current user: public

If you have questions about the server, please let us know.

Query: gi|30260208|ref|NP_842585.1| deoxynucleoside kinase family protein (BA_0014) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTRWSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKGLFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINNFNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVKLast
1 -71.400d2jaqa_ c.37.1.0 (A:) automated matches {Mycoplasma mycoides [TaxId: 44101]}  ali model 3D-neighbors follow..  30  2.............KIAIFGTVGAGKSTISAEISKKLGYEIFKEPVEENPYFEQYYKDLKKTVFKMQIYMLTARSKQLKQA-KNLENIIFDRTLLEDP-IFMKVNYDLNNVDQTDYNTYIDFYNNVVLENNKLSFDIVIYLRVSTKTAISRIKKRGRSEELLIGEEYWETLNKNYEEFYKQNYDFPFFVVDAEL-DVKTQIELIMNKLNSI............ 201
2 -69.800d2vp4a_ c.37.1.1 (A:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  21  1...TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNK-KLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESI-HVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRCKVLVLDAD.............................. 197
3 -68.100d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  1..........RIKKISIEGNIAAGKSTFVNILKQLCEEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTEVPILTLDVNE-DFKDKYESLVEKVKEFLSTL........ 241
4 -47.300d1p6xa1 c.37.1.1 (A:23-352) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]}  ali model 3D-neighbors follow..  17  2..........TIVRIYLDGVYGIGKSTTGRVMASAASTLYFPEPMAETDVISGIYDTQNRITAHYQSRFTTPYLILHDHTCTPDLTLVFDRHPVASTVCFPAARYLLGDMSMCALMAMVATLP------REPQGGNIVVTTLNVEEHIRRLRTRARIGEQ-IDITLIATLRNVYFMLVNTCRSGRVWRDGWGELPTSCGAYKHRATQMDAFQ.......... 234
5 -47.300d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}  ali model 3D-neighbors follow..  14  1........MPTLLRVYIDGPHGMGKTTTTQLLVALGSIVYVPEPMTASETIANIYTTQHRLDTSAQITMGMPYAAGSSHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIP------PTLPGTNIVLGALPEDRHIDRLAKRQRPGER-LDLAMLAAIRRVYGLLANTVQCGGSWREDWGQLSGTAVPPQGAEPQSNAGPRPHIGDTLFT 245
6 -45.800d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-Zoster virus [TaxId: 10335]}  ali model 3D-neighbors follow..  15  3.........MGVLRIYLDGAYGIGKTTAAEEFLHHFAITLIGEPLSGEDAICGIYGDAQRLTAHFQSLFCSPHAIMHAKISAPYKIMLSDRHPIASTICFPLSRYLVGDMSPAALPGLLFTLP------AEPPGTNLVVCTVSLPSHLSRVSKRARPGET-VNLPFVMVLRNVYIMLINTIIFLKTNNWGWNTLSFCNDVFKQKLQKSECIKLREVPG.... 245
7 -35.300d3kb2a1 c.37.1.1 (A:2-165) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  17  2.............LIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFE------------------LAKSGNEKLFEHFNKLADEDNVIIDRFVYSN-LVYAKKFKDYSILTERQLRFIEDKIK---------AKAKVVYLHADPSVIKKRLRVRG---DEYIEGKDIDSILELYREVMSN-AGLHTYSWDTGQWS-------SDEIAKDIIFLVE....... 164
8 -29.900d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  14  2.............LIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPALHGEHGDLASSVYAMATLFALDRAGTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAW-----VQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGERDAELQQRTGAVYAELAAQGWGGRWLVVGADV--------DPGRLAATL............ 207
9 -26.700d2yoga_ c.37.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}  ali model 3D-neighbors follow..  16  2........KKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPIISKYLKMENSMSNETIHLLFSEHMNEIKSLLLKGIWVVCDRYAYSGVAY-------SSGALNLNKTWCMNP------DQGLIKPDVVFYLNVPPNYAQNRSDYGEEIYEK---VETQKKIYETYKHFA---HEDYWINIDATR----KIEDIHNDIVKEVTKIKVEPEEF.. 202
10 -26.000d1e2da_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  1.........RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPLLSSYLQKKSDVEDHSVHLLFSEQVPLIKEKLSQGVTLVVDRYAFSGVAF-------TGAKENFSLDWCKQP------DVGLPKPDLVLFLQLQLADAAKRGAFGHERYEN---GAFQERALRCFHQ-LMKDTTLNWKMVDASK----SIEAVHEDIRVLSEDAIATATE... 201
11 -24.900d4hlca_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}  ali model 3D-neighbors follow..  18  1...........SAFITFEGPEGSGKTTVINEVYHRLDVIMTREP--RKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAY-------QGYARGIGVEEVRALNEFAINGL---YPDLTIYLNVSAEVGRERIIKNSRDQNRQEDLKFHEKVIEGYQE-IIHNESQRFKSVNADQ----PLENVVEDTYQTIIKYLE....... 202
12 -24.700d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}  ali model 3D-neighbors follow..  13  3.........PKGINILITGTPGTGKTSMAEMIAAELDGFQH---LEVGKLVKE--YDTELDTHIIEEKDEDRLLDFMEPIMVSRGNHVVD--------------------------------YHSSELFPERWFHMVVVLHTSTEVLFERLTKRQYSEAKRAENMEAEIQCICEEEARDAYEDDIVLVREND------TLEQMAATVEEIRERVEVLK.... 174
13 -23.800d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}  ali model 3D-neighbors follow..  15  2...........KKLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHMVVGGYRPPWESDELLAL-TWKNITDLTVNFLLAQNDVVLDYIAFPDEA---EALAQTVQAKVDDVEIR------------------FIILWTNREELLRRDALRKKDEQMG------ERCLELVEEFESKGIDERYF-YNTSHLQ--------TNLNDIVKNLKTNPRFIFC 176
14 -22.800d4s35a_ c.37.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}  ali model 3D-neighbors follow..  16  2.............LIAFEGIDGSGKTTQAKKLYEYLFVSLYREPTKVGEVLREILLTEELDERTELLLFEASRSKLIEEKLKRDKVVILDRFVLSTIAY-------QGYGKGLDVEFIKNLNEFATRGV---KPDITLLLDIPVDIALRRLKEKNRFENK----EFLEKVRKGFLELAKEEEN--VVVIDASG----EEEEVFKEILRALSGVLR....... 194
15 -22.200d1nksa_ c.37.1.1 (A:) Adenylate kinase {Sulfolobus acidocaldarius [TaxId: 2285]}  ali model 3D-neighbors follow..  14  2............KIGIVTGIPGVGKSTVLAKVKEILDNQ-FMLATALKLGYAKDRDEMRKLSVEKQKKLQIDAAKGIAEEARAGG----EGYLFIDTHAVIRT--PSGYLPGLPSYVITEI-----------NPSVIFLLEADPKIILSRQKRDTTRNRNDYSDESVINFARYAATASAVLAGSTVKVIVNVEGDP-------SIAANEIIRSMK....... 194
16 -22.000d4edha_ c.37.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}  ali model 3D-neighbors follow..  13  1..........TGLFVTLEGPEGAGKSTNRDYLAERLEVQLTREPTPLAERIRELLLAPSDEPMAADTELLLMFAGVIRPALARGAVVLCDRFTDATYAY-------QGGGRGLPEARIAALESFVQGDL---RPDLTLVFDLPVEIGLARAAARGRLDREQEDRRFFEAVRQTYLQ-RAAQAPERYQVLDAGL----PLAEVQAGLDRLLPNLLERLN.... 208
17 -21.700d3ld9b1 c.37.1.0 (B:1-201) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}  ali model 3D-neighbors follow..  16  2.............FITFEGIDGSGKTTQSHLLAEYLNVVLTREP--RNLLFKAQGLDSLSELLFFIAMRREHFVKIIKPSLMQKKIVICDRFIDSTIAY-------QGYGQGIDCSLIDQLNDLVI-----VYPDITFIIDVDINESLSRSCKNGYEFA---DMEFYYRVRDGFYD-IAKKNPHRCHVITDKS--------ETYDIDDINFVHLEVIKVL.. 199
18 -21.500d3iija1 c.37.1.1 (A:1-172) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  6..............ILLTGTPGVGKTTLGKELASKSGLKYI-DLAREEQLYDGYDEEYDCPILDED------RVVDELDNQMREGGVIVDYHGCD---------------------------------FPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPE--ELENNVDQILKWIEQWIKDHN.... 171
19 -21.200d1khta_ c.37.1.1 (A:) Adenylate kinase {Methanococcus voltae [TaxId: 2188]}  ali model 3D-neighbors follow..  15  1...........NKVVVVTGVPGVGSTTSSQLAMDNLRKE-VMFEVAKEENLVSDRDQMRKMDPETQKRIQKMAGRKIAEMAKESPVAVDTHSTVST---------PKGYLPGLPSWVLNEL-----------NPDLIIVVETTGDEILMRRMSRVRDLDTASTIEQHQFMNRCAAMSYGVLTGATVKIVQNRN-------GLLDQAVEELTNVLR....... 190
20 -20.200d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}  ali model 3D-neighbors follow..  12  2..........TTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDS----IEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLD------------------------LWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYD----------VEVDTTHKE----IECAWAIAAHV............ 176
21 -20.200d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  16  3..........GGNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDGYIKHGRIDPWLPQSHQQNRMIMQIAADVAGRYAKEGYFVILDGVVRPDW---------------------------LPAFTALARPLHYIVLRTTAAEAIERCLDRGG--DSLSDPLVVADLHSQ----FADLGAFEHHVLPVSGKD-------TDQALQSAINALQSGRFRID 176
22 -19.800d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1..........EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILDSFYRVLTSFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSH----SRKEETVTVYPADVVLFEGIL-AFYSQEVRDLFQMKLFVDTDADTRLSRISERGRDLEQILS-QYITFVKPAFEEFCLPTKKYADVIIPRG----ADNLVAINLIVQHIQDILNG...... 213
23 -18.600d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  14  11CKTILAIKTAGRLVLGIDGLSRSGKTTLANQLSQTLREQGISVCVFH---MDDHIVERAKYYLQWDVEWLTHQLFRQLKASHQLTLPFYDHETDTHSKRTVYLSDSDMIMIEGVFLQRKEWRPFF---------DFVVYLDCPREIRFARENDQVKQNIQKFINRYWK-AEDYYLETEEPIKRADVVF.................................. 197
24 -18.500d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  12  8............KTVAILGGESSGKSVLVNKLAAVFNTTSAWE-YGREFVFEKLGGDEQAMQYSDYPQMALGHQRYIDYAVRHSHKIAFIDTDFITTQAFCIQ-------------YEGKAHPFLDSMIKEYPFDVTILLKNNTEWVDDGLRSLGSQKQR-------QQFQQLLKKLLDKY-KVPYIEIESPSYL-----DRYNQVKAVIEKVLNEEE.... 186
25 -17.800d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  11  2...........KKIILTIGCPGSGKSTWAREFIAKINRDDYRQSIMAHEERDEYKYTKKKEGIVTGM--QFDTAKSILYGGDSVKGVIISDT----------------NLNPERRLAWETFAKEYGWKV------EHKVFDVPWTELVKRNSKRG---TKAVPIDVLRSMYKSMRE.............................................. 145
26 -16.200d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  4.........HDHHIYVLMGVSGSGKSAVASEVAHQLHAAFL-DFLHPRRNIEKMLNDDDRKPW------LQALNDAAFAMQRTNKVSLIVCSALK--------------------KHYRDLLREGNPNL------SFIYLKGDFDVIESRLKARGHFFKTQMLVTQFETLQE-------GADETDVLVVDID--------QPLEGVVASTIEVIKK...... 171
27 -16.100d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  19  1............KNIVFIGFMGSGKSTLARALAKDLDLVFLIEQKFNQKVSEIFEQKRENFFREQEQKMADFFSSCEKACIATGGGFVNVSNLEKA--------------------------------------GFCIYLKADFEYLKKRLDKDEISKRPLFYDE--IKAKKLYNERLSKYEQKANFILNIEN-------KNIDELLSEIKKVIK....... 161
28 -16.100d3akea_ c.37.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}  ali model 3D-neighbors follow..  14  4.............IVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVDPGDEEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFL-VVSAVARLPGVRAWVNRRLKEVPPPFVAEAVFPEAAHKFYLTASPEV---RAWRRARERPQAYEEVLRDLLRRDERDKAQSAPAPDALVLDTGGMTL---DEVVAWVLAHIRR.......... 208
29 -15.900d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]}  ali model 3D-neighbors follow..  15  1........SKKHPIISVTGSSGAGTSTVKHTFDQIFRREGVKAVSIE---GDAFHRGDATFSHFSYEANELKELERVFREYGETGQGRTRTYVHDDGVAPGNFTDWRDFDSDSHLLFYEGLHGAVVNSEVNIAGDLKIGVVPVINLWIQKIHRRGYTTEAVT--DVILRRMHAYVHCIVPQFSQTDINFQ................................ 206
30 -15.700d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  1..........EKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYIEKRTGADVGWVFDLEGEEGFRDREEKVINELTEKQGIVLATGGGSVKSRE----------------------------------TRNRLSARGVVVYLETTIEKQLARTQRDKKRPLLHVETPPREVLEALANERNPLYEEIADVTIRTDD-------QSAKVVANQIIHMLE....... 169
31 -15.500d2iyva2 c.37.1.2 (A:2-176) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  17  1...........APKAVLVGLPGSGKSTIGRRLAKALGVGLLIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSP-----------------------------------GVRAALAGHTVVYLEISAAEGVRRT-GGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRN-------PGAVVRHILSRLQVPS.... 169
32 -15.400d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  1...........PLVVFVLGGPGAGKGTQCARIVEKYGYERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLID---------FPRNQDNLQGWNKT---------------DGKADVSFVLFFDCNNEICIERCLERGKSSGR--SDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKE..... 193
33 -15.400d2c95a1 c.37.1.1 (A:1-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  2.....EEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDMVAKVNTSKGFLID----------------------------REVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGR--VDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDAL..... 193
34 -15.000d2h92a_ c.37.1.1 (A:) CMP kinase {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  16  3.............NIALDGPAAAGKSTIAKRVASELSMIYVDT--------GAMYRALTYKYLKLNKTEVDQTTLDLTYKADKGQCVILDNEDVTDFL-HVSYVASKEPVRSFAVKKQKELAAE-IGTVVLPDADLKVYMIASVEERAERRYKDNQLRGIESNFEDLKRDIEARDQYDMNREISPLVTLDTTGKSIEEVTDEILAMVSQI............ 216
35 -15.000d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}  ali model 3D-neighbors follow..  16  5..............IFMVGARGCGMTTVGRELARALGYEFV--QHTSGMTVADVVAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQ----------------------------------NRQFMRAHGTVVYLFAPAEELALRLQASLQAHQRPTGRPIAEEMEAVLREREALYQDVAHYVVDATQ--------PPAAIVCELMQTMR....... 169
36 -14.700d1yj5a2 c.37.1.1 (A:351-522) 5` polynucleotide kinase-3` phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  11  4.PESSSLLSPNPEVVVAVGFPGAGKSTFIQEHLVSAGYVHVNRD---------------------TLGSWQRCVSSCQAALRQGKRVVIDNT----------------NPDVPSRARYIQCAKDAGVPC------RCFNFCATIEQARHNNRFREMPSHAPVSDMVMFSYRKQFEPPTLAEGFLEILEIPFRLQEH--LDPALQRLYRQFSE.......... 171
37 -14.700d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  3...........APVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEI-AASQVAAFPRVREALLRRQRAFREL-MGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFERLLAEIKERDDRDRNRAVAPLLVLDSTTLSI---EQVIEKALQYARQKLA....... 223
38 -14.100d3hr7a_ c.37.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}  ali model 3D-neighbors follow..  13  2............QHLVLIGFMGSGKSSLAQELGLALKLEVLISERVGLSVREIFEEL--------EDNFRMFEKNLIDELKTLKTPHVISTG--------------------------------IVMHENLKGLGTTFYLKMDFETLIKRLNQKEREKRPLLN---LTQAKELFEKRQALYEKNASFIIDARG----GLNNSLKQVLQFI............ 161
39 -13.900d3r20a_ c.37.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  13  3.............VVAVDGPAGTGKSSVSRGLARALGARYLADLTDPAAIEKAAADAEIGVGSDPDVDAAFLAGEDVSSEIRGDAVTGAVSAVSAVPAVRTRLVDIQRKLATEGGRVVVEGRD--IGTVVLPDADVKIFLTASAEERARRRNAQNVANGLPDDYATVLADVQRRDHLDSTRPVSPLLVVDTSDMDQ---AQVIAHLLDLV............ 217
40 -13.600d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  2............RHVFLTGPPGVGKTTLIHKASEVLKSSGVP-------YTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYV---------VDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRN-----HLLPDIVTCVQSSRK....... 189
41 -13.600d4gi7a_ c.37.1.6 (A:) automated matches {Klebsiella pneumoniae [TaxId: 507522]}  ali model 3D-neighbors follow..  15  73...LGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRHVE----TDGFLHPNSVLK-SYDMHRLVKFVSDLKSGVPQATAPVYSHLIYDDILILEGLNVLQSGMDYPHDPHHVFVSDFV---------DFSIYVDAPEELLKSWYINRKEEAVDIATSLWNEINLMNLKENILPTRERASLIMTKSANHSVNQ....................... 304
42 -13.500d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  12  3..............LVLMGLPGAGKGTQAEKIVAAYGIDMFRAAMKEGTPLGLQAKQYMDRGDLVPDEVTIGIVRERLSKDDCQNGFLLD---------FPRTVAQAEALET-------------MLADIGRKLDYVIHIDVRQDVLMERLTXADDNEA--TVANRLEVNMKQMKPLVDFYEQKGYLR--------INGEQDMEKVFADIRELLGGLAR... 183
43 -13.200d3taua_ c.37.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 1639]}  ali model 3D-neighbors follow..  14  2.........ERGLLIVLSGPSGVGKGTVREAVFKDPETSFDYSISMTTRLPREGEQDGVDYYFRSREVF---------EQAIKDGKMLEYAEYVGNYYGTPLEYVEEKLAAGVDIFLEIEVQGAMQVRKAMPEGIFIFLTPPDLSELKNRIIGRGTESMEVVE----ERMETAKKE-----------IEMMASYDYAVVNDVVANAVQKIKGIVETEH.... 186
44 -13.100d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  12  1...........SRPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEF---------KSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIA-SVEDLKKRLEGRGTETEESINKRLSAAQAE-------------LAYAETGAHDKVIVNDDLDKAYKELKDFIFAEK.... 186
45 -13.100d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  13  3..............IIITGEPGVGKTTLVKKIVERLGKRA---------WTEEVRDPETKKRTGFRIITTEGKKKIFSSKFFTSKKLVGSYGVNVQYF-----------------ELAIPILERAYREAKKDRRKVIIIMELFSKKFRDLVRQIMHDPNVNVVATIPIRDVHPLVKEIRRLPGAVLIELT---------PENRDVILEDILSLLER...... 178
46 -12.900d3lnca_ c.37.1.0 (A:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}  ali model 3D-neighbors follow..  11  1......MLKSVGVILVLSSPSGCGKTTVANKLLEKQKNNIVKSVSVTTRAARKGEKEGKDYYFVDREEF---------LRLCSNGEIIEHAEVFGNFYGVPRKNLEDNVDKGVSTLLVIDWQGAFKFMEMMREHVVSIFI--SMEELRRRLCGRRADDSEVVEARLKGAAFE---------------ISHCEAYDYVIVNEDIEETADRISNILRAEQ.... 189
47 -12.600d1z6ga_ c.37.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}  ali model 3D-neighbors follow..  12  1..........NIYPLVICGPSGVGKGTLIKKLLNEFPNYFYFSVSCTTRKKREKEKEGVDYYFIDK-----TIFEDKLKNEDFLEYDNYANNFYGTLKSEYDKAKEQNKICLFEMNI-----KQLKKSTHIKNALYIFIKPPSTDVLLSRLLTRNTENQEQIQKRMEQLNIE-------------LHEANLLNFNLSIINDDLTLTYQQLKNYLLNSY.... 188
48 -12.600d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  18.........PSMRPVVLVGPSLKGYEVTDMMQKALFD------------------FLKHRFEGRISITRVTADISLAKRSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAA-------------DKLAQCPPQESFDVILDENQLEDACEHLADYLEA...... 199
49 -12.300d2yvua_ c.37.1.0 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]}  ali model 3D-neighbors follow..  15  1......KCIEKGIVVWLTGLPGSGKTTIATRLADLL--------QKEGYRVEVLDGDWARTTVSEGAGFTREERLRHLKRIAWIARLLARNGVIVICSFVSPYKQARNMVRRIVEEEGIPFLE--------------IYVKASLEEVIRRDPKGLYKKALKGELENFTGITDPYEP-----PENPQLVLDTESNTI---EHNVSYLYSLVKAVIE....... 179
50 -12.200d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  12  1.........KHPIIIGITGNIGSGKSTVAALLRSWFPEAVVGGRLDRRALARLVFSDPERLKALEAVVHPEVRRLLMEELSRLEAPLVF---------LEIPLLFEKGWEG-----------------------HGTLLVAAPLEERVRRVMARSGLSREEVLARERAQMPEEEKRKRATW------VLE-NTGSLEDLERALKAVLAELTG.......... 191
51 -12.200d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]}  ali model 3D-neighbors follow..  13  4.........ARLLRAAIMGAPGSGKGTVSSRITKHFELKHLSS------------------------DLLRDNMLRGTEIGVLAKTFIDQGKLIPDDVMTRLVLHELKNLTQYNWLLFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTXDRPETVVKRLKAYEAQTEPVLEYY----KKGVLETFSGTETN-----KIWPHVYAFLQTKLPQRSQ... 184
52 -12.100d3tr0a_ c.37.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}  ali model 3D-neighbors follow..  17  1.........NKANLFIISAPSGAGKTSLVRALVKAISHTTRPKRPGDQEGVDYFFIDETRFQAMVKEGAFLEHAT-----------------IYERHYGTEKDWVLRQLKAGRDVLLEIDWQGARQIRELFPPALSIFILPPSIEALRERLIKRRQDDTAIIEQRLALAREE---------------MAHYKEFDYLVVNDNFDQAVQNLIHIISAER.... 184
53 -12.000d1m7ga_ c.37.1.4 (A:) Adenosine-5`phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}  ali model 3D-neighbors follow..  17  14.SERTELRNQRGLTIWLTGLSASGKSTLAVELEHQL----VRDRRVHAYRLD---GDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPY--------RKDRDTARQLHEVATPGEETGLPFVEVYVDVPVEVAEQRLYKKAREGV----IKEFTGISAPYEA-----PANPEVHVKNYELPV-------QDAVKQIIDYLDTKGYL.. 205
54 -11.900d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  17  16IPEWFETGNKCPLFIFFSGPQGSGKSFTSIQIYNHLMEKYGGEKSIGYASIDDFYLTHE------DQLKLNEQFKNNKLLQGRGLPGTHDMKLLQEVLNTIFNNNEHPDQDTVVLPKYDKSQFKGEGDRCKLPVDIFIL................................................................................... 154
55 -11.900d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}  ali model 3D-neighbors follow..  12  4.........TQGFTIFLTGYMNSGKDAIARALQVTLNQQ-------GGRSVSLLLGDTVRHELSSELGFTREDRHTNIQRIAFVATELTRAGAAVIAAPIAP---------------YEESRKFARDAVSQAGSFFLVHVATPLEHCEQSDKRGIYAAARRGEIKGFTGVDDPYET-----PEKADLVVDFSKQSV-------RSIVHEIILVLESQGFLER 182
56 -11.800d1dvra1 c.37.1.1 (A:1-130,A:169-220) Adenylate kinase {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  10  2.........SESIRMVLIGPPGAGKGTQAPNLQERFHADMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIDELTNNPACKNGFILV---------FPRTIPQAEKLDQ-------------MLKEQGTPLEKAIELKVDDELLVARITXNADALKKRLAAAQTEPIVDFYKK------TGIWAGVDASQ--------PPATVWADILNKLGK...... 182
57 -11.700d2grja1 c.37.1.1 (A:1-176) Dephospho-CoA kinase {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  17  2.............VIGVTGKIGTGKSTVCEILKNKYGAHVV-GKVNRKKLAGIVFESRENLKKLELLVHPLMKKRVQEIINKTSGLIVIEAALLKRMGLDQLC-------------------------------DHVITVVASRETILKRNREADRRLKFQEDIVPQGIVVA-------------------NNSTLEDLEKKVEEVMKLV............ 175
58 -11.600d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}  ali model 3D-neighbors follow..  11  24...QGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDT-NFDELVKLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTA----TMLQAKGYET-------------------MYVMAVPKINSYLGTIERARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREG............................. 207
59 -11.200d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  1..........CPTLIVMVGLPARGKTYISKKLTRYLNVGQYRRDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEGGHVA--------------VFDATNTTRERRAMIFNFGEQNGYKT------FFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENESLDEEQDRDLSYIKIMDVGQSYVNRVADHIQSR..... 200
60 -10.900d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  11  44...AGKDGSGVFRAAMLYGPPGIGKTTAAHLVAQELGYDILEQNASDVRSKTLLNAGVKNALDNMSVVGYFKHNEEAQNLNGKHFVIIMDEV--GDRGGVGQLAQFCRKTSTPLILICNERNLPKMRPFDRVCLDI--FRRPDANSIKSRLMTIAIREKFKLDPNVIDRLIQTTRGDIRQINLLSTISTTTKTINHENINEISKAWEKNI............ 253
61 -10.800d2vhja_ c.37.1.11 (A:) automated matches {Pseudomonas phage [TaxId: 161736]}  ali model 3D-neighbors follow..  15  126..............VIVTGKGNSGKTPLVHALGEALGGKDKYATVRFGEPLSGYNTDFN------------VFVDDIARAMLQHRVIVID-----SLKNVIGAAGGNTTSGGISRGAFDLLSDIGAMAASRGCVVIAS-PTSNDDKIVELVKEADVDGEWQVLTRTGEGLQRLTHTLQTSYGEHSVLTIHTSK............................. 300
62 -10.800d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  21  27.....KLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQ---GNVKSPTYLVEEYNIAGKMIYHFDLYRLADPEELIRDYFNTDSICLIE.................................................................................................................................... 113
63 -10.800d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  11  2............KLIFLSGVKRSGKDTTADFIMSNYSAVKYQ------------LAGPIKDALAYAWGVFAANTDYPCLTRKEFEGIDYDRETNLNLT-LMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVIT---NDGSLEELFSKIKNTLKVL............ 241
64 -10.200d4zo4a1 c.37.1.0 (A:2-201) automated matches {Campylobacter jejuni [TaxId: 192222]}  ali model 3D-neighbors follow..  11  1...........KNAFFVTASIACGKSTFIEIANS-LGFKSISADKIAHKILDENALELEKIFSPFSLKNLLKK-KILGEIVFNNKEAKKILENFTHPKIRAKILEQMQILDKENKAFFVEI-PLFFESGAYENLGKVIVIYTPKELSLKRIMQRDKLSLEAAKARLDSQIDIEEKLKKADF------IIK-NTNSYADFRQECVKVIQEISK.......... 197
65 -10.200d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  12  2...........TYIVGLTGGIGSGKTTIANLFTD-LGVPLVDADVVAREVVAKDSPLLSKIVEHFGAQILTEQGELNRAALRE------DKLWLNNLLHPAIRERMKQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSAQRDNNNFEQIQRIMNSQVSQQERLKWADD------VIN-NDAELAQNLPHLQQKVLELHQFYLQQ..... 200
66 -9.850d4ttra_ c.37.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}  ali model 3D-neighbors follow..  13  4.............SVGLTGNIASGKSTVAEFFSE-LGINVIYADKIAKELTSKNTPCYQDIISHFGSSVVLDRKRIRDIIFSNSNERLWLESLLHPVI--RKKIEEQLIVCTSPYCLIE--IPLLFNKHHYPYLQKVLLVIAPLESQLDRIVKRDHCTKKQALAILATQPNLEQRLEAADD------VLI-NESGLSELKAKVNKLHQKYLREAKIKQ.... 201
67 -9.400d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  1.........HMRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQM----------MQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAPT---ITPGLNEDESLQRLQKES--DILQRTYAHYF----------------DLTIINNEIDETIRHLEEAVELV..... 177
68 -9.130d4ixna1 c.37.1.10 (A:1-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  12  1........MNPIAVTLLTGFLGAGKTTLLRHILNEYKIAVIANEFGEVSVDDQLIGDRATQIKTLTEDALLDLLDNLDKGNIQFDRLVIECTGMADPGPIIQTFFSHEVLCQDAVHADEQMNQFTIAQSQVGYADRILLTKTDVAGEAEKLHERLARINARAPV.......................................................... 182
69 -9.120d1yrba2 c.37.1.10 (A:1-245) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}  ali model 3D-neighbors follow..  11  2.............IVVFVGTAGSGKTTLTGEFGRYLEDN-VREFVTVEEIMREGYGPNGAIVESYDRLMFNEYLNKILRLEKENDYVLIDVRLMENLPYPLVVYISDPEILKKPNDYCFVRFFALLIDLRLGATTIPALNKVDLLSEEEKERHRKYFEDIDYLTARLKLDPSMQGLMAYKMPPVRVLYLSAKT------REGFEDLETLAYEHYCT...... 243
70 -9.020d2d2ea_ c.37.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}  ali model 3D-neighbors follow..  12  22.....NLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEIENILELSPDERARKGLFLAFQYPVEVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYIQPDKVHVMMDGRVVATGGPELALELEAKGYEWLKEK..... 244

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.