FFAS03 results for 30260198

Query: gi|30260198|ref|NP_842575.1| hypothetical protein (BA_0003) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.

						`. 10 . 20 . 30 . 40 . 50 . 60 . 70`
#	Score	Template	Links and tools	%id	First	`MKRIKISTEYITLGQFLKLADVIDTGGAVKWFLQEYEVYVNQELENRRGRKLYANDIIEIPGSGSFQVQS`	Last
1	-37.100	`[S] COG2501 Uncharacterized conserved protein`	`ali follow..`	67	2	`ANPISIDTEMITLGQFLKLADVIQSGGMAKWFLSEHEVLVNDEPDNRRGRKLYVGDVVEIEGFGSFQV..`	69
2	-22.900	`[J] COG1188 Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog)`	`ali follow..`	14	5	`......SSVEVRLDKWLWAARFYKTRAMAREMIEGGKVHYNGQRS-KPSKIVELNATLTLR.........`	58
3	-19.700	`[J] COG0522 Ribosomal protein S4 and related proteins`	`ali follow..`	14	97	`...........RLDNVVYRMGFGATRAESRQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAK.....`	150
4	-17.700	`[S] KOG4837 Uncharacterized conserved protein`	`ali follow..`	20	74	`.KVVKTKVNSLRADLLLK-AGLGMARNKVELNFYESKIRVNGKKLPKKSAQLEVGDEIDV..........`	131
5	-17.200	`[J] KOG3301 Ribosomal protein S4`	`ali follow..`	8	108	`...........RLQTQVFKLGLAKSIHHARVLIFQRHIRVGKQIVNVPSFVVRLDTQKHID.........`	157
6	-16.400	`[S] COG2302 Uncharacterized conserved protein, contains S4-like domain`	`ali follow..`	15	172	`WEEMGLTVSSMRLDVIISNA-HHISRQKAKQLVTAGLVKVNWKTVENPDFECEEEDVLSARGYGRVKVLS`	240
7	-15.700	`[A] KOG4655 U3 small nucleolar ribonucleoprotein (snoRNP) component`	`ali follow..`	13	128	`...........SYNHFPLAVRMSEHLKAATDLIEHGHVRVGPEMIKDPAFLVSRNDFVTWVDGS......`	182
8	-13.600	`[S] COG4332 Uncharacterized protein conserved in bacteria`	`ali follow..`	10	143	`..........LRLDRLLA-SELGISRSRLQTLAERRLLVVDPDGAKALRKPARQGMTIRID.........`	192
9	-12.100	`[J] COG1187 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases`	`ali follow..`	18	60	`......LVEGEKLQKVLARAGQG-SRREIEAMIAENRVSVDGKIATLGDRDVHAGVKIRIDGHLINLLHA`	123
10	-12.100	`[J] COG0564 Pseudouridylate synthases, 23S RNA-specific`	`ali follow..`	16	17	`......EQLTGRLDKGLVSYNGAYSRAFYQQQIELGRVRVNGRVYTRVSHPLSLGDVVEVE.........`	71
11	-11.300	`[J] COG0162 Tyrosyl-tRNA synthetase`	`ali follow..`	15	331	`.......EGEMGLANLLKEAGLVASTSEANRMVQQGGVKIDGEKVEDAKLVIKASTAVYQVGKR......`	387
12	-10.100	`[J] COG1471 Ribosomal protein S4E`	`ali follow..`	17	40	`.......ENSLPLMIIVRILKVADNAREARKIINSGEVLVDGRPRKNYKFPVGFMDVVSIPRTG......`	97
13	-9.220	`[J] KOG2623 Tyrosyl-tRNA synthetase`	`ali follow..`	8	376	`.......KKENVATMGQLADASRLGSGKGHLLMQQGAFSVNGEKKRSPSESIADVFLENASDLTLVCW..`	436

FFAS is supported by the NIH grant R01-GM087218-01

jobs submitted since Jan 1, 2011

Comments and questions to: webmaster