current user: public

If you have questions about the server, please let us know.

Query: gi|30260214|ref|NP_842591.1| hypothetical protein (BA_0020) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MMRGGMGNMNNMMKQMQKMQKEMAKAQEELGEKTVEGTAGGGMITVIANGHKQILEVKVKEEVVDPEDIEMLQDLVLAATNDALKKADELSNSTMGKFTKGLNLPGGMFLast
1 -40.5001pug_A mol:protein length:109 Hypothetical UPF0133 protein ybaB  ali model follow..  38  3....GKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLED-DKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGF. 105
2 -40.3001ybx_A mol:protein length:143 Conserved hypothetical protein  ali model follow..  57  34.....GGNINNLVKQAQKMQRDMERVQEELKEKTVEASAGGGAVTVVATGRKDIKEITIKPEVVDPDDVEMLQDLILAAVNEALRKADEMVTAEISKITGGLGGIPGLF 137
3 -39.3001j8b_A mol:protein length:112 YbaB  ali model follow..  38  6....GKGGLGGLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPSLMED-DKEMLEDLIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGM. 108
4 -39.3003f42_A mol:protein length:99 protein HP0035  ali model follow..  20  1....GHMDFSQLGGLLDGMKKEFSQLEEKNKDTIHTSKSGGGMVSVSFNGLGELVDLQIDDSLLE--DKEAMQIYLMSALNDGYKAVEENRKNLAFNMLGNFA...... 97
5 -38.5005yrx_A mol:protein length:139 Nucleoid-associated protein Rv3716c  ali model follow..  32  1..MQPGGDMSALLAQAQQMQQKLLEAQQQLANSEVHGQAGGGLVKVVVKGSGEVIGVTIDPKVVDPDDIETLQDLIVGAMRDASQQVTKMAQERLGALAGAMRPPA... 104
6 -7.2502m2k_A mol:protein length:131 HasB protein  ali model follow..  14  38................SRISGRLNRFKRYPKDALRLKRQGVGQVRFTLDRQGHVLAVTL----VSSAGLPSLDREIQALVKRA-SPLPTPPADAYVNGTVELTLP.... 121
7 -7.1705lw8_A mol:protein length:92 Protein TonB  ali model follow..  18  5...............LMKIQTAISSKNRYPKMAQIRGIEGEVLVSFTINADGSVTDIKV----VKSNTTDILNHAALEAIKSA.......................... 68
8 -6.4804n7r_C mol:protein length:310 Genomic DNA, chromosome 3, P1 clone: MXL8  ali model follow..  204.............EDIFRFCNVYVDLDFVVSETKMIWMDRLGFLRVWSPRGVYDVRIPFPMEV---TDEKGAKSSFNGMSQLAWEVEKSYCPADFNKV........... 286
9 -6.4703m9b_A mol:protein length:251 Proteasome-associated ATPase  ali model follow..  12  68......ARNSKLMETLKEARQQLLALREEVDRLGLLATHDDDTVDVFTSGRKMRLTCNIDAASLKKGQTVRLNEALTVVEAGTFEAVGEIST................. 163
10 -6.2304adz_A mol:protein length:136 CSOR  ali model follow..  13  49.............KQKAEHLKRLRRIEGQIRGLQRMVDEDVYCIDI-------LTQVSASTKALQSFALQLLEEHLRHCVADAALKGGTEIDAKVEEATKAI....... 130

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24