current user: public

If you have questions about the server, please let us know.

Query: gi|30260203|ref|NP_842580.1|(removed signalp:1-28) D-alanyl-D-alanine carboxypeptidase (BA_0009) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .
# Score Template Links and tools%idFirst ETGSALNIEAGAAILVEANSGKILYQKNADELLSIASMTKMMSEYLVHEAVDKGKFKWDQKIKVSEYAYKVSQDASLSNVALENGGSYTVKELYEAMAIFSANGATIALAEAIAGKEVDFVKMMNDKSKELGLKNYKFVNSTGLTNKDLKGMHPEGTTADEENKMSAKDVATLAQHLIKDYPKVLDTAKIPKKEFRPEKEKFAMSNWNWMLKGLVKEYDGVDGLKTGSTPEAGDCFTGTVERNGMRFISVVIKTSSHTARFDETKKLYDYGFANFEMKQMYKKGSSVKGQETVRVENAKDKDVAVQTKQAISLPVPKGSKEVYKTELKESSKGQEAPIKKGAALGQMVITPKDTNDPGFLTGKSLQVDLVTTSEVEEANWFTRAMRGIGSFFSGIWNSAVDTVKGWFLast
1 -107.0001xp4_A mol:protein length:379 D-alanyl-D-alanine carboxypeptidase  ali model follow..  37  6.VAQDFTIAAKHAIAVEANTGKILYEKDATQPVEIASITKLITVYLVYEALENGSITLSTPVDISDYPYQLTTNSEASNIPME-ARNYTVEELLEATLVSSANSAAIALAEKIAGSEKDFVDMMRAKLLEWGIQDATVVNTTGLNNETLGDNIYPGSKKDEENKLSAYDVAIVARNLIKKYPQVLEITKKPSSTFAG----MTITSTNYMLEGMPAYRGGFDGLKTGTTDKAGESFVGTTVEKGMRVITVVLNADHQDARFTATSSLMDYISSTFTLRKIVQQGDAYQD-SKAPVQDGKEDTVIAVAPEDIYLIERVGNQSSQSVQFTPDSKAIPAPLEAGTVVGHLTYEDKDLIGQGYITTERPSFEMVADKKIEK.............................. 379
2 -104.0001hd8_A mol:protein length:363 PENICILLIN-BINDING PROTEIN 5  ali model follow..  29  9.IPGVPQIDAESYILIDYNSGKVLAEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGNDAWATGNPKGSSLMFLKPGMQVPVSQLIRDINLQSGNDACVAMADFAAGSQDAFVGLMNSYVNALGLKNTHFQTVHGLD--------------ADGQYSSARDMALIGQALIRDVPNEYSIYKEKEFTF----NGIRQLNRNGLLWD---NSLNVDGIKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGREAESKKLLTWGFRFFETVNPLKVGKEFA---SEPVWFGDSDRASLGVDKDVYLTIPRGRMKDLKASYVLNSSELHAPLQKNQVVGTINFQLDGKTI--------EQRPLVVLQEIPEGNFGDPVID..................... 363
3 -104.0003it9_A mol:protein length:352 D-alanyl-D-alanine carboxypeptidase dacC  ali model follow..  32  4QTVEAPSVDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWATGNPAGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTFQTVHGLD--------------APGQFSTARDMALLGKALIHDVPEEYAIHKEKEFTF----NKIRQPNRNRLLWS---SNLNVDGMKTGTTAGAGYNLVASATQGDMRLISVVLGAKTDRIRFNESEKLLTWGFRFFETVTPIKPDATFV---TQRVWFGDKSEVNLGAGEAGSVTIPRGQLKNLKASYTLTEPQLTAPLKKGQVVGTIDFQLNGKSI--------EQRPLIVMENVEEGG............................ 352
4 -103.0004drt_A mol:protein length:361 de novo designed serine hydrolase, OR89  ali model follow..  27  10.IPGVPQIDAESYILIDYNSGKVLAEQNADVRRDPALLAHMMTSYVIGQAMKAGKFKETDLVTIGNDAWATGNPKGASLMFLKPGMQVPVSQLIRGINLQDGADAAVAMADFAAGSQDAFVGLMNSYVNALGLKNTHFQTVSGGD--------------ADGQYSSARDMALIGQALIRDVPNEYSIFKEKEFTF----NGIRQLNRNGLLWD---NSLNVDGIMTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGREAESKKLLTWGFRFFETVNPLKVGKEFA---SEPVWFGDSDRASLGVDKDVYLTIPRGRMKDLKASYVLNSSELHAPLQKNQVVGTINFQLDGKTI--------EQRPLVVLQEIPEGNFGD......................... 360
5 -103.0005j8x_A mol:protein length:387 D-alanyl-D-alanine carboxypeptidase DacA  ali model follow..  29  26.IPGVPQIDAESYILIDYNSGKVLAEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGNDAWATGNPKGSSLMFLKPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNSYVNALGLKNTHFQTVHGLD--------------ADGQYSSARDMALIGQALIRDVPNEYSIYKEKEFTF----NGIRQLNRNGLLWD---NSLNVDGIKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGREAESKKLLTWGFRFFETVNPLKVGKEFA---SEPVWFGDSDRASLGVDKDVYLTIPRGRMKDLKASYVLNSSELHAPLQKNQVVGTINFQLDGKTI--------EQRPLVVLQEIPEGNFFGKIIDC.................... 381
6 -103.0005tr7_A mol:protein length:341 D-alanyl-D-alanine carboxypeptidase  ali model follow..  30  1..PDAPQIAAKGYVLMDYHSGKVLAEKEMDTKLSPASLTKMMTSYVIGQEVKRGNISLNDDVVISKNAWAKNF-PDSSKMFVEVGTTVKVSDLNRGIIIQSGNDACVAMAEHVAGTEDAFVDLMNAWASSLGMKNSHFTNSHGLD--------------DPNLYSTPYDLALLGQALIRDVPEEYAIYSEQKFTY----NGITQYNRNGLLWD---KSMNVDGIKTGHTSGAGYNLVSSATEGNMRLVAVVMGTDNENARKAESKKLLSYGFRFFETVAPHKAGETFV---NETIWMGDKDTIALGVDKDTYVTLPRGQAKDLTASFVLEKQ-LKAPLKKGDIVGTLYYQLAGNDI--------AQYPLLALEDVQE.............................. 341
7 -102.0003a3j_A mol:protein length:344 PBP5  ali model follow..  31  1.GVTPPQITAQTYVLMDYNSGAILTALNPDQRQYPASLTKMMTSYVVGVALKQGKIHNTDMVTIGESAWGRNF-PDSSKMFLDLNTQVSVADLNRGVIVVSGNDATVALAEHISGNVPNFVETMNKYVQQFGLKNTNFTTPHGLD--------------DPNQYSSARDMAIIGAHIIRDLPEEYKIYSEKDFTF----NKIKQPNRNGLLWD---KTINVDGMKTGHTSQAGYNLVASATSNNMRLISVVMGVPTYKGREVESKKLLQWGFANFETFKTLEAGKEIS---EQRVYYGDKNSVKLGAFMDHFITIPKGKQSEVKARYELADKNLQAPLAKGQVIGKVVYALDGKDI--------ASANLQVMNDVGE.............................. 344
8 -102.0004k91_A mol:protein length:346 D-ala-D-ala-carboxypeptidase  ali model follow..  31  6.VPAPPQLAAKSYVLMDGESGQVLVENNGDQRLPPASLTKLMTAYIATKEIEAGRIGENDLVTVSEHAWRTGG----SRMFIKVGSQVSVSDLLHGIIIQSGNDASVALAEHIAGSEDAFADMMNTTAQKLGLTNSHFMDATGLP--------------NPDHYSSARDMAVLARAIIYGEPSHYAIYAQKEFLW----NNIKQPNRNLLL----WRDKTVDGLKTGHTDEAGYCLVASAVRDGQRMIAVVFGTNSEQARAAETQKLLTYGFRFFESRNFYKKGTELT---KGLVWKGSEHEVKAGLAEDLTMTLPRGQMQKLQASMVLEPQ-LMAPIQQGQVIGKVEVKLDDKVI--------RSADLVALNAVEEGGF........................... 346
9 -102.0003hum_A mol:protein length:453 Penicillin-binding protein 4  ali model follow..  25  56.YAGLSAAYEPTSAVNVSQTGQLLYQYNIDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVTMTNKEYIMSTLPELSNTKLYPGQVWTIADLLQITVSNSSNAAALILAKKVSKNTSDFVDLMNNKAKAIGMKNTHFVNPTGAENSRLRSFAPTKYKDQERTVTTARDYAILDLHVIKETPKILDFTKQLAPTTHA----VTYYTFNFSLEGAKMSLPGTDGLKTGSSDTANYNHTITTKRGKFRINQVIMGAGDEKQRNMMGNALMERSFDQYKYVKILSKGEQRI---NGKKYYVE---------NDLYDVLPSDFSKKDYKLVVEDGK-VHADYPRNKDYGPPTVEVHQPII--------QKANTVAKSMWEEHPLFTIIGGTCLVAGLALIVHMI....... 438
10 -101.0005fsr_A mol:protein length:375 D-ALANYL-D-ALANINE CARBOXYPEPTIDASE DACD  ali model follow..  28  23.SPQPPEIHAGSWVLMDYTTGQILTAGNEHQQRNPASLTKLMTGYVVDRAIDSHRITPDDIVTVGRDAWAKDNPVGSSLMFLKEGDRVSVRDLSRGLIVDSGNDACVALADYIAGGQRQFVEMMNNYAEKLHLKDTHFETVHGLD--------------APGQHSSAYDLAVLSRAIIHGEPEFYHMYSEKSLTW----NGITQQNRNGLLWD---KTMNVDGLKTGHTSGAGFNLIASAVDGQRRLIAVVMGADSAKGREEEARKLLRWGQQNFTTVQILHRGKKVG---TERIWYGDKENIDLGTEQEFWMVLPKAEIPHIKAKYTLDGKELTAPISAHQRVGEIELYDRDKQV--------AHWPLVTLESVGEG............................. 369
11 -100.0001tvf_A mol:protein length:369 penicillin binding protein 4  ali model follow..  27  26.YAGLSAAYEPTSAVNVSQTGQLLYQYNIDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVTMTNKEYIMSTLPELSNTKLYPGQVWTIADLLQITVSNSSNAAALILAKKVSKNTSDFVDLMNNKAKAIGMKNTHFVNPTGAENSRLRSFAPTKYKDQERTVTTARDYAILDLHVIKETPKILDFTKQLAPTTHA----VTYYTFNFSLEGAKMSLPGTDGLKTGSSDTANYNHTITTKRGKFRINQVIMGAGDEKQRNMMGNALMERSFDQYKYVKILSKGEQRI---NGKKYYVENDLYDVLSKKDYKLVVEDGKVHADYPREFINKD-YGPPTVEVHQ................................................................ 369
12 -89.3003mfd_A mol:protein length:334 D-alanyl-D-alanine carboxypeptidase dacB  ali model follow..  27  1.SNAAIDVSAKSAIIIDGASGRVLYAKDEHQKRRIASITKIMTAVLAIE-----SGKMDQTVTVSANAVRTEG----SAIYLTEGQKVKLKDLVYGLMLRSGNDAAVAIAEHVGGSLDGFVYMMNQKAEQLGMKNTRFQNPHGLDDH-------------ENHYSTAYDMAILTKYAMKL-KDYQKISGTKIYKAETMES--VWKNKNKLLT---MLYPYSTGGKTGYTKLAKRTLVSTASKDGIDLIAVTINDPN---DWDDHMKMFNYVFEHYQTYLIAKKGD-------IPKLKGTFYESKAFIKRDITYLLTEEEKENVKINTTL-LKPKKAWEKDASKVGHMEIMFNDATIA--------KVPIYYENERHQ.............................. 333
13 -86.0005zqa_A mol:protein length:276 Lmo2812 protein  ali model follow..  35  21.EQPNLYLSANAAAVYSVENGEALYEQNADKVMPIASLSKLMTAFLVLEAVDNNELSWDEKLDLVRLDDPSAV----SLYAITQKRTWSVRDLYSAMLTMSANDAAETLGDRLDGAD--FPKEMNNQAKKLGMSSTTFVSASGLDVD------------GKSAVSTTKDLFLLSSKLISTHPEVLETTSKPTVTTD---KGAKLESTNDLLG----SIQGLDGLKTGFTDEAGYCFIGTAERGGKRVISIVLDAGTAEKRFKDTEKLMEVGFKE..................................................................................................................................... 269
14 -82.1001es2_A mol:protein length:262 DD-TRANSPEPTIDASE  ali model follow..  25  2...TKPTIAAVGGYAMNNGTGTTLYTKAADTRRSTGSTTKIMTAKVV---LAQSNLNLDAKVTIQKAYSDYVVANNASQAHLIVGDKVTVRQLLYGLMLPAGCDAAYALADKYAARVKSFIGKMNTAATNLGLHNTHFDSFDGIG--------------NGANYSTPRDLTKIASSAMKN-STFRTVVKTKAYTAKTVTKTDTWKNTNGLL----SSYSGAIGVKTGSGPEAKYCLVFAATRGGKTVIGTVLASTSIPARESDATKIMNYGFA...................................................................................................................................... 261
15 -80.4006azi_A mol:protein length:285 D-alanyl-D-alanine endopeptidase  ali model follow..  22  10TAAAQPQIASGSAMIVDLNTNKVIYASHPDLVRPIAXITKLMTAMVVLDA----HLPLDEKLKVDISHTP---EMKGVYSRVRLNSEISRKNMLLLALMSSENRAAASLAHHYPGGYDAFIRAMNAKAKALGMNNTRFVEPTGL---------------SIHNVSTARDLTKLLIASKQ-YPLIGQLSTTREEMATNPAYTLPFRNTNHLVYR---ENWNIQLTKTGFTNAAGHCLVMRTVFNGKPVALVVMDAFGKYTHFADASRLRTWIETGKVQPVPAAALTYKK---QKAEQMATAQN......................................................................................................... 284
16 -74.4004p0m_A mol:protein length:276 D-alanyl-D-alanine carboxypeptidase  ali model follow..  21  10GSVPIPDGPAQTWIVADLDSGQVLAGRDQNVAHPPASTIKVLLALVALD-----ELDLNSTVVADVADTQAEC----NCVGVKPGRSYTVRQLLDGLLLVSGNDAANTLAHMLGGQD-VTVAKMNAKAATLGATSTHATTPSGLDGP------------GGSGASTAHDLVVIFRAAMAN-PVFAQIIAEPSAMFPSDDGEQLIVNQDELL----QRYPGAIGGKTGYTNAARKTFVGAAARGGRRLVIAMMYGEGGPTYWDQAATLFDWGFALNPQASVDSLGS.......................................................................................................................... 270
17 -73.6004rye_A mol:protein length:269 D-alanyl-D-alanine carboxypeptidase  ali model follow..  20  11GSVPIPDGPAQTWIVADLDSGQVLAGRDQNVAHPPASTIKVLLALVALD-----ELDLNSTVVADVADTQAEC----NCVGVKPGRSYTARQLLDGLLLVSGNDAANTLAHMLGGQD-VTVAKMNAKAATLGATSTHATTPSGLDGP------------GGSGASTAHDLVVIFRAAMAN-PVFAQITAEPSAMFPSDNGEQLIVNQDELL----QRYPGAIGGKTGYTNAARKTFVGAAARGGRRLVIAMMYGEGGPTYWDQAATLFDWGFALNPQASVGS............................................................................................................................. 268
18 -72.0004ppr_A mol:protein length:334 Penicillin-binding protein DacB1  ali model follow..  21  51SAPAPGDVSAEAWLVADLDSGAVIAARDPHGRHRPASVIKVLVAMASIN-----TLTLNKSVAGTADDAAVEG----TKVGVNTGGTYTVNQLLHGLLMHSGNDAAYALARQLGGMP-AALEKINLLAAKLGGRDTRVATPSGLD--------------GPGMSTSAYDIGLFYRYAWQN-PVFADIVATRTFDFPGHGDHYELENDNQLL----YNYPGALGGKTGYTDDAGQTFVGAANRDGRRLMTVLLHGTRQPPPWEQAAHLLDYGFNTPAGTQIGTLIEPDPSLMSTDRNPADRQRVDPQAAA.................................................................................................. 333
19 -23.8002v1z_A mol:protein length:291 BETA-LACTAMASE TEM  ali model follow..  18  25...........GYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQN-------KYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKE-----LTAFLHNMGDHVTRLDRWE--------PELNEAIPNDERDTTMPVAMATTLRKLLT-------------------GELLTLASRQQLIDWMEADKVAGPLLKSGAGRRGSRGIIAALGPDGKPSRIVVIYTTGSRKKTDERNRQI........................................................................................................................................... 257
20 -23.8003toi_A mol:protein length:254 Ampicillin resistance protein  ali model follow..  18  7...........GYIELDLNSGKVLESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKH----LTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKE-----LTAFLHNMGDHVTRLDRWE--------PELNEAIPNDERDTTTPVAMATTLRKLLS-------------------GELLTLASRQQLMDWMEADKVAGPLLKSGAGEHGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQI........................................................................................................................................... 239
21 -23.7001bsg_A mol:protein length:266 BETA LACTAMASE  ali model follow..  15  19...........GVYAYDTGSGRTV-AYRADELFPMCSVFKTLSSAAVLRDLDRNGEFLSRRILYTQDDVEQADGAPETGKPQNLANGMTVEELCEVSITASDNCAANLMLRELGGPAA-----VTRFVRSLGDRVTRLDRWE--------PELNSAEPGRVTDTTSPRAITRTYGRLVL-------------------GDALNPRDRRLLTSWLLANTTSGDRFKTGAGRYGTNNDAGVTWPPGRAPIVLTVLTAKTEQDAARDDGLV........................................................................................................................................... 254
22 -23.6004mez_A mol:protein length:263 Beta-lactamase TEM  ali model follow..  19  20...........GYIELDLNSGKILESFRPEERFPLTSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHL----TDGMTVRELCSAAITMSDNTAANLLLTTIGGPKE-----LTAFLHNMGDHVTRLDRWE--------PELNEAIPNDERDTTMPAAMATTLRKLLT-------------------GELLTLASRQQLIDWMEADKVAGPLLKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQI........................................................................................................................................... 252
23 -23.4005iq8_A mol:protein length:263 Beta-lactamase TEM  ali model follow..  19  20...........GYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKH----LTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKE-----LTAFLHNMGDHVTRLDRWE--------PELNEAIPNDERDTTTPAAMATTLRKLLT-------------------GELLTLASRQQLIDWMEADKVAGPLLKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQI........................................................................................................................................... 252
24 -23.4001htz_A mol:protein length:263 BETA-LACTAMASE MUTANT TEM52  ali model follow..  19  20...........GYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKH----LTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKE-----LTAFLHNMGDHVTRLDRWE--------PELNEAIPNDERDTTTPAAMATTLRKLLT-------------------GELLTLASRQQLIDWMEADKVAGPLLKSGASERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQI........................................................................................................................................... 252
25 -23.4003dtm_A mol:protein length:263 Beta-lactamase  ali model follow..  18  20...........GYIELDLNSGKILESFRSEERFPMMSTFKVLLCGAILSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKH----LTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKG-----LTAFLHNMGDHVTRLDRWE--------PELNEAIPNDERDTTTPVAMATTLRKLLT-------------------GELLTPASRQQLMDWMEADKVAGPLLKSGAGERGSRGIVAALGPDGKPSRIVVIYTTGSQATMDELNRQI........................................................................................................................................... 252
26 -23.4005npo_A mol:protein length:264 Beta-lactamase TEM  ali model follow..  19  21...........GYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKH----LTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKE-----LTAFLHNMGDHVTRLDRWE--------PELNEAIPNDERDTTMPAAMATTLRKLLT-------------------GELLTLASRQQLIDWMEADKVAGPLLKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQI........................................................................................................................................... 253
27 -23.4001li0_A mol:protein length:263 Class A beta-Lactamase- TEM-32  ali model follow..  19  20...........GYIELDLNSGKILESFRPEERFPMISTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKH----LTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKE-----LTAFLHNMGDHVTRLDRWE--------PELNEAIPNDERDTTTPAAMATTLRKLLT-------------------GELLTLASRQQLIDWMEADKVAGPLLKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQI........................................................................................................................................... 252
28 -23.2004hes_A mol:protein length:275 Beta-lactamase class A-like protein  ali model follow..  14  31...........SYAVLQFDDEELIAARGENTVHSSASLIKVLIMEYVFHLARTEQLDINDTVPLSRTPRVEG---GGALQELVGKHSFTYLELCRLMMVLSDNIATNLLITVLGMEN------INARAEKLGVDEMELNRMM---------MDFNALAEGRDNHITAMSLARLYKHIFEC--RDRDVYGREMWNI------LGRQQFRDILPFYWGEGIRF---KTGSLDRVEHDGGVIETFRGHFCFILLMSDIDNDRGKELGAQVGRIMKEFVEE.................................................................................................................................. 272
29 -23.1005npo_B mol:protein length:265 Beta-lactamase  ali model follow..  18  21...........GYIELDLASGKILVSFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKH----LTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKE-----LTAFLHNMGDHVTRLDRWE--------PELNEAIPNDERDTTTPVAMATTLRKLLT-------------------GELLTAASRQQLIDWMEADKVAGPLLKSGAGERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQI........................................................................................................................................... 253
30 -23.1005tfq_A mol:protein length:280 Beta-lactamase  ali model follow..  17  19......DKKATVGVAVLANDETVA-VYNNQIHFPLLSVFKFHVGLAVLDKMDKGHIALDSLIEVKSSQLKSNTYSPLRDKFPDQDITISLGELLKYTISKSDNNTCDILIEYVGGIDQ-----VNEYVKSLGIKDCNLAA---------TETLMHTSGDTDLNWSTPEEVVRLLNIADK-------------------QPLFGTQYKDFLQAIMQETSTGKDKLKTGSSDRTPEGIKIADNPNGQKYYIAVFVMESQETDADNAAIIASISKIVYD................................................................................................................................... 273
31 -23.1004op5_A mol:protein length:263 Extended spectrum beta-lactamase TEM-63  ali model follow..  18  20...........GYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKH----LTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKE-----LTAFLHNMGDHVTRLDSWE--------PELNEAIPNDERDTTTPVAMATTLRKLLT-------------------GELLTAASRQQLIDWMEADKVAGPLLKSGAGERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQI........................................................................................................................................... 252
32 -23.0002j7v_A mol:protein length:298 TLL2115 PROTEIN  ali model follow..  18  37...........GLYFFNLDSGASL-NVGGDQVFPAASTIKFPILVAFFKAVDEGRVTLQERLTMRPDLIAPE---AGTLQYQKPNSQYAALEVAELMITISDNTATNMIIDRLGGAAE-----LNQQFQEWGLENTVINNPL--------------PDMKGTNTTSPRDLATLMLKIGQG--EILSPRSRDRLL-----DIMRRTVTNTLLPAGLGKGATI---KTGDIGIVVGDAGMVDMPNGQRYVAAMMRPYNDPRGSELIRQVSRMVYQAFEK.................................................................................................................................. 273
33 -23.0004ibr_A mol:protein length:263 TEM-94 ES-beta-lactamase  ali model follow..  18  20...........GYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQN-------KYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKE-----LTAFLHNMGDHVTRLDRWE--------PELNEAIPNDERDTTTPVAMATTLRKLLT-------------------GELLTAASRQQLIDWMEADKVAGPLLKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQI........................................................................................................................................... 252
34 -23.0004rva_A mol:protein length:263 Beta-lactamase TEM  ali model follow..  20  20...........GYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKH----LTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKE-----LTAFLHNMGDHVTRLDRYY--------GELNEAIPNDERDTTMPAAMATTLRKLLT-------------------GELLTPASRQQLIDWMEADKVAGPLLKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQI........................................................................................................................................... 252
35 -22.8001e25_A mol:protein length:282 EXTENDED-SPECTRUM BETA-LACTAMASE PER-1  ali model follow..  17  21...........GVAVWGPDDLEPL-LINPFEKFPMQSVFKLHLAMLVLHQVDQGKLDLNQTVIVNRAKVLQNTWAPIMKAYQGDEFSVPVQQLLQYSVSHSDNVACDLLFELVGGPAA-----LHDYIQSMGIKETAVVANE--------AQMHADDQVQYQNWTSMKGAAEILKKFEQ-------------------KTQLSETSQALLWKWMVETTTGPERLKTGTSQIKAGKTAATNDPDGRPLLVAVFVKDSAESSRTNEAIIAQVAQTAYQ................................................................................................................................... 270
36 -22.7004zj1_A mol:protein length:297 Beta-lactamase TEM  ali model follow..  19  43...........GYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKH----LTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKE-----LTAFLHNMGDHVTRLDRWE--------PELNEAIPNDERDTTMPVAMATTLRKLLT-------------------GELLTLASRQQLIDWMEADKXAGPLLKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQI........................................................................................................................................... 275
37 -22.7004id4_A mol:protein length:263 Beta-lactamase TEM, Beta-lactamase PSE-4  ali model follow..  20  20...........GYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKH----LTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKE-----LTDFLRQIGDKETRLDRIE--------PDLNEGKLGDLRDTTTPKAIASTLRKLLT-------------------GELLTLASRQQLIDWMEADKVAGPLLKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQI........................................................................................................................................... 252
38 -22.6004zj2_A mol:protein length:297 Beta-lactamase TEM  ali model follow..  18  43...........GYIELDLNSGKILESFRPEERFPMMXTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHL----TDGMTVRELCSAAITMSDNTAANLLLTTIGGPKE-----LTAFLHNMGDHVTRLDRWN--------PELNEAIPNDERDTTMPVAMATTLRKLLT-------------------GELLTLASRQQLIDWMEADKVAGPLLKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQI........................................................................................................................................... 275
39 -22.5005gs8_A mol:protein length:280 Beta-lactamase  ali model follow..  15  23...........GVAVLGIEDNFKL-NVNEKHHYPMQSTYKFHLALAVLDKLDKENISVDKKLFVKKSDLQPNTWSPLKDKYPNGNLELSFSEIIKSTVSHSDNNGCDILFRFVGGTNK-----VHNFISKLGVKNISIKATE--------EEMHKAWNVQYTNWTTPDATVQLLKKFYK-------------------NEILSKNSYDFLLNTMIETTTGPKRLKTGSSDTNNKGITAATNPNGKHFAIAVYVSDSSEKSDVNEKIIAEICKSVWD................................................................................................................................... 273
40 -22.3003p98_A mol:protein length:286 Beta-lactamase TEM-72  ali model follow..  19  43...........GYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKH----LTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKE-----LTAFLHNMGDHVTRLDRWE--------PELNEAIPNDERDTTTPAAMATTLRKLLT-------------------GELLTLASRQQLIDWMEADKVAGPLLKSGASKRGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQI........................................................................................................................................... 275
41 -22.3004d2o_A mol:protein length:284 PER-2 BETA-LACTAMASE  ali model follow..  17  23...........GVAVWGPDDLEPL-LLNPFEKFPMQSVFKLHLAMLVLHQVDQGKLDLNQSVTVNRAAVLQNTWSPMMKDHQGDEFTVAVQQLLQYSVSHSDNVACDLLFELVGGPQA-----LHAYIQSLGVKEAAVVANE--------AQMHADDQVQYQNWTSMKAAAQVLQKFEQ-------------------KKQLSETSQALLWKWMVETTTGPQRLKTGTSGVRAGKTAATNDPDGRPLLVAVFVKDSAESERTNEAIIAQVAQAAYQ................................................................................................................................... 272
42 -22.2002a3u_A mol:protein length:270 Beta-lactamase SHV-1  ali model follow..  18  20...........GMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHL----ADGMTVGELCAAAITMSDNSAANLLLATVGGPAG-----LTAFLRQIGDNVTRLDRWA--------TELNEALPGDARDTTTPASMAATLRKLLT-------------------SQRLSARSQRQLLQWMVDDRVAGPLIKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQI........................................................................................................................................... 252
43 -21.7004ewf_A mol:protein length:275 Beta-lactamase  ali model follow..  17  23......ATGGTVGATIVAPGGETF-RHNGDRRFRAASTVKIPLMIAVYRAVDAGERALTDRIVLRAADKAPG---SGVLLHLHDGLELTLEDLVYLTISISDNTATNLLIDLVG------LDAVNDVIASLGMRDSNLSRKM---------KGRPALPDEPENWATPDDYALAVQALLEG--RAASQESCTAML-----AMLEKQQNPRRIGRYVPEGEGIRGSKTGSLTGVVNDVGFITTPAGTLVVAVFTNLPDLHAGEQAIGDITRAALQATGL.................................................................................................................................. 269
44 -21.7005eoo_A mol:protein length:265 Beta-lactamase  ali model follow..  18  20...........GVALVSENGNLIQ-GYRANERFAMCSTFKLPLAALVLSRIDAGEENPERKLHYDSAFLEEYAPAAKR---YVATGYMTVTEAIQSALQLSDNAAANLLLKEVGGPPL-----LTKYFRSLGDKVSRLDRIE--------PTLNTNTPGDERDTTTPMSMAQTVSKLIF-------------------GDTLTYKSKGQLRRLLIGNQTGDKTIKTGSCANGGRNDVAFFITTAGKKYVLSVYTNAPELQGEERALLI........................................................................................................................................... 252
45 -21.5002wuq_A mol:protein length:318 BETA-LACTAMASE REGULATORY PROTEIN BLAB  ali model follow..  15  23...........SFLVRDLYTGEEL-GIDPDTELPTASLVKLPLALATLERIRLGEVDGAQQIEVAPGRITTPGPTGLSR--FRHPARVAVDDLLYLSTSVSDGTASDALFEITP------PAQVEQMVREWGFRDLTVRHSM---GTSGRGHRVPQLDVARANTGTARAFVDLLEALWAPVLTGPRPGRTSRALPPEPAARLRELMAANLLRHRLAPDFASDAAKTGTLLNLRHEVGVVEHADGQVFAVAVLTESQVPADSQPGAEAL........................................................................................................................................... 297
46 -21.4003d4f_A mol:protein length:286 Beta-lactamase SHV-1  ali model follow..  18  41...........GMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHL----ADGMTVGELCAAAITMSDNSAANLLLATVGGPAG-----LTAFLRQIGDNVTRLDRWE--------TELNEALPGDARDTTTPASMAATLRKLLT-------------------SQRLSARSQRQLLQWMVDDRVAGPLIKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQI........................................................................................................................................... 273
47 -21.4003cjm_A mol:protein length:282 Putative beta-lactamase  ali model follow..  17  53...........GISYLDLETGEQR-SVNGQHEFYTASTIKVPLTMLVADTVASGQKKWTDLIPYNAEEDYEEGT---GIIAYNIQPEYPLKTLQEYAITYSDNIAKNMLYDTLGGDAK-----AKREMYQRYLHKT---------------------PSIEEPQFSSEDALVILQKLYTE--------KATKPDYQAIYDSMKQSVFHERMETPTTQGKVAH--KIGSYDEFIH--MGILETPHPFALAIFTKGPDNAKSAAFIASVTDKLWQLQVSE................................................................................................................................. 278
48 -21.4005f83_A mol:protein length:268 Beta-lactamase  ali model follow..  16  22...........GVAIVDPQGEIVA-GHRMAQRFAMGSTFKFPLAALVFERIDSGTERGDRKLSYGPDMIVEWSPATER---FLASGHMTVLEAAQAAVQLSDNGATNLLLREIGGPAA-----MTQYFRKIGDSVSRLDRKE--------PEMSDNTPGDLRDTTTPIAMARTVAKVLY-------------------GGALTSTSTHTIERWLIGNQTGDATLKTGTCANGGRNDIGFFKAQERDYAVAVYTTAPKLSAVERDELVASVGQVITQ................................................................................................................................... 262
49 -21.2002qpn_A mol:protein length:287 Beta-lactamase GES-1  ali model follow..  16  40...........GVAIVDPQGEIVA-GHRMAQRFAMCSTFKFPLAALVFERIDSGTERGDRKLSYGPDMIVEWSPATER---FLASGHMTVLEAAQAAVQLSDNGATNLLLREIGGPAA-----MTQYFRKIGDSVSRLDRKE--------PEMGDNTPGDLRDTTTPIAMARTVAKVLY-------------------GGALTSTSTHTIERWLIGNQTGDATLKTGTCANGGRNDIGFFKAQERDYAVAVYTTAPKLSAVERDELVASVGQVITQ................................................................................................................................... 280
50 -21.2003zdj_A mol:protein length:263 ENCA BETA-LACTAMASE  ali model follow..  18  21...........GMVELDLASGRTL-SYRADERFPMMSTFKVLLCGAVLARVDAGLEQLDRRIHYRQQDLVEYSPVTEKHL----ADGMTVAELCAAAITMSDNTAANLLLATIGGPAG-----LTAFLRNIGDNVTRLDRWE--------TELNEALPGDERDTTTPAAMAATLRKLLT-------------------GEILSAASRQQLITWMVADKVAGPLLKTGAGERGSRGIIAVLGPDGKPSRIVVIYLTETQASMDERNQQI........................................................................................................................................... 252
51 -21.1005gla_A mol:protein length:278 Beta-lactamase  ali model follow..  15  25...........GFVALDTATGARI-AHRADERFPFCSTFKTMLSAAVLARSAGDAALLQRRIPYAKRDLVRYSPITEKH----VGAGMTVAELCAATLQYSDNTAANLLIALLGGPQA-----VTAYARSIGDATFRLDRRETELNTAIPGDERDTTTGDERDTTTPAAMAASVRRLLV-------------------GDALGTAQRAQLNAWMLGNKTGDARIKTGTGDYGTGNDIGVAYPPDRAPIVFVVYTTMRSRNAQARDDVI........................................................................................................................................... 266
52 -21.1004yfm_A mol:protein length:275 Beta-lactamase  ali model follow..  14  27...........GVYALDTGSGDTV-GHRADERFLMCSTVKTFIVSAILRRRLSEPGLLDQRIQYTQSDVLEWAPITSQHV----STGMTVSELCDATLRYSDNTGANLLITQLGGPKE-----TEKFVRSLGDNVTRMDRTE-------------NIPDGDLDTSTPQQLVANLRRLVL-------------------DEGLDSRGRDLLTDWLKRNTTGDQSIKTGGGFKGETNDIAVIWPPGRAPIVMAVLTVPEDPTSTKGKPTI........................................................................................................................................... 256
53 -21.1004c6y_A mol:protein length:262 BETA-LACTAMASE  ali model follow..  18  20...........GVAVLDTATGRRI-AYRGDERFPMCSTFKALLAAAVLAQVDQGKERLDRRITYSKADLVDYSPVTEKHV----GGGMTVAELCEAAITYSDNTAANLLLEALGGPAA-----LTAFLRSIGDEVTRLDRWE--------PELNEALPGDPRDTTTPRAMAATLRKLLL-------------------GDALSPASREQLVDWLLANKTGDKRLKTGTGGHGTTNDIAVIWPPNRAPIVVAVYYTESQADAEARDAVI........................................................................................................................................... 251
54 -21.0003bfd_A mol:protein length:263 Class A beta-lactamase Sed1  ali model follow..  14  21...........GVALINTADNSQV-LYRADERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTIKKADLTNWNPVTEKY----VGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGN-----VTAFARSIGDTTFRLDRKE--------PELNTAIPGDERDTTSPLAMAKSLRKLTL-------------------GDALAGPQRAQLVDWLKGNTTGGQSIKTGACDYGTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWRKDVL........................................................................................................................................... 252
55 -21.0004c75_A mol:protein length:262 BETA-LACTAMASE  ali model follow..  17  20...........GVYALDTGTGRTI-AYRADERFPMCSTFKALAAAAVLAQVDAGKESLDRRITYTKDDLVDYSPVTEKHV----GTGMTLAELCEAAITYSDNTAANLLLDEIGGPKG-----LTAFLRSIGDDVTRLDRWE--------PELNEALPGDPRDTTTPAAMAATLRALLL-------------------GDALSPASRAQLTDWMRGNTTGDKLIKTGTGSYGTRNDIAIIWPPNRAPIVLAIYSTGSTADAKERNALI........................................................................................................................................... 251
56 -21.0002cc1_A mol:protein length:262 BETA-LACTAMASE  ali model follow..  13  19...........GLYAANLQSGRRI-THRPDEMFAMCSTFKGYVAARVLQMAEHGEISLDNRVFVDADAL-----PNSPVTEARAGAEMTLAELCQAALQRSDNTAANLLLKTIGGPAA-----VTAFARSVGDERTRLDRWE--------VELNSAIPGDPRDTSTPAALAVGYRAILA-------------------GDALSPPQRGLLEDWMRANQTS--ADKTGSGDYGSTNDAGIAFGPDGQLLVMMTRSQAHDPKAENLRPLI........................................................................................................................................... 250
57 -21.0005vpq_A mol:protein length:289 Beta-lactamase  ali model follow..  13  36...........GVAALRTADGSYV-GYRESERFPMCSTFKLLAVALILKRSMAERGLLEERIRYGDAQVVAHSPVTKR---HAGGEGMTVGELSAAALQHSDNTAANLLLTSLGGPEV-----LNQFALSIGDTWFDLVRNE--------PEVNASVPGDMRDTTSPRAMLLDVQKLLLADDVLGAREREQLKAWMLGNTT------ATRIRAAVPAAGWLVADNTGSGDYGTANDVAVVPPSSAPLVVAIYFTGVTPKETPPQDAIV........................................................................................................................................... 271
58 -21.0003w4o_A mol:protein length:266 Beta-lactamase  ali model follow..  13  23...........GFVALDTATGARI-AHRGDERFPFCSTSKMMLCAAVLARSAGEPALLQRRIAYAKGDLIRYSPITEQHV----GAGMSVAELCAATLQYSDNTAANLLIALLGGPQT-----VTAYARSIGDATFRLDRRE--------PELNTALPGDERDTTTPAAMAASVHRLLV-------------------GDALGAAQRAQLNAWMLGNKTGDARIKTGTGDYGTANDIGVAYPPNRAPIVFIVYTTMRNPNAQARDDVI........................................................................................................................................... 254
59 -20.8005hw3_A mol:protein length:269 Beta-lactamase  ali model follow..  16  19...........GVFAIDTGSGRTL-GHRADERFLMCSTFKGLLAAQILARVDSGSERLDRLVHYTEKDLIFTSPVTKANV---AQGAMSIEALCRAVLVESDNTAAILLMRSAGGPAA-----LTRFVRGLGDTVTRSDRYE-------------NRYHGVLDTTTPKAIAATAQRLLL-------------------GDVLSAGSRARLERGMTDCKPGLNRIRPGTSVDRETNDYALVRPPGRAPLLVAVYYDAPGVSMDAREAVL........................................................................................................................................... 249
60 -20.8005fqm_A mol:protein length:269 GNCA BETA LACTAMASE  ali model follow..  18  21...........GVAVLDTATGRRI-AYRGDERFPMCSTFKALLAAAVLARVDQGKERLDRRITYGKEDLVDYSPVTEKHV----GDGMTVAELCEAAITLSDNTAANLLLEALGGPAA-----LTAFLRSIGDEVTRLDRWE--------PELNEAAPGDPRDTTTPAAMAATLRTLLL-------------------GDALSPASRQQLVDWLVANKTGDKRLKTGTGGHGTTNDIAVIWPPGRAPIVVTVYLTESQVDADARDAVI........................................................................................................................................... 252
61 -20.7005uj3_A mol:protein length:290 Carbapenem-hydrolyzing beta-lactamase KPC  ali model follow..  16  36...........GVYAMDTGSGATV-SYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYL----TTGMTVAELSAAAVQYSDNAAANLLLKELGGPAG-----LTAFMRSIGDTTFRLDRWE--------LELNSAIPGDARDTSSPRAVTESLQKLTL-------------------GSALAAPQRQQFVDWLKGNTTGNHRIKTGTCGVYGTA-YAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVI........................................................................................................................................... 268
62 -20.7006AFP Entity 1(prereleased)  ali follow..  14  25...........GFVALDTATGARI-AHRADERFPFCSTFKTMLSAAVLARSAGDAALLQRRIPYAKRDLVRYSPITEKHV----GAGMTVAELCAATLQYSDNTAADLLIALLGGPQA-----VTAYARSIGDATFRLDRRE--------TELNTAIPGDERDTTTPAAMAASVRRLLV-------------------GDALGTAQRAQLNAWMLGNKTGDARIKTGTGDYGTGNDIGVAYPPDRAPIVFVVYTTMRSRNAQARDDVI........................................................................................................................................... 256
63 -20.7005fqi_A mol:protein length:269 GNCA4 LACTAMASE W229D AND F290W  ali model follow..  17  21...........GVAVLDTATGRRF-GYRGDERFPMCSTFKALLAAAVLARVDQGKENLDRRITYGKEDLVDYSPVTEKHV----GDGMTVAELCEAAITYSDNTAANLLLEALGGPAA-----LTAFLRSIGDNVTRLDRWE--------PELNTAAPGDPRDTTTPAAMAATLRTLLL-------------------GDVLSPASRQQLVDWLIANKTGDKRLKTGTGEHGTTNDIAVIWPPNRAPILVAVYLTESQVDADARDAVI........................................................................................................................................... 252
64 -20.7001hzo_A mol:protein length:271 BETA-LACTAMASE  ali model follow..  14  22...........GVALINTEDNSQI-TYRGEERFAMASTSKVMAVAAVLKASEKQAGLLDKNITIKKSDLVAYSPITEKHL----TTGMTLAELSAATLQYSDNTAMNKILDYLGGPAK-----VTQFARSINDVTYRLDRKE--------PELNTAIHGDPRDTTSPIAMAKSLQALTL-------------------GDALGQSQRQQLVTWLKGNTTGDNSIKTGSGDYGTTNDIAVIWPENHAPLILVVYFTQQEQNAKYRKDII........................................................................................................................................... 253
65 -20.7002xep_A mol:protein length:458 ORF12  ali model follow..  12  140......TPGVQHSVYLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGD------LPDGTRVTVRETAHKMIALSDNTGADLVADRLGREV------VERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKM-FDVVRVLEGLLQDSGR-DTSGTVEEILTAYPGLLIDEERWRRV-YFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIE................................................................................................................................... 426
66 -20.6001bza_A mol:protein length:262 BETA-LACTAMASE  ali model follow..  14  20...........GVALINTADNSQI-LYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKH----VNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDK-----VTAFARSLGDETFRLDRTA--------PTLNTAIPGDPRDTTTPLAMAQTLKNLTL-------------------GKALAETQRAQLVTWLKGNTTGSASIKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAERRRDIL........................................................................................................................................... 251
67 -20.6005ihv_A mol:protein length:269 Beta-lactamase  ali model follow..  11  17...........GIAVLDTSNGTRI-AHHARERFPLCGTYAVVAAAAILARGSLDASLLPRRILYRRY------VAGSPVTESHVDTGMTIAQLCAAMLQSGDKGAGNLLMRVLGGPQA-----VTSFAHESGDTVFRLDRWE--------PELNLAAPGDERDTSTPVAMVDLLQQLLL-------------------GDTLREPQRAQLTEWMTGGARGATAIKAGTGGYGTTTDVAVLWPPSRAPIVLAVSFTQPRADAAARADVV........................................................................................................................................... 248
68 -20.6001g68_A mol:protein length:271 BETA-LACTAMASE PSE-4  ali model follow..  14  24...........GVSVLDTQNGEYW-DYNGNQRFPLTSTFKTIACAKLLYDAEQGKVNPNSTVEIKKA-------TYSPVIEKQVGQAITLDDACFATMTTSDNTAANIILSAVGGPKG-----VTDFLRQIGDKETRLDRIE--------PDLNEGKLGDLRDTTTPKAIASTLNKFLF-------------------GSALSEMNQKKLESWMVNNQVTGNLLRSGAGGFGARSITAVVWSEHQAPIIVSIYLAQTQASMEERNDAI........................................................................................................................................... 255
69 -20.5005gl9_A mol:protein length:268 Beta-lactamase  ali model follow..  14  25...........GFVALDTATGARI-AHRADERFPFCSTFKTMLSAAVLARSAGDAALLQRRIPYAKRDLVRYSPITEKHV----GAGMTVAELCAATLQYSDNTAANLLIALLGGPQA-----VTAYARSIGDATFRLDRRE--------TELNTAIPGDERDTTTPAAMAASVRRLLV-------------------GDALGTAQRAQLNAWMLGNKTGDARIKTGTGDYGTGNDIGVAYPPDRAPIVFVVYTTMRSRNAQARDDVI........................................................................................................................................... 256
70 -20.5002zq8_A mol:protein length:262 Beta-lactamase Toho-1  ali model follow..  14  20...........GVALINTADNSQI-LYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKH----VNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDK-----VTAFARSLGDETFRLDRTE--------PTLNTAIPGDPRDTTTPLAMAQTLKNLTL-------------------GKALAETQRAQLVTWLKGNTTGSASIKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDIL........................................................................................................................................... 251
71 -20.4003byd_A mol:protein length:267 Beta-lactamase OXY-1  ali model follow..  12  25...........GVALINTADDSQT-LYRGDERFAMCSTGKVMAAAAVLKQSESNPEVVNKRLEIKKSDLVVWSPITEKHL----QSGMTLAELSAAALQYSDNTAMNKMISYLGGPEK-----VTAFAQSIGDVTFRLDRTE--------PALNSAIPGDKRDTTTPLAMAESLRKLTL-------------------GNALGEQQRAQLVTWLKGNTTGGQSIKTGAGDYGTTNDIAVIWPENHAPLVLVTYFTQPQQDAKSRKEVL........................................................................................................................................... 256
72 -20.3003dw0_A mol:protein length:294 Class A carbapenemase KPC-2  ali model follow..  16  45...........GVYAMDTGSGATV-SYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYL----TTGMTVAELSAAAVQYSDNAAANLLLKELGGPAG-----LTAFMRSIGDTTFRLDRWE--------LELNSAIPGDARDTSSPRAVTESLQKLTL-------------------GSALAAPQRQQFVDWLKGNTTGNHRIKTGTCGVYGTA-YAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVI........................................................................................................................................... 277
73 -20.3003p09_A mol:protein length:290 Beta-lactamase  ali model follow..  13  40...........GIYTLNTDDKTNI-KYNESYHFPICSVFKFLLVGAILDYDMHNQGFLDKKIPINQDDIGKL---GYAPITAKNVGKTLTISQLNYAAILSDSPASNILVRELGGLQN-----LNKFIKKLGDNDTIITADE--------PEINYTQPHSNINKTTPKAITKDIYKLAF-------------------GNILDKKHKDIFIKYLQDNNTGANRIKTGTCGQYA--VAIIWPKNQQPIALGILYTNPNDKNAPSNEEII........................................................................................................................................... 274
74 -20.3005tw6_A mol:protein length:263 Beta-lactamase  ali model follow..  13  21...........GVALIDTADNTQV-LYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKH----VNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGG-----VTAFARAIGDETFRLDRTA--------STLNTAIPGDPRDTTTPRAMAQTLRQLTL-------------------GHALGETQRAQLVTWLKGNTTGAASIKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVL........................................................................................................................................... 252
75 -20.3001we4_A mol:protein length:262 Beta-lactamase Toho-1  ali model follow..  14  20...........GVALINTADNSQI-LYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKH----VNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDK-----VTAFARSLGDETFRLDRTE--------PTLNTAIPGDPRDTTTPLAMAQTLKNLTL-------------------GKALAETQRAQLVTWLKGNTTGSASIKTGSCDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAERRRDIL........................................................................................................................................... 251

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24