEFL-VSEGTLRLAA-EGDYGRAQDTLSVTGGTEQAMSLAFNARHVLDALGPIDGD-AELLFSGSTSPAIFRAVGGGGYMAVMVTLR.. 361
25 -17.5001rwz_A mol:protein length:245 DNA polymerase sliding clamp  ali model follow..  14  1............................................................................................................................................MIDVIMTGELLKTVTRAIVALVSEARIHFLEKGLHSRAVDPANVAMVIVDIPKDS-DEEKTIGVDMDRIFDISKSISTKDLVELIVEDESTLKVKFGSVEYKVALIDPSAIRKEPRIPEELPAKIVMDAGEFKKAIAAADKISDQ-----VIFRSDKEGRIEAKGDVDSIVFHMTETELIEFNGGEARSMFSVDYLKEFCKVAGSGDLLTIHLGTNYPVRLVVGGRAKVEYILAP.... 240
26 -14.0001b77_A mol:protein length:228 PROTEIN (SLIDING CLAMP)  ali model follow..  10  17.................................................................................................................................................................INSGILLSQGKFIMTRAVNGTTYAEANISDEIDFD---NSFLSILSLVSDDAEISMHTDGNIKIADTRSTVYWPAADKSTIV------FPNKPIQFP-VASVITEIKAEDLQQLLRVSRGLQIDT----IAITNKDGKIVINGYNKVEDSGLTRPKYSLTLTDYDGSNNFNFVINMANMKIQPGN-YKVMLWGAGDKVAAKFESSQVSYVIAMEADS. 224
27 -13.6003k4x_A mol:protein length:798 Proliferating cell nuclear antigen  ali model follow..  13  408STLSLPSSEFSKIVRDLSQLSDS---------INIMITKETIKFVADGDIGSGSVIIKEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSSDRVGIRLSSEAPALFQFDLKSGFLQFFLA---PKFNDEGSNSQASNSGALEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEA-DHPVTLGMDLTSLSKILRCGNNTDTTLIADNTPDSIILLFEDAEYSLKLMDID-ADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDS-TKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPK... 793
28 -13.2003hi8_A mol:protein length:247 Proliferating cell nuclear antigen PcnA  ali model follow..  11  1............................................................................................................................................MFKAIVSAATLRDALDSVSVLVDECKIRLNEESLSIRAVDPANVGMVDLTLDAAAFESGGVIGVNLSRLEEVAGMAGAGDLHLTLDEETRKLNIRIDGLSYTLALIDPDSIRQEPDIPDDLAANIVLEGTHLDRGIKAADMVSDH-----IRLRVDGAEETFHIEAEGDTDDVDPPADLISIEAGAADSLFSLDYLKDMNKAIPDAEVTVELGEE-FPVKLHAEGMGTITYMLAP.... 242
29 -12.5006aig_A mol:protein length:263 DNA polymerase sliding clamp 1  ali model follow..  14  1.....................................................................................................................MSSEATLDSEFTDYKAMFRYEAKVFKELVDSV---------SKILDEGLFIITGEGLRLRGMDPARVALVDIEIPSSSDVERVELGVNMETLKGVVARAKKGDQEVRVREDKVLFIVESVVLRRYLLPNLEVIVDVPEDISLEFDATATVIADVVKKTLRDVELVGDI-----VEFDA-GEDYLSIRSVGPERRRVETRLTRESPAKEPATSRYDVGYLKRMLGVAKAESIELSFSTD-KPLKMV-PDGSRVTYLLAP.... 260
30 -11.3003aix_A mol:protein length:246 DNA polymerase sliding clamp C  ali model follow..  11  4...............................................................................................................................................KVIDADAFSYIFRTLEEFIDEITLDFTSDGLKIRGIDPSRVTFIDILIPAGY-EKEEKVGVKLEDFTDVLKTVTKNDSYLETDENQNIKVTLDGVYERTFTFPSIVASEIETPNLNEFPFKAKALTVTFTDIIDEIEDIGGDS----ITFKAEGGKLYLSANSDMGSSTITENGGLLESEGGDAESVYGLEYVVNTSKMRKSDTVEIAFGSQ-IPLKLR-PQGGYADFYIAP.... 243
31 -11.1002hii_A mol:protein length:257 PCNA1 (SSO0397)  ali model follow..  12  6................................................................................................................................................YPNAKDFFSFINSITNVTDSIILNFTEDGIFSRHLTEDKVLMAIMRIPKDV-DSPTSVKLDVSSVKKILSKASSKKATIELTETDSGLKIIIRDSTIYIKAEKGQVEQLT-EPKVNLAVNFTTDESVLNVIAADVTLVGEE-----MRIST-EEDKIKIEAGEEGKRYVAFLMKDKPLKDTSASSSYSAEMFKDAVKGLRSAPTMVSFGEN-LPMKID-VSGGHMIFWIAP.... 247
32 -10.9005a6d_A mol:protein length:249 DNA POLYMERASE SLIDING CLAMP  ali model follow..  16  1MPFEIVFDG-AKEFADLIATASN-----LIDEAAFKITEEGVSMRAMDPSRVVLIDLNLPESIFSKYEVEEPETIGINMDHFKKILKRGSKDTLILRKGDENFLEITFEGTAKRTFRLPLID-LELPELPFTAKVVLLGEVLKEAIKDASLVSDS---------LKFIAKEDEFTMKAEGE-KLTLEDEGLLDLEVEEETRSAYGISYLADMVKGIGKADE-VTLRFGTEMMDYFIRDEGKLTFLLAPRVEE............................................................................................................................... 249
33 -10.9002io4_B mol:protein length:246 DNA polymerase sliding clamp C  ali model follow..  13  5...............................................................................................................................................KVIDAVSFSYILRTVGDFLSEANFIVTKEGIRVSGIDPSRVVFLDIFLPSSYSQEKEIIGFKLEDVNDILKRVLKDDTILSSNESKLTLTFDGEFTRSFELPLIQVESTQPPSVNLEFPFKAQLLTITFADIIDELSDLGEV-----LNIHSKENKLYFEVIGDLSTAKVEDNGTLLEASGADVSSSYGMEYVANTTKMRRSDSMELYFGSQ-IPLKLR-PQEGYGDFYIAP.... 243
34 -10.7001ge8_A mol:protein length:249 PROLIFERATION CELL NUCLEAR ANTIGEN  ali model follow..  13  1MPFEIVFEG-AKEFAQLIDTASK-----LIDEAAFKVTEDGISMRAMDPSRVVLIDLNLPSSIFSKYEVVEPETIGVNLDHLKKILKRGAKDTLILKKGEENFLEITIQGTATRTFRVPLID-VDLPELPFTAKVVVLGEVLKDAVKDASLVSDS---------IKFIARENEFIMKAEGE-KLTLEDEGLLDIEVQEETKSAYGVSYLSDMVKGLGKADE-VTIKFGNEMMEYYIRDEGRLTFLLAPRVEE............................................................................................................................... 249
35 -10.7002hii_C mol:protein length:252 PCNA3 (SSO0405)  ali model follow..  13  4...............................................................................................................................................VYDDVRVLKDIIQALARLVDEAVLKFKQDSVELVALDRAHISLISVNLPREM-NDEFKFGFNTQYLMKILKVAKRKEAEIASESPDSVIINIIGSTNREFNVRNLEVSEQEIPEINQFDISATISSDGFKSAISEVSTVTDN-----VVVEG-HEDRILIKAEGESEVEVEFSKDTGGLQSKESKNSYSAEYLDDVLSLTKSDYVKISFGNQ-KPLQLF-EGGGKVTYLLAP.... 242
36 -10.6002ix2_C mol:protein length:259 DNA POLYMERASE SLIDING CLAMP A  ali model follow..  13  22..................................................................................................................................................DVRVLKDIIQALARLVDEAVLKFKQDSVELVALDRAHISLISVNLPREM-NDEFKFGFNTQYLMKILKVAKRKEAEIASESPDSVIINIIGSTNREFNVRNLEVSEQEIPEINQFDISATISSDGFKSAISEVSTVTDN-----VVVEG-HEDRILIKAEGESEVEVEFSKDTGGLQSKESKNSYSAEYLDDVLSLTKSDYVKISFGNQ-KPLQLF-EGGGKVTYLLAP.... 257
37 -10.5003lx1_A mol:protein length:255 DNA polymerase sliding clamp 1  ali model follow..  13  9..................................................................................................................................................GAKEFADLIATASNLIDEAAFKFTEEGISMRAMDPSRVVLIDLNLPESI-EEPETIGINMDQFKKILKRGKAKDTLILRKGDENFLEITFEGTAKRTFRLPLIDVEELEL-ELPFTAKVVLLGEVLKEGIKDASLVSDA-----IKFIAKENEFTMKAEGETNEVEIRLTLEDEGLLEEETKSAYGIRYLSDMVKGIGADEVILRFGNE-MPLQME-RDEGRLTFLLAP.... 245
38 -10.3001ud9_A mol:protein length:245 DNA polymerase sliding clamp A  ali model follow..  12  4...............................................................................................................................................VYDDVRDLKAIIQALLKLVDEALFDIKPEGIQLVAIDKAHISLIKIELPKEM-PEEFKFGFNTQYMSKLLKAAKRKEEIIDADSPEVVKLTLSGALNRVFNVNNIEVLPPEVPEVNEFDIKATINASGLKNAIGEIAEVADT-----LLISG-NEEKVVVKGEGENKVEVEFSKDTGSLANKESSSAYDVEYLNDIISLTKSDYVKVAFADQ-KPMQLE-EGGGKVTYLLAP.... 242
39 -10.2003aix_B mol:protein length:248 DNA polymerase sliding clamp B  ali model follow..  11  5...............................................................................................................................................TYSSAKDFYSLLSGLLKVTDEIILNFTEDSIFSRYLTDDKVLMVIFKIPKEY-DKPLGIKININDLKKILGKAKSKSATVTLEETEAGLKVTV-RSNIYIKGEKTSIDQLT-EPKVNLSVTFTTDGDVLKDIARDLSLVGEE-----VEISA-DENTVTLSTEEAGRTYKSLLKQDKPLKESPSKAVYSIEVLKDVFKVTSSQNVTVGFGNN-IPMKIE-DSGGQLIFWIAP.... 246
40 -10.1005tup_A mol:protein length:259 Proliferating cell nuclear antigen  ali model follow..  12  6...............................................................................................................................................RLEQASLLKRVVDAIKDLVQDCNFDCNDSGIALQAMDNSHVALVSMLLKAEG-DRNIALGINLVSLTKVLRAAQNEDITLKADDSPDAVNLMFESSEYDIKLMDIDQEHLA-IPETEYAATVEMPSAEFQRICRDLNALSES-TKEGVKFSCQGDIGSGSVTIRQHTSVDKPEQNVSIALSEPVALTFSLKYLVNFCKATSSSKVTLCLSQEVPLLVEYGLGSGHLRFYLAP.... 253
41 -10.0003lx2_A mol:protein length:259 DNA polymerase sliding clamp 2  ali model follow..  13  9..................................................................................................................................................SAREFESLIATLEKFFDEAVFQVNMEGIQMRAIDPSRVVLVDLNLPEML-ESEEAIAFDLKRFLKVLKLARSRDTVLRKGGENFLEVGLLGDENTWFKLPLIDANTPEIEIPSPWTVKAVVLAGALKRAVKAAKLVSDSIYFMATPEKLTFKAEGNDSEVRTVLTMEDPGLLDLEHKMTKAKSAYGVAYLEDILRSLAADEVIIRFGFD-IPLLLK-RDAGEVSFLIAP.... 246
42 -10.0005jne_D mol:protein length:258 Proliferating cell nuclear antigen  ali model follow..  12  5...............................................................................................................................................KFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEA-DHPVTLGMDLTSLSDILREGNNTDTTLIADNTPDSIILLFEDAEYSLKLMDIDADFLG-IEELQYDSTLSLPSSEFSKIVRDLSQLSDS-TCETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSSDRVGIRLSSEAPALFQFDLKSGFLQFFLAP.... 252
43 -10.0003g65_A mol:protein length:296 Cell cycle checkpoint control protein RAD9A  ali model follow..  13  2.....................................................................................................................................KCLVTGGNVK-VLGKAVHSLSR-----IGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLPGQDLLRCKILMKSFLSVFRSLAMLEKCISLNGRSSRLVVQLHCKFGVRKTHNLSFQDCESL-PASCPHMLRAPARVLGEAVLPFSPALAE-----VTLGIGRGRRVILRSYHEEEADSTAKAMVTEMCQEGVAITFCLKEFRGLLSFAENLNLSIHFDAPGRPAIFTIKDSLLDGHFVLATLS. 266
44 -9.9004yhr_A mol:protein length:266 Proliferating cell nuclear antigen  ali model follow..  12  7...............................................................................................................................................KFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEA-DHPVTLGMDLTSLSKILRCGNNTDTTLIADNTPDSIILLFKDRIAEYSLKLMDIDADFLKIEEQYDSTLSLPSSEFSKIVRDLSQLSDS-TKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSSDRVGIRLSSEAPALFQFDLKSGFLQFFLAP.... 254
45 -9.8803p91_A mol:protein length:265 Proliferating cell nuclear antigen  ali model follow..  14  10...............................................................................................................................................KFKEAALFKRVVESLKSTIDKTNFDCSDAGIAVQCMDNSHVSLVSLLIETDA-LKPITLGINLTHLSKILKALDNDCGILDVKKVDDAVLSITSEGTNKTMKFGLNLVDIEAIPELQSDAIITLSSAEFLKITKDFSALGDDSGCTKNEVTLTTKGAMCETCMTLSALENVDSNGLQIEHNKDVTASFALKQISEFAKSAPADNVKLSLSGQAPLIMEFKGEACVLKFYLAP.... 255
46 -9.8306e49_A mol:protein length:272 Proliferating cell nuclear antigen  ali model follow..  12  13...............................................................................................................................................KFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEA-DHPVTLGMDLTSLSKILRCGNNTDTTLIADNTPDSIILLFKDRIAEYSLKLMDIDADFLKIEEQYDSTLSLPSSEFSKIVRDLSQLSDS-TKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSSDRVGIRLSSEAPALFQFDLKSGFLQFFLAP.... 260
47 -9.4301sxj_F mol:protein length:283 Proliferating cell nuclear antigen  ali model follow..  12  24...............................................................................................................................................KFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEA-DHPVTLGMDLTSLSKILRCGNNTDTTLIADNTPDSIILLFKDRIAEYSLKLMDIDADFLKIEEQYDSTLSLPSSEFSKIVRDLSQLSDSTKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMD-QPVDLTFGAKYLLDIIKGSSSDRVGIRLSSEAPALFQFDLKSGFLQFFLAP.... 271
48 -9.2905zut_A mol:protein length:289 Proliferating cell nuclear antigen  ali model follow..  12  5...............................................................................................................................................KFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEA-DHPVTLGMDLTSLSKILRCGNNTDTTLIADNTPDSIILLFKDRIAEYSLKLMDIDADFLKIEEQYDSTLSLPSSEFSKIVRDLSQLSDS-----INIMITKETIKFVADGDIGSGSVIIKPFVDMEHDQPVDLTFGAKYLLDIIKGSSSDRVGIRLSSEAPALFQFDLKSGFLQFFLAP.... 252
49 -9.2002zvw_A mol:protein length:275 Proliferating cell nuclear antigen 2  ali model follow..  15  22.........................................................................................................................................QGSLLKKVLEAV---------KDLVNDANFDCSTTGFSLQAMDSSHVALVSLLLRSEG-DRNLSMGMNLGNMSKMLKCAGNDDITIKADDGSDTVTFMFESADFEMKLMDIDSEHLG-IPDAEYHSIVRMPSGEFSRICKDLSSIGDT-TKEGVKFSTAGDIGTANIVLRQNTTVDKPEDAIVIEMNEPVSLSFALRYMNSFTKATPSETVTISLSSELPVVVEYKVAEMGYIYYLAP.... 267
50 -9.1705hac_A mol:protein length:300 Proliferating cell nuclear antigen  ali model follow..  10  10LEAQVQF---ASLWKRLVECING-----LVNEANFDCNPGGLSVQAMDSSHVALVHMLLRDDCFVKYQCGRNSILGLNLASLSKVLKIVSNDSLSLRHDDDS--------------------------------------------DVVTLTSENPEKT--------RKCEYQLKLLEIEAESMGIPEMDYRS-------TVTLNSAEFAKIVRDMQVFGDTVTIAISKEGVKFSS----------SGDVGQGYTFLQAAGVSDRSTKSEVKAEVKAEARDDDEEPLSRKYGKADSSANAIGVEVTM----------------EEPITLSFALRFMGIFAKGSTSERVTLKFAKD-SPCMVE-DNVGYLRYYLAP.... 294

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.