current user: public

If you have questions about the server, please let us know.

Query: gi|30260205|ref|NP_842582.1| glutamine amidotransferase subunit PdxT (BA_0011) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MVKIGVLGLQGAVREHVKSVEASGAEAVVVKRIEQLEEIDGLILPGGESTTMRRLIDKYDFMEPLRTFAKSGKPMFGTCAGMILLAKTLIGYDEAHIGAMDITVERNAFGRQKDSFEAALSIKGVGEDFVGVFIRAPYVVDVADDVEVLSTHGDRMVAVKQGPFLAASFHPELTDDHRVTAYFVEMVKEAKMKKVVLast
1 -72.200[H] KOG3210 Imidazoleglycerol-phosphate synthase subunit H-like  ali follow..  36  13MKVIGVLALQGAFLEHTNHLKRCLIEIKTVKTPEDLAQCDALIIPGGESTSMSLIAQRTGLYPCLYEFVHNPKVVWGTCAGLIFLSAQLENALVKTLGVLKVDVRRNAFGRQAQSFTQKCDFSNFIDNFPATFIRAPVIERILDPIAVKSLYDVVVAATQNHNILVTSFHPELADDTRFHDWFIRQFVSN...... 224
2 -70.800[H] COG0311 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis  ali follow..  42  1.MKVGVIGLQGHIDATNLALKKLGVEAIWLKKPEQLKEVSAIIIPGGESTTISRLMQKTGLFEPVKKLIEDGLPVMGTCAGLIMLSREVLGPEQRFLEVLDVRVNRNAYGRQVDSFEAPVRLSFDDEPFIGVFIRAPRIVELLSDRVKPLAWLDRVVGVEQDNIIGLEFHPELTDDTRVHEYFLKKA......... 195
3 -61.700[E] COG0118 Glutamine amidotransferase  ali follow..  17  4..NVVIIDTGANISSVKFAIERLGYAVTISRDPQVVLAADKLFLPGGTASEAMKNLTERDLIELVKR---VEKPLLGICLGMQLLGKLSEEKGQKADEIVTGDLPLPHMGWNTVQVKEGHPLFNGIEPDAYFYFVHSFAMPVGDYTIAQCEYGPFSAAIQAGNYYGVQFHPERSSGARLIQNFLEL.......... 203
4 -41.200[F] COG0047 Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain  ali follow..  18  1.MKFAVIQFPGS-LDMLHAIRDSLGEEYVWHAETSLAGFDAVLLPGGDYLRTGAIAKFSSIMPEVLRFAEMGKPVLGVCNGFQILTEIGLLPGA--VANADTMFTGLYEEGEIIQVPVAHGEGNYYCDDETLLKLKDNNQIVFTYDSVNPN-DIAGIVNERGNVLGMMPHPERAVGLRLFESVVKAWKEEQVN... 226
5 -40.200[E] KOG0623 Glutamine amidotransferase/cyclase  ali follow..  22  1.............................IRNPHDIEKAECLIFPGGNFGFVCDSLAKQGFLEPLRRYALSGKPFMAVCVGIQALFEGSVEPHSKGLGVFPGLVQRPHIGWNSCAVRSTSKEFFGMRPHDKFYFVHSYMIPEKEFKIATTKYGNFVGAIVKNNFLATQFHPEKSGGLRCLKAFLTGNYEQPISGE. 187
6 -28.100[F] COG0518 GMP synthase - Glutamine amidotransferase domain  ali follow..  17  9..RILILDFGSQYQLLARRVREIGVYCELWAWDVTEAQISGIILSGSPES-----TIENGSPRAPDYVFTAGVPVLGVCYGMQTMAIQ--------LGGKVESSNQREFGYAQVEIKADSALIRDIKDAINPAGEAVLVAEIPADFVTVASTDTCPFAIEEKRFYGVQFHPEVTQGLRLLERFVLGICGCEA.... 206
7 -27.400[F] KOG1622 GMP synthase  ali follow..  16  27..AVVILDAGAQYGKVIRRVRELFVQSEIFPLETPAFAIRAIIISGGPNS-----VYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKV--------FGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGSVDKVADGFKVVARSGNIVAGIANESLYGAQFHPEVGNGKVILKNFLYDIAGCSGT... 216
8 -24.000[R] COG3442 Predicted glutamine amidotransferase  ali follow..  16  8.LTIGWLGDRGNVITIERRAQWRGYTVKVLSTADDIKSVDVIVGGGAQDRQQEIVMRDLQKADAMREKIDNGTPGVFTCGSPQLLGHYYEPAFIEGLGILDLVSTKRCIGNLVIEVTASREMTGSKAYLVGFENHGGRTKLGKVEALGKVVYGDGTEGSFYQNAIATYSHPLLPKNPFVADWLIQTALRLKYQQAI 239
9 -23.300[S] COG4285 Uncharacterized conserved protein  ali follow..  12  1.MNVLIYNGNGCLLRTFQSLLPFVVDASTLEKEPWPASTALLVMPGGRDMGYCSSFNETIY-RKITDFVKRGGAYLGLCAGGYFGSAVVDFRGKRKLQFFPGTCAGPTFP-GARRASIIVDGMQSSPVHTHIYFNGGGSTENYSNVKVVARYEKSAAIIYKGNVVLTGIHPEFSAELELLSYILKLL......... 238
10 -23.300[F] KOG3179 Predicted glutamine synthetase  ali follow..  11  7KKRFALFLFVSTFGEEGEQWDLFRVIDGQFPDENDLDKYDGFVISGSPHDAFGDADWIVKLCEVCQKLDHMKKKVLGICFGHQIITR-----------VKGGKIGRALKGADMGLRSITIADVEVPASLAIIKCHQDEVLELPESATLLASSENVEMFSIGDHFFCIQGHPEYNKE--ILFEIVDRVLNM...... 214
11 -21.400[E] KOG0026 Anthranilate synthase, beta chain  ali follow..  14  19.GPIIVIDNYDSFTNLCQYMGELQCHFEVYRNDEKRKNPRGVLISPGPGTP-----QDSGISLQTVLELGPLVPLFGVCMGLQCIGEKIVRSPFGVMHGKSSMVH--YDEKGEEGLFSGLSNPFIVGRYHSLVIEKDTFPSDELEVTAWTEDGLVMAARHRKYIQGVQFHPETTEGKTIVRNFIKIVEKKDSEKL. 221
12 -20.800[R] COG2071 Predicted glutamine amidotransferases  ali follow..  20  29.............QRYVDAIQKVGGFPIALPIDDPISLVDGLLLTGGQEIGAYFPPRDSYEIALVRAALDAGKPIFAICRGMQLVNVALGGTLYQDISLQHLQRVDEQLGSHTIDIEPTSELAKHHPNKKLV-LHHQFIKKLAPSFKVTARTADGMIEAVEGDYLGVQWHPELPESEQLFQALVDESKKTMVK... 244
13 -20.600[H] COG1492 Cobyric acid synthase  ali follow..  18  253.IDIAVLDLPSNYTDLEPFRYEEDVAIRFVSSVDALGRPDAIILPGTKSTFHLQILKEKGFKERLHEYVTTDGTVVAICGGFQMLGHRLIDATIDGLDLAPVETRFAEKKKTVRSLGQLLHPFGTAKDIYGFEIHLGETDIVDPSIPAFLRVGNHTVYLHEGRLIGTYFH--LFFNDDFRSGWLNTLRRKK..... 456
14 -20.500[EH] COG0512 Anthranilate/para-aminobenzoate synthases component II  ali follow..  12  1.MILLIDNYDSFTWNLYQYFCELGADVLVKRNDADALKPQKVVISPGPCTP-----DEAGISLDVIRHYAGRLPILGVCLGHQAMAQA--------FGGKVVRAAKVMHGKTSPITHNGEGVFRGLANPLTVTRYHSLVVEPDS-EVTAWSETREIMGIRHRQLEGVQFHPESEQGHQLLANFLH........... 186
15 -20.300[H] COG1797 Cobyrinic acid a,c-diamide synthase  ali follow..  19  248.VKIAVAAFHFYYEENFTLLRQAGAELVYLRGEDLPSHCDGLYLGGGFPEEFADELQWIKDHPQLKKRVQSGLPTLAECGGYMFLGEQLTTTKVEMAGVIPMVVKLVSLGYRDVTPLDDSFLLSKGQQIRGHEFHYSKAVYTETEYFVKGLFGEGKEGYMSDHLLAGYTHLHFASEPAVATQWVKACEVYKNRRL. 458
16 -19.500[E] COG1897 Homoserine trans-succinylase  ali follow..  14  35PLKVLILNLMPKKIETENQFLRL-NNFYCNFEDIQEQNFDGLIVTGAPLGLVEF----PQIKQVLEWSKDHVTSTLFVCWAVQAALNIL--------GIPKQTRTDKLSGVYEHHILHPHATRGFDDSFLAPHSRYADFIRDYTDLEILAETEEYLFASKDKRIAFVTGHPEYDAQT-LAQEYFRDVEAGLDPEV. 259
17 -18.900[EF] COG0505 Carbamoylphosphate synthase small subunit  ali follow..  16  189.YHVVAYDF-GVKTNILRMLASRGCRLTVVPAQTSAEDVDGVFLSNGPGDPEP-----TYAIKAVQKLIESGKPIFGICLGHQLIS---------AIGAKTLKMRFSHHGANHPVQDLDSGKVVITSQNHG-FAVDADTLPANARITHKSLFDNTLQGIELTDVFCFQGHPEASPGPQLFDKFIGNMKAAKRA... 377
18 -18.400[E] COG3340 Peptidase E  ali follow..  11  45..TVAFVPYAGVELKVQKALAELNVAILSVHRAEKIEKADVIAIGGGNTFCLLKGMYEHHLLPLIREKVQSGTPYFGWSAGANVAGRSIMTTNDDALNLFPHQLNPHFISGKPAGHNGESREERALPEGTALHIQGQQARVLGQHDVLLFSENMQLATLPVNSVF............................... 241
19 -13.300[QP] COG4242 Cyanophycinase and related exopeptidases  ali follow..  16  61..YITIIPSASRGGRYIRIFEEMGAEKVEIQVKASLEACSGVFLTGGDQLRLCGVLSDTPVMEIIRQRVRGGQLTLGTSAGAAVMGHHMIAGGATGLGLIPEVIVDQHFH-NRNRMGRLISAVAAHPDRLGI--------GIDEDTCAVFERDGWLQVLGKGSVTIVD............................ 248
20 -12.200[H] KOG1536 Biotin holocarboxylase synthetase/biotin-protein ligase  ali follow..  19  1...MNVLVYNGSVKHAVESLRDF-VNVKVLQTEPWMSKTSAVVFPGGADLPYVQACQPII-SRLKHFVSKQGGVFIGFCAGGYFGTSRVE--GSRDLRFFPGTSR-NGFQYNSEAGARAVKLNLPDGSQFSTYFNGGAVADKFDNVEILATYAEHPCTVGRGKVLLTGPHPEFSTDKHFLETVVENLKAQEIMRL. 247
21 -11.600[Q] COG3155 Uncharacterized protein involved in an early stage of isoprenoid biosynthesis  ali follow..  25  4MKKIGVILSG-EAVLTLLAISRSGAQAVCFAAQADAAELDALIVPGGFASLGSECTVDRELKALAQAMHQAGKPLGFMCIAPAMLPKIFDFPLRLTIG.................................................................................................. 157
22 -10.000[R] COG0693 Putative intracellular protease/amidase  ali follow..  17  92..................................KQEDYDAVFYPGGH-GPMWDLVNDRNSIALIEGFYDAGKPVAAVCHGPAVLTQVTHLGEP---------------GRRVTGFTNSEEEAVQLTDV---FLVEDELKRLGGRYEKAADWADFT--VVDGRLVTGQ-NPSSSTS--AASELLKLLQ........ 226
23 -9.660[F] KOG2387 CTP synthase (UTP-ammonia lyase)  ali follow..  17  304.VKIALVNLKDSYLSVTKSLEHASMKCKFHDSWNKLSSADGILVPGGFGTRGIE-----GMILAAKWARESGVPFLGVCLGLQVAAIEFARNPEIDKEHMGGTMRLGLRPTIFQPNSEWSNIRKLYGEVNEVHERHRHRYEINPKIVNDMESRGFIFVGKDETYVGTQYHPEYTSKVLPFWGLVAAAPAHLVK... 564

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24