current user: public

If you have questions about the server, please let us know.

Query: gi|30260208|ref|NP_842585.1| deoxynucleoside kinase family protein (BA_0014) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTRWSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKGLFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINNFNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVKLast
1 -74.2002ocp_A mol:protein length:241 Deoxyguanosine kinase  ali model follow..  25  1..........GPRRLSIEGNIAVGKSTFVKLLTKTYGNQKACTAQSLGNLLDMMYREPARWSYTFQTFSFLSRLKVQLEPFARKPVQIFERSVYSDRYIFAKNLFENGSLSDIEWHIYQDWHSFLLWEFSRITLHGFIYLQASPQVCLKRLYQRAREEEKGIELAYLEQLHGQHEAWLIHLMNIPVLVLDVND-DFSEEVTKQEDLMREVNTFVKNL..... 241
2 -71.9002jas_A mol:protein length:206 DEOXYGUANOSINE KINASE  ali model follow..  30  3.............KIAIFGTVGAGKSTISAEISKKLGYEIFKEPVEENPYFEQYYKDLKKTVFKMQIYMLTARSKQLKQAKN-LENIIFDRTLLEDP-IFMKVNYDLNNVDQTDYNTYIDFYNNVVLENNKLSFDIVIYLRVSTKTAISRIKKRGRSEELLIGEEYWETLNKNYEEFYKQNYDFPFFVVDAEL-DVKTQIELIMNKLNSIKN.......... 204
3 -71.8003qeo_A mol:protein length:279 Deoxycytidine kinase  ali model follow..  26  23PSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLSEEELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSMIRAQLASLNEKPVLFFERSVYSARYIFASNLYESESMNETEWTIYQDWHDWMNNQFQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHLQEVPILTLDVNE-DFKDKYESLVEKVKEFLSTL........ 273
4 -70.8003hp1_A mol:protein length:280 Deoxycytidine kinase  ali model follow..  26  24PSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSMIRAQLASLNEKPVLFFERSVYSARYIFASNLYESECMNETEWTIYQDWHDWMNNQFQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTEVPILTLDVNE-DFKDKYESLVEKVKEFLSTL........ 274
5 -70.0005mql_A mol:protein length:289 Deoxycytidine kinase  ali model follow..  28  33PSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLSDWEVVPEPVARGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHLQEVPILTLDVNE-DFKDKYESLVEKVKEFLSTL........ 283
6 -69.3001ot3_A mol:protein length:250 Deoxyribonucleoside Kinase  ali model follow..  19  10.KGTKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNICLLTEPVEKVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNK-KLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESI-HVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRCKVLVLDADL-NLENIGTEYQRSESSIFDAISSNQQPSP 237
7 -68.1002no0_A mol:protein length:280 Deoxycytidine kinase  ali model follow..  27  24PSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLSEEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTEVPILTLDVNE-DFKDKYESLVEKVKEFLSTL........ 274
8 -68.0002a2z_A mol:protein length:248 Deoxycytidine kinase  ali model follow..  28  13PSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHLQEVPILTLDVNE-DFKDKYESLVEKVKEFLSTL........ 248
9 -67.8005mqj_A mol:protein length:281 Deoxycytidine kinase  ali model follow..  27  25PSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLSEEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTEVPILTLDVNE-DFKDKYESLVEKVKEFLSTL........ 275
10 -66.8002qrn_A mol:protein length:280 Deoxycytidine kinase  ali model follow..  27  25.SFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTEVPILTLDVNE-DFKDKYESLVEKVKEFLSTL........ 274
11 -60.4005o31_O mol:protein length:320 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial  ali model follow..  21  12.EKATKKMTEKSKLITVDGNICSGKSKLAKEIAEKLGLKHFPEAGSGNCSLEKFYDDPKSNSYRLQAWLYASRLLQYADALSTGQGVVLERSIYSDF-VFLEAMYRQGFIRKQCVDHYNQVKKVTICEY--LPPHVVVYVDVPVPEVQSRIQKKGNPHEMKITSAYLQDIENAYKGTFLPEMSEKCEVLQYSAWEAQDAEKVVEDIEYLKYDKGP....... 247
12 -59.9005lnk_k mol:protein length:320 Mitochondrial complex I, 42 kDa subunit  ali model follow..  22  11GEKTTKKMTENSKLITVDGNICSGKSKLAKEVAEKLGLKHFPEAGSGNCSLEKFYDDPKSNSYRLQAWLYASRLLQYADALSTGQGVVLERSIYSDF-VFLEAMYRQGFIRKQCVDHYNQVKKVTVCEY--LPPHVVIYVDVPVSEVQSRIQKKGNPHEMKITSAYLQDIENVYKGTFLPEMSEKCEVLQYSAWEAEDAEKVVEDIQYLKYDKGPWLDQ... 251
13 -59.4005gpn_q mol:protein length:357 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial  ali model follow..  23  48GERTTRKLTETSKVITVDGNICSGKGRLAREIAEKLGLRHFPEAGSGNCSLEKFYDDPKSNSYRLQSWLYASRLLQYADALSTGQGVVLERSIYSDF-VFLEAMYRQGFIRKQCVEHYNEVKKVTACE--YLPPHVVVYVDVPVPEIQSRIQKKGNPHEMKITAAYLQDIENAYKKTFLPEMSEKCEVLQYSAREAEDAEKVVEDIEYLKCD.......... 281
14 -59.2005xtc_w mol:protein length:320 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial  ali model follow..  21  12.DKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGNGNCSLEKFYDDPRSNSYRLQSWLYSSRLLQYSDALTTGQGVVLERSIFSDF-VFLEAMYNQGFIRKQCVDHYNEVKSVTICDY--LPPHLVIYIDVPVPEVQRRIQKKGDPHEMKITSAYLQDIENAYKKTFLPEMSEKCEVLQYSAREAQDSKKVVEDIEYLKFDKGP....... 247
15 -59.0006g2j_O mol:protein length:355 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial  ali model follow..  25  47.DKTTKKLHEYSRVITVDGNICSGKNKLAKEIAQQLGMKHYPEAGSGSCSLEKFYDDPKSNSYRLQSWLYASRLLQYADALSTGQGVVLERSIYSDF-VFLEAMYNQGYIRKQCVDHYNEIKRLTLPE--YLPPHAVIYIDVPVPEVQSRIQKKGDPHEMKVTSAYLQDIENAYKKTFLPKMSEMVLVYDSWEEDPTKVVEDIEYLKYNKGPWLKQDDW... 289
16 -47.4001p6x_A mol:protein length:334 Thymidine kinase  ali model follow..  17  4........MVTIVRIYLDGVYGIGKSTTGRVMASAASTLYFPEPMAETDVISGIYDDAALITAHYQSRFTTPYLNSLQRGTQPDLTLVFDRHPVASTVCFPAARYLLGDMSMCALMAMVATLP------REPQGGNIVVTTLNVEEHIRRLRTRARIGEQ-IDITLIATLRNVYFMLVNTCRSGRVWRDGWGELPTSCGAYKHRATQMDAFQ.......... 238
17 -46.1001osn_A mol:protein length:341 Thymidine kinase  ali model follow..  16  1MSTDKTDVKMGVLRIYLDGAYGIGKTTAAEEFLHHFAITLIGEPLSGEDAICGIYGDAQRLTAHFQSLFCSPHAIMHAKISAPYKIMLSDRHPIASTICFPLSRYLVGDMSPAALPGLLFTLP------AEPPGTNLVVCTVSLPSHLSRVSKRARPGET-VNLPFVMVLRNVYIMLINTIIFLKTNNWGWNTLSFCNDVFKQKLQKSECIK.......... 246
18 -45.4001of1_A mol:protein length:376 THYMIDINE KINASE  ali model follow..  14  39.EVRPEQKMPTLLRVYIDGPHGMGKTTTTQLLVALGSIVYVPEPMTASETIANIYTTQHRLDTSAQITMGMPYAAGSSHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIP------PTLPGTNIVLGALPEDRHIDRLAKRQRPGER-LDLAMLAAIRRVYGLLANTVQCGGSWREDWGQLSGTAVPPQGAEPQSNAGPRPHIGDTLFT 290
19 -34.2002axp_A mol:protein length:173 hypothetical protein BSU20280  ali model follow..  17  2............TLIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFE------------------LAKSGNEKLFEHFNKLADEDNVIIDRFVYSN-LVYAKKFKDYSILTERQLRFIEDKIK---------AKAKVVYLHADPSVIKKRLRVRG---DEYIEGKDIDSILELYREVMSN-AGLHTYSWDTGQWS-------SDEIAKDIIFLVE....... 165
20 -30.1001g3u_A mol:protein length:214 THYMIDYLATE KINASE  ali model follow..  14  2.............LIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPALHGEHGDLASSVYAMATLFALDRAGTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAW-----VQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGERDAELQQRTGAVYAELAAQGWGGRWLVVGADV--------DPGRLAATLAPPD........ 211
21 -29.1002plr_A mol:protein length:213 Probable thymidylate kinase  ali model follow..  14  1........MKKGVLIAFEGIDGSGKSSQATLLKDWIKRDVYLTEWNSSDWIHDIIKTPLTFSLIHATDFSDRYERYILPMLKSGFIVISDRYIYTAYARDSVRGVDIDWVKK--------------LYSFAIKPDITFYIRVSPDIALERIKKSKRKIKEEGFLKYQGLITEVYDKLVKDEN---FIVIDGTK----TPKEIQIQIRKFVGELIDN...... 211
22 -27.9005uiv_A mol:protein length:227 Bifunctional thymidylate/uridylate kinase  ali model follow..  14  3.......TSARGQLILIEGLDRSGKSTQASILSTKLSPSKLIKFPDRSTPIGKLINE-KSFTLSDQAAHLLELSQQIQDLLNQGYFIILDRYIYSGIAYAKNDFHDETISQGKNKQQLNNIDWLLSPDKGLPKPDLTLFLTLDLEEISKRKGWGDERYEL---QQFQAKVKQCFLEILDTNKDPTIRIVDVGGKTI---DQVTTQLWEIIETNKNH...... 216
23 -27.5001e9f_A mol:protein length:217 THYMIDYLATE KINASE  ali model follow..  16  2....SHMAARRGALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPLLSSYLQKKSDVEDHSVHLLFSEQVPLIKEKLSQGVTLVVDRYAFSGVAF-------TGAKENFSLDWCKQP------DVGLPKPDLVLFLQLQLADAAKRGRARG-ELERYENGAFQERALRCFHQ-LMKDTTLNWKMVDASK----SIEAVHEDIRVLSEDAIATATE... 209
24 -26.4002xx3_A mol:protein length:232 THYMIDYLATE KINASE  ali model follow..  14  9VPRGSHMAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPLLSSYLQKKSDVEDHSVHLLFSEQVPLIKEKLSQGVTLVVDRYAFSGVAF-------TGAKENFSLDWCKQP------DVGLPKPDLVLFLQLQLADAAKRGAFGHERYEN---GAFQERALRCFHQ-LMKDTTLNWKMVDASK----SIEAVHEDIRVLSEDAIRTATE... 218
25 -26.3001e9c_A mol:protein length:215 THYMIDYLATE KINASE  ali model follow..  15  2....SHMAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPLLSSYLQKKSDVEDHSVHLLFSEQVPLIKEKLSQGVTLVVDRYAFSGVAY-------TGAKENFSLDWCKQP------DVGLPKPDLVLFLQLQLADAAKRGAFGHERYEN---GAFQERALRCFHQ-LMKDTTLNWKMVDASK----SIEAVHEDIRVLSEDAIATATE... 207
26 -26.2002v54_A mol:protein length:204 THYMIDYLATE KINASE  ali model follow..  14  1........MSRGALIVFEGLDKSGKTTQCMNIMESITIKYLNFPQRSTVTIDDYLTRKKTYNDHIVNLLFCEFASFIQEQLEQGITLIVDRYAFSGVAYAAAKGASMTLSKSYE--------------SGLPKPDLVIFLESGSKEINRNVGE-----EIYEDVTFQQKVLQEYKK-MIEEGDIHWQIISSEFEEDVKKELIKNIVIEAIHTVTGPVGQL.. 202
27 -26.1002wwf_A mol:protein length:212 THYMIDILATE KINASE, PUTATIVE  ali model follow..  16  1..SHMTDDKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPIISKYLKMENSMSNETIHLLFSEHMNEIKSLLLKGIWVVCDRYAYSGVAY-------SSGALNLNKTWCMNP------DQGLIKPDVVFYLNVPPNYAQNRSDYGEEIYEK---VETQKKIYETYKHFA---HEDYWINIDATR----KIEDIHNDIVKEVTKIKVEPEEF.. 207
28 -25.3001tmk_A mol:protein length:216 THYMIDYLATE KINASE  ali model follow..  14  1.......MMGRGKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERGLINEYLTDDSFQLSDQAIHLLFEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAAKGTNGMDLD------------CLQPDVGLLKPDLTLFLSTQDVDNNAE--KSGFGDERYETVKFQEKVKQTFMKLLDKKGDESITIVDVTNKGI---QEVEALIWQIVEPVLST...... 206
29 -25.2001y63_A mol:protein length:184 Lmaj004144AAA protein  ali model follow..  14  4.....SMEQPKGINILITGTPGTGKTSMAEMIAAELDGFQH---LEVGKLVKE--YDTELDTHIIEEKDEDRLLDFMEPIMVSRGNHVVDYHSSE---------------------------------FPERWFHMVVVLHTSTEVLFERLTKRQYSEAKRAENMEAEIQCICEEEARDAYEDDIVLVRENDTLE--QMAATVEEIRERVEVLKVERG.... 183
30 -25.0002ccg_A mol:protein length:225 THYMIDYLATE KINASE  ali model follow..  17  6.SGLVPRGSHMSAFITFEGPEGSGKTTVINEVYHRLDVIMTREP--RKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAY-------QGYARGIGVEEVRALNEFAINGL---YPDLTIYLNVSAEVGRERIIKNSRDQNRQEDLKFHEKVIEGYQE-IIHNESQRFKSVNADQ----PLENVVEDTYQTIIKYLEKI..... 219
31 -24.9004dwj_A mol:protein length:229 Thymidylate kinase  ali model follow..  17  13....YFQSNAMSAFITFEGPEGSGKTTVINEVYHRLDVIMTREP--RKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAY-------QGYARGIGVEEVRALNEFAINGL---YPDLTIYLNVSAEVGRERIIKNSRDQNRQEDLKFHEKVIEGYQE-IIHNESQRFKSVNADQ----PLENVVEDTYQTIIKYLEKI..... 223
32 -24.8002rhm_A mol:protein length:193 Putative kinase  ali model follow..  16  2........MQTPALIIVTGHPATGKTTLSQALATGLRLPLLSKDAFKEVMFDGLGWSDREWSRRVGATAIMMLYHTAATILQSGQSLIMESNF----------------RVDLDTERMQNLHTIAPFTP------IQIRCVASGDVLVERILSRIAQGARHCDDRSPADLELVRSRG-----GGPLLTVDTTF----PEQIDMNAIVQWVRQHLQS...... 188
33 -24.7005x7j_A mol:protein length:198 Thymidylate kinase  ali model follow..  14  2..........PGLFLTLEGLDGSGKTTQARRLAAFLPVLLTREPGGGLPEVRSLLLTQELSPEAEYLLFSADRAEHVRKVLAAGKVVISDRYLDSSLAY-------QGYGRGLPLPWLREVAREATRGL---KPRLTFLLDLPPEAALRRVRRPDRLEGLGL--EFFRRVREGYLA-LARAEPGRFVVLDATL----PEEEIARAIQAHLRPLLP....... 198
34 -23.6005jzv_A mol:protein length:206 Adenylate kinase isoenzyme 6  ali model follow..  16  23...QMGRGSMLLPNILLTGTPGVGKTTLGKELASKSGLKYI-DLAREEQLYDGYDEEYDCPILDED------RVVDELDNQMREGGVIVGYHGCD---------------------------------FPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPE--ELENNVDQILKWIEQWIKDHN.... 199
35 -23.5002bdt_A mol:protein length:189 BH3686  ali model follow..  15  2...........KKLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHMVVGGYRPPWESDELLAL-TWKNITDLTVNFLLAQNDVVLDYIAFPDEA---EALAQTVQAKVDDVEIR------------------FIILWTNREELLRRDALRKKDEQMG------ERCLELVEEFESKGIDER-YFYNTSHLQ--------TNLNDIVKNLKTNPRFIFC 176
36 -23.2004tmk_A mol:protein length:213 PROTEIN (THYMIDYLATE KINASE)  ali model follow..  17  2..........RSKYIVIEGLEGAGKTTARNVVVETLDMVFTREP--RSLLLDIKSVGDEVITDKAEVLMFYAA-TVIKPALANGTWVIGDRHDLSTQAY-------QGGGRGIDQHMLATLRDAVLGDF---RPDLTLYLDVTPEVGLKRARARGELDREQESFDFFNRTRARYLELAAQDKS--IHTIDATQ----PLEAVMDAIRTTVTHWVKELD.... 212
37 -23.0001ki9_A mol:protein length:192 adenylate kinase  ali model follow..  13  2..........KNKLVVVTGVPGVGGTTITQKAMEKLSEE-VMFEVAQEENLVEDRDQMRKLDPDTQKRIQKLAGRKIAEMVKESPVVVDTHSTIKT---------PKGYLPGLPVWVLNEL-----------NPDIIIVVETSGDEILIRRLNDETRNRDLETTAGIEEHQIMNRAAAMTYGGATVKIIQNKN-------NLLDYAVEELISVLR....... 192
38 -22.9003ld9_A mol:protein length:223 Thymidylate kinase  ali model follow..  16  5.TLEAQTQGPGSMFITFEGIDGSGKTTQSHLLAEYLNVVLTREP--RNLLFKAQGLDSLSELLFFIAMRREHFVKIIKPSLMQKKIVICDRFIDSTIAY-------QGYGQGIDCSLIDQLNDLVI-----VYPDITFIIDVDINESLSRSCKNGYEFA---DMEFYYRVRDGFYD-IAKKNPHRCHVITDKS--------ETYDIDDINFVHLEVIKVLQM 216
39 -22.8002vli_A mol:protein length:183 ANTIBIOTIC RESISTANCE PROTEIN  ali model follow..  14  4..........RSPIIWINGPFGVGKTHTAHTLHERLPGSFVFEPEEMGQALRKLTPGFSGDPQEHPMWIPLMLDALQYASREAAGPLIVPVSISDTARHRR-----MSGLKDRGLSVH------------------HFTLIAPLNVVLERLRRDGQPQVN------VGTVEDRLNELRGEQFQ---THIDTAGLG--------QQVAEQIAAQVG....... 170
40 -22.8002pbr_A mol:protein length:195 Thymidylate kinase  ali model follow..  16  2.............LIAFEGIDGSGKTTQAKKLYEYLFVSLYREPTKVGEVLREILLTEELDERTELLLFEASRSKLIEEKLKRDKVVILDRFVLSTIAY-------QGYGKGLDVEFIKNLNEFATRGV---KPDITLLLDIPVDIALRRLKEKNRFENK----EFLEKVRKGFLELAKEEEN--VVVIDASG----EEEEVFKEILRALSGVLR....... 194
41 -22.7003h86_B mol:protein length:192 Adenylate kinase  ali model follow..  13  2..........KNKVVVVTGVPGVGGTTVTQKAMDILSEEGLYKMVNFGSAMFDVANDQMRKLDPETQKRIQKMAGRKIAEMAKESPVAVDT--------HSTVKTPKGYLPGLPAWVLTEL-----------NPDIVIVVETDGDEILMRRLSDESRKRDLETTASIEEHQFMNRA-YGVLTGATVKIVKNKN-------GLVDNAVEELMSVLR....... 192
42 -22.6003iij_A mol:protein length:180 Coilin-interacting nuclear ATPase protein  ali model follow..  18  3LGSPEFMLLPN---ILLTGTPGVGKTTLGKELASKSGLKYI-DLAREEQLYDGYDEEYDCPILDED------RVVDELDNQMREGGVIVDYHGCD---------------------------------FPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPE--ELENNVDQILKWIEQWIKDHN.... 179
43 -22.6003v9p_A mol:protein length:227 Thymidylate kinase  ali model follow..  13  9.QTQGPGSMARGKFITFEGIDGAGKTTHLQWFCDRLHVVVTREPTRLGETLREILLNQPMDLETEALLMFAGRREHLALVLARGDWVVSDRFTDATFAY-------QGGGRGLPRDKLEALERWVQGGF---QPDLTVLFDVPPQIASARRGAVRMPDKESESDAFFARTRAEYLR-RAQEAPHRFVIVDSSE--------PIAQIRKQLEGVLAAL..... 221
44 -22.6003uwk_A mol:protein length:232 Thymidylate kinase  ali model follow..  13  7.GLVPRGSHMTGLFVTLEGPEGAGKSTNRDYLAERLEVQLTREPTPLAERIRELLLAPSDEPMAADTELLLMFAGVIRPALARGAVVLCDRFTDATYAY-------QGGGRGLPEARIAALESFVQGDL---RPDLTLVFDLPVEIGLARAAARGRLDREQEDRRFFEAVRQTYLQ-RAAQAPERYQVLDAGL----PLAEVQAGLDRLLPNLLERLN.... 223
45 -22.3003lv8_A mol:protein length:236 Thymidylate kinase  ali model follow..  17  11.NLYFQSNAMNAKFIVIEGLEGAGKSTAIQVVVETLQITRTREPGGTRALVKEEHPGEELQDITELLLVYAARVQLVENVLARGEWVVGDRHDMSSQAY-------QGGGRQIAPSTMQSLKQTALGDF---KPDLTLYLDIDPKLGLERARGRGELDREKMDISFFERARERYLELANSDDS--VVMIDAAQ----SIEQVTADIRRALQDWLSQVNRV.. 230
46 -22.2001nks_A mol:protein length:194 ADENYLATE KINASE  ali model follow..  14  2............KIGIVTGIPGVGKSTVLAKVKEILDNQ-FMLATALKLGYAKDRDEMRKLSVEKQKKLQIDAAKGIAEEARAGG----EGYLFIDTHAVIRT--PSGYLPGLPSYVITEI-----------NPSVIFLLEADPKIILSRQKRDTTRNRNDYSDESVINFARYAATASAVLAGSTVKVIVNVEGDP-------SIAANEIIRSMK....... 194
47 -22.1001kht_A mol:protein length:192 adenylate kinase  ali model follow..  15  2..........KNKVVVVTGVPGVGSTTSSQLAMDNLRKE-VMFEVAKEENLVSDRDQMRKMDPETQKRIQKMAGRKIAEMAKESPVAVDTHSTVST---------PKGYLPGLPSWVLNEL-----------NPDLIIVVETTGDEILMRRETRVRDLDTASTIEQHQFMNRCAAMSYGVLTGATVKIVQNRN-------GLLDQAVEELTNVLR....... 192
48 -22.1004e5u_A mol:protein length:213 Thymidylate kinase  ali model follow..  13  5..........TGLFVTLEGPEGAGKSTNRDYLAERLEVQLTREPTPLAERIRELLLAPSDEPMAADTELLLMFAGVIRPALARGAVVLCDRFTDATYAY-------QGGGRGLPEARIAALESFVQGDL---RPDLTLVFDLPVEIGLARAAARGRLDREQEDRRFFEAVRQTYLQ-RAAQAPERYQVLDAGL----PLAEVQAGLDRLLPNLLERLN.... 212
49 -21.7003hjn_A mol:protein length:197 Thymidylate kinase  ali model follow..  19  2.............FITFEGIDGSGKSTQIQLLAQYLKVILKREPTETGEKIRKILLEEEVTPKAELFLFLASRVTEIKQYLSEGYAVLLDRYTDSSVAY-------QGFGRNLGKEIVEELNDFATDGL---IPDLTFYIDVDVETALKRKGELNRFEKR----EFLERVREGYLV-LAREHPERIVVLDGKR----SIEEIHRDVVREVKRRWK....... 194
50 -21.3004cvn_A mol:protein length:191 PUTATIVE ADENYLATE KINASE  ali model follow..  20  1.......MKAMGMLIAITGTPGVGKTTIAKLLAEKLGYEYV----------DFALEKGCGREVDGEVEVEIDELAYFVEKELKDRNVVLDGHL-----------------------------------SHLMPVDLVVVLRAHPRIIGERLRERGYSKEKIGENVEAELVDAILIEAIDEHENV--IEVDTTNKT--------EEIVEEIIGLIKSGVK... 161
51 -20.7001zp6_A mol:protein length:191 hypothetical protein Atu3015  ali model follow..  16  1MNMTDDL---GGNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDGYIKHGRIDPWLPQSHQQNRMIMQIAADVAGRYAKEGYFVILD-----------------GVVRPDWLPAFTALARPLH----------YIVLRTTAAEAIERCLDRGG--DSLSDPLVVADLHSQ----FADLGAFEHHVLPVSGKD-------TDQALQSAINALQSGRFRID 181
52 -20.2001grq_A mol:protein length:178 CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE  ali model follow..  12  2..........TTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDS----IEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLD------------------------LWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYD----------VEVDTTHKE----IECAWAIAAHV............ 176
53 -20.2003asy_A mol:protein length:211 Uridine kinase  ali model follow..  17  1......MSAPKPFVIGIAGGTASGKTTLAQALARTLGERVAL--------MDHYYKDLGRVNYDHPDAFDLALYLEHAQALLRGLPVEMPVYDFRAY----TRSPRRTPVRPAPVVILEGIL-VLYPKELRDLMDLKVFVDADADERFIRVLERGRSLEGVVA-QYLEQVKPMHLHFVEPTKRYADVIVPRG----GQNPVALEMLAAKALARLARMGA... 210
54 -19.6001xrj_A mol:protein length:261 Uridine-cytidine kinase 2  ali model follow..  16  9LQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILDSFYRVLTSFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSH----SRKEETVTVYPADVVLFEGIL-AFYSQEVRDLFQMKLFVDTDADTRLSRISERGRDLEQILS-QYITFVKPAFEEFCLPTKKYADVIIPRG----ADNLVAINLIVQHIQDILNGGP.... 233
55 -19.1001rz3_A mol:protein length:201 hypothetical protein RBSTP0775  ali model follow..  14  11CKTILAIKTAGRLVLGIDGLSRSGKTTLANQLSQTLREQGISVCVFH---MDDHIVERAKYYLQWDVEWLTHQLFRQLKASHQLTLPFYDHETDTHSKRTVYLSDSDMIMIEGVFLQRKEWRPFF---------DFVVYLDCPREIRFARENDQVKQNIQKFINRYWK-AEDYYLETEEPIKRADVVFDMTS.............................. 201
56 -18.8002jeo_A mol:protein length:245 URIDINE-CYTIDINE KINASE 1  ali model follow..  14  17.........MRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRQRKVVILDRFYKVLTAYNFDHPDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTH----SRLPETTVVYPADVVLFEGILVFYSQEIRDM--HLRLFVDTDSDVRLSRRVLRDGRDLEQILTQYTTFVKPAFEEFCLPTKKYADVIIPRG----VDNMVAINLIVQHIQDILNGDI.... 231
57 -18.8003lw7_A mol:protein length:179 Adenylate kinase related protein (AdkA-like)  ali model follow..  17  2............KVILITGMPGSGKSEFAKLLKER------AKVIVMSDVVRKRYSIEAKPGERLMDFAKRLR-------EIYGDGVVARLCVEELGTSNHDLVVFDGVRSLAEVEEFKRLLGDSV---------YIVAVHSPPKIRYKRMIERLRSDDSKEISELIRRDREELKLGIGEVIAMADYIIT-NDSNYEEFKRRCEEVTDRVLK.......... 179
58 -18.7002p0e_A mol:protein length:207 Nicotinamide riboside kinase 1  ali model follow..  11  13.........SKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVIS-------QDDFFKPESEIETALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFL------------------LFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPP-DSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTK--SEEDLFLQVYEDLIQEL........ 201
59 -18.3003t61_A mol:protein length:202 Gluconokinase  ali model follow..  13  7YKSEAAAVRRFPGSIVVMGVSGSGKSSVGEAIAEACGYPFI----EGDALHPPENIRKMSEGIPLTDDDRWPWLAAIGERLASREPVVVSCSALK--------------------RSYRDKLRESAPGG------AFVFLHGSESVLAERMHHRGHFMPSSLLQTQLETLEDPRGE-------VRTVAVDVAQ--------PLAEIVREALAGLARL..... 180
60 -18.2001knq_A mol:protein length:175 Gluconate kinase  ali model follow..  17  2.....STTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFL-DFLHPRRNIEKMLNDDDRKPW------LQALNDAAFAMQRTNKVSLIVCSALK--------------------KHYRDLLREGNPNL------SFIYLKGDFDVIESRLKARGHFFKTQMLVTQFETLQEPGAD------ETDVLVVDIDQ--------PLEGVVASTIEVIKKGK.... 175
61 -18.1005b3f_A mol:protein length:343 Phosphoribulokinase/uridine kinase  ali model follow..  14  26......RHSPLVYLIGVAGDSGSGKSTFTRAISDIFGEELVS--------VDDYHLYDRKTRSEMGITPLLHTANNLKLLEENLMDLKAGRTIQKPVYLHDHGTFGE-LFSPTKFIIIEGLHPYATKSLRAL--DYTIFVDPERDVKYDWMKKRNYDKNEVL--REILQREPDYFQYVFPQREVADAVIQISYSSYGKEEGEKRNVYRVMLSMPAQEYCFED 239
62 -18.0002qg6_A mol:protein length:199 Nicotinamide riboside kinase 1  ali model follow..  10  2..........KTFIIGISGVTNSGKTTLAKNLQKHLPNCSVIS-------QDDFFKPESEIETALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFL------------------LFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPP-DSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTK--SEEDLFLQVYEDLIQELAKQK.... 193
63 -17.9004eun_A mol:protein length:200 thermoresistant glucokinase  ali model follow..  15  15...QSMMTGEPTRHVVVMGVSGSGKTTIAHGVADETGLEFA-DAFHSPENIATMLTDEDRWPW------LRSLAEWMDARADAGVSTIITCSALK--------------------RTYRDVLREGPPSV------DFLHLDGPAEVIKGRMSKRGHFMPASLLQSQLATLEALEPD-------ESGIVLDLRQ--------PPEQLIERALTWLDIAP.... 189
64 -17.5003ch4_B mol:protein length:202 Phosphomevalonate kinase  ali model follow..  11  4....APLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQ-DTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRR------VSDIQWFREAYGAVT---------QTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDF-------------WVIE-NHGVEQRLEEQLENLIEFIRSRLK....... 195
65 -17.0002cdn_A mol:protein length:201 ADENYLATE KINASE  ali model follow..  13  6...SGLVPRGSHMRVLLLGPPGAGKGTQAVKLAEKLGIELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILD---------YPRSVEQAKALHE-------------MLERRGTDIDAVLEFRVSEEVLLERLKGRGRADD---TDDVILNRMKVYRD-----ETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK...... 195
66 -16.8004loa_A mol:protein length:173 De-novo design amidase  ali model follow..  17  1........MSLAKNIVFIGESGSGKSTLARALAKDLDLVFLIEQKFNQKASEIWEQYGWNFALEQEQKMADFFSSCEKACIATSGSFVNVSNLEKA--------------------------------------GFCIYLKADFEYLKKRLDKDEISKFPLFSDE--IKWKKHYNETLSKYEQKANFILNIENKNI-------DELLSEIKKVIK....... 165
67 -16.4001via_A mol:protein length:175 shikimate kinase  ali model follow..  19  1........MSLAKNIVFIGFMGSGKSTLARALAKDLDLVFLIEQKFNQKVSEIFEQKRENFFREQEQKMADFFSSCEKACIATGGGFVNVSNLEKA--------------------------------------GFCIYLKADFEYLKKRLDKDEISKRPLFYDE--IKAKKLYNERLSKYEQKANFILNIENKNI-------DELLSEIKKVIKE...... 166
68 -16.3001kag_A mol:protein length:173 Shikimate kinase I  ali model follow..  16  1........MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYIEKRTGADVGWVFDLEGEEGFRDREEKVINELTEKQGIVLATGGGSVKSRE----------------------------------TRNRLSARGVVVYLETTIEKQLARTQRDKKRPLLHVETPPREVLEALANERNPLYEEIADVTIRTDD-------QSAKVVANQIIHMLES...... 172
69 -16.1003akc_A mol:protein length:208 Cytidylate kinase  ali model follow..  14  4.............IVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVDPGDEEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFL-VVSAVARLPGVRAWVNRRLKEVPPPFVAEAVFPEAAHKFYLTASPEV---RAWRRARERPQAYEEVLRDLLRRDERDKAQSAPAPDALVLDTGGMTL---DEVVAWVLAHIRR.......... 208
70 -15.9004xrp_A mol:protein length:312 Pnkp1  ali model follow..  3...AKNNTHHFPKLLILVGAPGSGKSTFARYFIRTEDNWVRVNRDD----FRLMQFGDSLMSPFYEERITKMVEASVIALLKNRTNVIIDAT----------------NSSLRSLQDMVHTYTEYADIS-------FKVFDLPVEELVKRCDKRCEQTGKFIPKSAIEKHVTQLQY.............................................. 148
71 -15.9003trf_A mol:protein length:185 Shikimate kinase  ali model follow..  17  1.......MKKNLTNIYLIGLMGAGKTSVGSQLAKLTKRILYIEKRTGADIAWIFEMEGEAGFRRREREMIEALCKLDNIILATGGGVVLDEK----------------------------------NRQQISETGVVIYLTASIDTQLKRIGQKGEMRRPLFINNSKEKLQQLNEIRKPLYQAMADLVYPTDD---LNPRQLATQILVDIKQTYSDLE.... 180
72 -15.9001a7j_A mol:protein length:290 PHOSPHORIBULOKINASE  ali model follow..  15  1.......MSKKHPIISVTGSSGAGTSTVKHTFDQIFRREGVKAVSIE---GDAFHRGDATFSHFSYEANELKELERVFREYGETGQGRTRTYVHDDGVAPGNFTDWRDFDSDSHLLFYEGLHGAVVNSEVNIAGDLKIGVVPVINLWIQKIHRRGYTTEAVT--DVILRRMHAYVHCIVPQFSQTDINFQ................................ 207
73 -15.8003r20_A mol:protein length:233 Cytidylate kinase  ali model follow..  13  2....PGSMVSGSLVVAVDGPAGTGKSSVSRGLARALGARYLADLTDPAAIEKAAADAEIGVGSDPDVDAAFLAGEDVSSEIRGDAVTGAVSAVSAVPAVRTRLVDIQRKLATEGGRVVVEGRD--IGTVVLPDADVKIFLTASAEERARRRNAQNVANGLPDDYATVLADVQRRDHLDSTRPVSPLLVVDTSDMDQ---AQVIAHLLDLVTAQAGARR.... 233
74 -15.7004y0a_A mol:protein length:179 Shikimate kinase  ali model follow..  13  2.....SKAFETLPNIYLVGPMGAGKTTVGRHLAELLGREFLIERKTGATIPWIFEKEGEVGFRTRETVVLNELTSRKALVLATGGGAITQAP----------------------------------NREFLKQRGIVVYLYTPVELQLQRT-YRDKNRPLLQVENPEQKLRDLLKIRDPLYREVAHYTIETNQGA-------ARDLAQKILQLILSNK.... 177
75 -15.6003r8c_A mol:protein length:228 Cytidylate kinase  ali model follow..  13  2.........PGSMVVAVDGPSGTGKSSVAKELARQLGASYLVDLTDPAAIAAATDQVPMSVSSDPDAQTALLAGEDVSVPIRGNEVTGAVSAVSAVPAVRERLVRQQRELAESSGAVVVEGRD--IGTVVLPDADVKIYLTASAQARAQRRNAQNVSGGGDDEYEKVLADVQRRDHLDSTRAVSPLLEVDTSDMTQ---EQVVAHLLDLVRTRAGASR.... 228

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 0 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.