current user: public

If you have questions about the server, please let us know.

Query: gi|30260202|ref|NP_842579.1| inosine 5`-monophosphate dehydrogenase (BA_0008) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .
# Score Template Links and tools%idFirst MWESKFVKEGLTFDDVLLVPAKSDVLPREVSVKTVLSESLQLNIPLISAGMDTVTEADMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSESGVISDPFFLTPEHQVYDAEHLMGKYRISGVPVVNNLDERKLVGIITNRDMRFIQDYSIKISDVMTKEQLITAPVGTTLSEAEKILQKYKIEKLPLVDNNGVLQGLITIKDIEKVIEFPNSAKDKQGRLLVGAAVGVTADAMTRIDALVKASVDAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAGNVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGVPQLTAVYDCATEARKHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEIYQGRQFKVYRGMGSVGAMEKGSKDRYFQEGNKKLVPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFLRENAQFIRMSGAGLLESHPHHVQITKEAPNYSLLast
1 -117.000[F] KOG2550 IMP dehydrogenase/GMP reductase  ali follow..  41  27.......ADDLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKNFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTGSKLVGIVTSRDIDFLAEKDLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVFHSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDPMEKSSSSQYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSELKFEKRTMSPQIEGGVHGLHSYEKR..... 512
2 -91.400[F] COG0516 IMP dehydrogenase/GMP reductase  ali follow..  71  1.............................................................................................................................................................................................................KVIEFPNSAKDKHGRLLAAAAVGITNDTFVRVEKLIEAGVDAIVIDTAHGHSAGVINKISEIRQTFKDVVIVAGNVATAEGARALFEVGVDIVKVGIGPGSICTTRVVAGVGVPQITAIYDCATVAREFGKTIIADGGIKYSGDIVKALAAGGNAVMLGSMLAGTDESPGETEIFQGRQFKTYRGMGSLAAMEHGSKDRYFQADAKKLVPEGIEGRVPYKGSVADIIFQLVGGIRSGMGYTGSPDLRHLREEAAFVRMTGAGLRESHPHDIQITKEAPNYSI 282
3 -15.500[G] COG3010 Putative N-acetylmannosamine-6-phosphate epimerase  ali follow..  16  87........................................................................................................................................................................................................................................FLQDIEELAAAGADIIAFDGTDRVRPTTREAI--IKRIKELGCLAMADCSNFEEGMYCHNLGVEII----------STMSGYTGGEIPAEPDYQLVKDLNAAGCRVMAEGRYNTPELAKTAIEIGAYSVTVGSALTRLEH................................................................................................................... 215
4 -14.600[R] COG2070 Dioxygenases related to 2-nitropropane dioxygenase  ali follow..  10  4...............................IFDPLVIRGKSLTPIVQGGMGVVSASGLSSAVARENGIGTI--DLRHLHEDLLAESQINPSEEKYTSLNCTALDREIQKAKSASEGKGLIAVNVMK-----------------------------------------------------------------------------------------------------AVKDHAAYVRQACESGADAVVMGAGLPLDLPEMTEGYHKD-------ALLPILSESRGINIVLILPDAIVHAA-GHLGASTVEGVNDAKFDFKRVIEETFEVLESEKIPLILAGGMANFEKVKTALNWGASAVQIGTAFAVTEEGDAHLNFKKGLPARGVRSKFLDSDIQLAAAFRGEVDKGLFFRGKDPLPFGNAIRTVRETIQYLLTGSEPVAT........................................... 388
5 -13.700[C] COG1304 L-lactate dehydrogenase (FMN-dependent) and related alpha-hydroxy acid dehydrogenases  ali follow..  15  41...........DLENIALRQRVLK-DMSELDTSIELFGE-KLSMPTILAPVGA-GEVQAAQAADNKGVPFTLSTVSICP-----IEEVAPAIKRPMWFQLYVLKDRGFMKNALERAKAAGCSTLVFTVDMP-------------------------------TPGARYRDMHSGMSGPYKEIRRVLQGFTHPFWAYDVGIKGKPHTLGNVSTYMGRQIGLDDYIGWLTENFDPSIS-------------------------KDLEWIREFWEGPMVIKG-ILDPEDAKDAVRFGADGIVVSNHGG-----RQLDGV-LSSARALPPIADAVKG-DIKIIADSGIRNGLDIVRMLALGADATMLGRAFVYALGAEGR---------------------------------------QG----------VENMLDIFKKEMHVAMTLTSNRTIADIKPE.............................. 373
6 -12.900[C] KOG0538 Glycolate oxidase  ali follow..  26  214.....................................................................................................................................................................................................................................................................KDIKWLQSIT-SLPILVKGVITAEDARIAVEYGAAGIIVSNHGA-----RQLDYV-PATIVALEEVVKAVEG-RIPVFLDGGVRRGTDVFKALALGASGVFVGRPSLFSLAADGE---------------------------------------AG----------VRKMLQMLRDEFELTMALSGCRSLREISRT.............................. 352
7 -11.600[K] COG4109 Predicted transcriptional regulator containing CBS domains  ali follow..  15  158..........................................ELPILSTSYDTFTVATMINRAIYDQ---IKKEVVFVEDILTPLETT-----------AYLSTSDKVEDWHKMEEATGHSRFPVV--NRAMRLTGMVTSKDILEKNPSISIERVMT--KNPLTVGPKMSVASVAHMMIWESIEVIPVVKDDLTLIGIVSRQDILKSMQMIQKQPQVGETIDDTIAKADTGEEADYEFKVSPQMTNSLGTLSYGVFTQVVCEVVQQKLFSMKKRNVAIENVTMYFQMDATIVIKPRILEMGRKAGKLDVELYLEGILTGKAIVACQMME.............................................................................................................................................................. 436
8 -11.500[H] COG2022 Uncharacterized enzyme of thiazole biosynthesis  ali follow..  21  158..........................................................................................................................................................................................................................................................................................DPVLCKRLEEVGCAAVMP---------APIGSNQGLETRAMLEIIIQQAT---VPVVVDAGIGVPSHAAQALEMGADAVLVNTAIAVADD-------------PVNMAKAFRLAVEAGLLAPQSGPGSRSYFAHATS---PLTGFLEASV....................................................... 281
9 -11.300[K] COG1954 Glycerol-3-phosphate responsive antiterminator (mRNA-binding)  ali follow..  15  1......................................................................................................................................................................................MPXLHLLRQNPVIAAVKDNASLQLAIDSECQF--------ISVLYGNICTISQIVKKIKNAGKYAFIVDLLEGASNKE-VVIQFLKLVTEADGIISTKASMLKAAR---AEGFFCIHRLFIVDSISFHNIDKQVAQSNPDCI--LGWVTEKIRQPLIAGGLVCDEEDARNAINAGVVALSTTN.......................................................................................................................... 180
10 -10.300[I] COG4981 Enoyl reductase domain of yeast-type FAS1  ali follow..  11  28.........................VDGTPRLVTKFTELTGRT-PMMLAGMPTTVDPAIVAAAANGGHWAEL--QVTPELLETHIAQLTDMLEPGINAQFNSMFLDPYLWKMQI----------------------------------------------------------GGKRLVPKARANGASIDG------------------------------IVITAGIPEKDEAVALVKELMRDGFPWIAFKPG-----------------------AIKQVNSVLAIAKEVPELPIIIQIGGVAGG-------HSWEDLDELLIATYGKVRALDNVVLCVGGGIGSPERAADYVAMPVDGILVGTAAMATKEATTSQAVKE.......................................................................................................... 280
11 -10.100[R] COG0517 FOG: CBS domain  ali follow..  23  7..............................................................................................MTRKVVYISPDITVSHAADLMREQGLHRLPVIEND---QLVGLVTEGTIAQASPSKATSLSIVMIRDVVTVSGYASLEDATYLMLKNKISILPVVDN-HQVYGVITDRDVFQA........................................................................................................................................................................................................................................................................................ 129
12 -9.880[R] COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold  ali follow..  17  22............................................................................................................................................................................................................................TLIDPEEQTPEEAVEIARAAIRGGTDGIMLGGSTTDSSELDNTARALRENID--------IILFPGNTTGVSRYADAIFF-VEPGGMRLFYLEAGSGAPEHVPEEMIALVKRCTDQILIVGGGIRSGEDAARVAGAGADVVVTGTVVENSDNVEDKI.............................................................................................................. 238
13 -9.500[E] COG0106 Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase  ali follow..  18  29.....................................................................................................................................................................................................................................NPDPAAQARAFEEQGFEVVDLNGAFAGETVNGAAVDAILKATKNPVQLGGGIRTLEHIENWLSRGLKRVILGAGVAAIIYTDIDRD-GILTGINWASTLELADAVSIPVIASGGLASMDDIRRMTEPKLEGAISGRAL........................................................................................................................ 225
14 -9.440[G] COG0269 3-hexulose-6-phosphate synthase and related proteins  ali follow..  15  1............................................................................................................................................................MSLPMLQVALDNQTMDSAYETTRL--------IAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTV-ICCADINTAKGALDVAKEFNGDVQIELTGYWTWEQAQQWRDAGIGQVVYHRSRDA----------GVAWGEADITAIKRLSDMGFKVTVTGGLA-LEDLPLFKGIPIHVFIAGRSIRDAAS-PVEAARQFKRSIAELWG................................................................................................. 216
15 -9.430[G] COG0800 2-keto-3-deoxy-6-phosphogluconate aldolase  ali follow..  18  13........................................................................................................................................................................................................................TTGPVVPVIVVNKLEHAVPMAKALVAGGVRVLEVTL---RTACAMDAIRAIAKEVPEAIVGAGTVLNPQQLAEVTEAGAQFATIPLIPGISTVSELMLGMGTKALQAIAGPFS-----QVRFCPTGGI-SPANYRDYLALKSVLCIGGSWLVPAD.................................................................................................................... 190
16 -9.170[E] COG0107 Imidazoleglycerol-phosphate synthase  ali follow..  20  31......................................................................................................................................................................................................................................GDPVEIARRYDEQGADEITITASVDGRDTTLHTVERMASQVFIPLTVGGGVRSVQDIRNLLNAGADKVSINLGAGEILLTSMDQD-GVKSGYDLGVTRAISEAVNVPVIASGGVGNLEHLAAGILEGADAVLAASIF........................................................................................................................ 234

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.