current user: public

If you have questions about the server, please let us know.

Query: gi|30260208|ref|NP_842585.1| deoxynucleoside kinase family protein (BA_0014) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTRWSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKGLFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINNFNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVKLast
1 -75.300[F] COG1428 Deoxynucleoside kinases  ali follow..  38  1......MEGVGNKVIVLAGMIGAGKSSYTELIANELGTKAFYESIKDNRILEMFYDDPKRWAFALQIYFLNTRFRSIKAALTD-QNNVLDRSIYEDA-LFTQINFEEGNISEPEMDTYLDLLDNMMEELAYKAPDLLIYLRGSLDTVLSRISLRGRPYEQTFDLDYYKHLHSRYDSWFESYDKSDTLVINIDEVDI-NKPSDAKYVMQLIHEKLKR...... 214
2 -52.300[C] KOG3877 NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit  ali follow..  20  71FDKTSKRFDENSKVICVEGPIAAGKSKFAKELAEELDMEYYPAVDLDLIYVRNFCLDPHDLAAQFQIRMYMLRYSQYIDALSTGQGVVLERSPYSDF-VFMEAMFRQGYLSRGARSVYNELRQNTIGEL--LKPHLVIYLDLPVDAVKKQIKARNVDYEVQFSDAYLSDLEQLYKQQYLKDISAELLIYDWTA------GGETEVVVEDIERIDFNQ..... 311
3 -23.300[F] COG2019 Archaeal adenylate kinase  ali follow..  15  1............MRSVITGVAGVGKTTVLDIVARESGIPVV----NYGTLMFEVAKRRGLVENRDQIRKLSRETQVDLQKLAGEEIGKMENAIVDTHMSIKT---PFGYLPGLPEWVLRSI-----------NASVFVIIEADPAIIKRRRDNRARDDEGVDSIREHQEMNRYFAAAYSIFSGATVKIVKNEEGKP-------EQAADEIVRVIK....... 181
4 -22.100[F] COG0125 Thymidylate kinase  ali follow..  13  2..........SGLFITFEGPEGAGKTTVLQEIKNILQVMATREPIDIAEQIREVILNENNILMDPKTEALLYAAEKVKPALEQGFIVLCDRFIDSPLAY-------QGYARGLGIDEVLSINEFAIGDM---MPHVTVYFSIDPEEGLKRIYANGSREKNRLDLDFHTKVQEGYQE-LMKRFPERFHSVDAGQ----SKDLVVQDVLKVIDEALKKIQ.... 211
5 -21.500[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  18  6..............ILLTGTPGVGKTTLGKELASKSGLKYI-DLAREEQLYDGYDEEYDCPILDED------RVVDELDNQMREGGVIVDYHGCD---------------------------------FPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPE--ELENNVDQILKWIEQWIKDHN.... 171
6 -21.000[R] COG0645 Predicted kinase  ali follow..  13  3.............LAVTHGVSAVGKSQVAMRLVEALGAVRLRSDIERKRLFGEQPEHDRGYSSQASEATYAHLHQLAAKILQAGYPVVIDAAYLK--------------------QNQRQAACHIAEETGVP---LILDCQAPEAVIAGWLAQRQAEGKSDATLDVIRTQQATREP-LTAAETVQSKRVDTHD------AASLDGLVDGIRQRLPGL..... 185
7 -20.700[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  21  3..............IAITGTPGVGKTTVAKLLAKKLNYEYV---------LKDFALEKGCGRVNDEVEVEIDELAYFIERELKGKNAVLDGHL-----------------------------------SHLMPVDLVVVLRAHPKLIGERLRERGYDREKIGENVEAELVDAVLIEAIEEHEN--VIEVDTTN-------KSPEDVVEEIVSLINS...... 153
8 -19.500[F] KOG3308 Uncharacterized protein of the uridine kinase family  ali follow..  12  1.......MTRKTIIVGVSGASCSGKSTLCQLLHAIFEGSSLVH-------EDDFYKTDAEIPVSLNLDAFLENLHYIRDLRNRENKNVAPEALIEYADIIKEFKAPAIPTLEQHLVFVDGFMMYVNEDLINA--DIRLMLVTDFDTLKRRREARLEGFWQDPPHYFENYVWPGYVHGHSHLFVNGDVTGKLLDKRIQLSPSSKMSVRDNVQWAINSILNALQ 230
9 -19.300[F] COG0572 Uridine kinase  ali follow..  16  6.........HQCVIIGIAGASASGKSLIASTLYRELREQVGDQHIG----EDGYYKDQSKTNYDHPSAMDHNLLLEHLQALKAGKPVELPLYSYTEH----TRKKETVHLEPKKVIILEGILLLTDIRLRQE--NFSIFVDTPLDICLMRVNERGRSMDSVMA-QYQKTVRPMFLQFIEPSKQYADIIVPRG----GKNRIAIDILKAKISQFFE....... 213
10 -19.200[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  15  9............RTVAILGGESSGKSTLVNKLANIFNTTSAWE-YGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTDFVTTQAFCKK-------------YEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLGSSVDR-------KEFQNLLVEMLEEN-NIEFVRVEEEDYD-----SRFLRCVELVREMMGEQR.... 187
11 -19.000[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  13.RLAAMAGMPEGKLILLNGGSSAGKTSLALAFQDLAAECWMHIGIDL--------EQLDLARVRPEYYTWDSAVEADGLEWFTVHPGPILDLAMHSRYRAIRAYLDNGMNVIADDVIWTREWLVDALRVFEGCRVWMVGVHVSDEEGARRELERGDRHPGWNRGSA-RAAHADAE-----------FELDTTATP--------HELARELHESYQACPY... 212
12 -18.800[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  12  1MSIVRLKKLEQPVFLIVAGPNGSGKSSVYANADLELEGRSVW--VNPDLLAGRISEVENKPLPEANLVAVQRIEAWIQSSISVHKTIGVETVLSTD----------------------KYRRLVEAAEAVGFAIWLFYTVLDSPERSIERIKLRVAKGGHDVPAD---KVRARYARIWDNSGATPKLIGEKQDGVIGLDENALAVVASAVKSIATE...... 206
13 -18.200[R] COG3911 Predicted ATPase  ali follow..  15  1......MQNDFDRVFVLTGGPGSGKTTLIAALRRA-GFATSVVAGRG--IVRDQSSIGGT-RTLFAELMLSWEMRSYQNAVEQKGPVFFDRGVPETLGYLR--------------LSGLPVADHVSTAAKRFRYNPRVFIAPPWPDIFAQDEERKQTPDEAKCTY--HALAEIYTEL-----GYELVPLPLAPVE-----TRLRFVLADAG........... 181
14 -18.000[F] KOG3327 Thymidylate kinase/adenylate kinase  ali follow..  13  14..................................................INSYLTNSKDLPDEVIHLMFSEHINQVKEKLLEGTTLVVDRYSFSGVAYSAAKGLDFDWCYAPE--------------RGLIKPDAVFYLRAPPNDLTHRGQYGKERYEK---VEFQGRVAEVFNR-ICSKEGSYFHQFDARQ----SVEDLHAQIASITEELLPKVA.... 163
15 -17.500[G] COG3265 Gluconate kinase  ali follow..  17  2..........SGKCIIVMGVSGTGKSCVGQALALALGAKFI----DGDDLHPRANIQKMAAGQPLRAPWLERLSDVAYSLQQKNEVGFLVCSALK--------------------KQYRDRLREGNEGI------RFLWLTGDYDLVLHRMQQRGHFMPESLLKSQFATLEAPGSD------EPDVIPIDISS--------SIADVVEHCIAALSLEN.... 170
16 -17.400[G] COG2074 2-phosphoglycerate kinase  ali follow..  16  83...RKIRQCKEPLIILIGGASGVGTSSIAFEVANRLGIRNMISTDMIREVMRKIVSRELLPSIYESSY-VLIGFRDHVESVSIGVEAVIERALTEGISIVIEGVHIVPGFIREDLVNKENVA-------------MFVLTVSDENVHKGRFYSRCRQMWARRPLKYFWAIRRIHRYIENQARKHGVPVIENIDVV-----TTIDSIIKSLTKTTVK...... 296
17 -16.600[G] KOG3354 Gluconate kinase  ali follow..  14  3VTPINPTNQPYKYVFVVIGPAGSGKTTMAKAVSEKLGFEYI-DDLHPKANIEKMLNDNDRWGW---LHNCGGACAMELDKESIKGVVLTCSAL----------------------RSYRDILRSSLEHRPAI---RFIYLAASRETLIKRTTSRNHYMKADMVESQLAILEA-------TADEKDVITISVEN----GKEQSEEECLDIVHKMVNENKQ... 192
18 -16.600[P] COG3709 Uncharacterized component of phosphonate metabolism  ali follow..  14  7...DSRRTLSPGTMIVIVGPSGAGKDTLMDYAAAQLSRRVITRSCDAG---HEFNQLEDAGAFAVSWQAHGLKYAAVYRHLEAGDVVIAN-------------------GSRSALPHFGTAFSRL----------KVVNIVARPDVLARRLEQRGRESRDDIL---------------RRLERSSLAVAGDFDVTTVDNSGAIEDAGKTIMQVLQQSA.... 194
19 -16.300[F] COG1102 Cytidylate kinase  ali follow..  12  3.........KGCLVITVSGLAGSGTTTLCRNLAKHYGFKHV----YAGLIFRQMAKERG-----MSLEEFQKYAELHPEIDREVDRRQVEAAKECNVVIEGR-----------------------LAGWMVKNADLKIWLDAPIRVRAERVAKR-EGISVEEAFMKIAEREMQNRKRYLNLYGIDILIIDTSKWSPEGVFAIVKAAIDHLYEKV........ 181
20 -16.300[F] COG4088 Predicted nucleotide kinase  ali follow..  11  3.............LIIVSGYPSSGKTTRSNELKKALEDRIHQNIDNTKDYRVIIINDESLRESKNEKAARGLLYSAVQRELSKSTFVICDALNYIKGF-----------------------YQLYCESKSMYTTHCVIHVAVPQDLCRKFNSNKEQPYPDDVLEQLMFRYEE.................................................. 146
21 -16.200[TZ] KOG4203 Armadillo/beta-Catenin/plakoglobin  ali follow..  13  63.........DGLILVGLAGPSGAGKTIFTEKILNFMPSIAIIN-------MDNYNDGTRVIDGNFDDPRLTDYDTLLDNIHGLRDGKPVQVPIY-DFKSSSRIGYRTLEVPSSRIVILEGIY--ALSEKLRPLLDLRVSVTGGVHFLVKRVLRAGQEPEEIIH-QISETVYPMYKAFIEPDLKTAQIKILNKFNPFS......................... 244
22 -15.900[C] COG3954 Phosphoribulokinase  ali follow..  15  1.......MSAKHPVIAVTGSSGAGTTTTSLAFRKIFAQLNLHAAEVE---GDSFHRAGRHISYFGPEANDFSLLEHTFIEYGQTGKGQSRKYLHTY-QVPGTFTPWQPLPEPTDVLFYEGLHGGVVTPQHDVARDLLVGVVPIVNLLIRDTSERGHSREAVM--DSVVRSMDDYINYITPQFSRTHINFQ................................ 206
23 -15.700[FH] KOG2702 Predicted panthothenate kinase/uridine kinase-related protein  ali follow..  13  119...AAMFSPNLKRLVGLAGPPGAGKSTVANEVVRRVNKLWPQKAASFDA-MDGFHLYRSQLD-TFDPALLLNCLKKLKN--GSVYVPSFDHGVGDPV---HKVVIVEGNYILLEEGSWKDISDMF---------DEKWFIDVNLDTAMQRVENRGKPPDVAK--WRVDYNDRPNAELIIKSKTNADLLIRSMNI............................ 333
24 -15.400[F] COG0283 Cytidylate kinase  ali follow..  15  1........MNRQKVIAIDGPGASGKGTVAARVAAALGYDYLDT--------GALYRLTALYAQKQGVGWVSELAKKLPAVFSDSRILLGGEDVSDAIGMGASAVAQLPKVRASLLQRQRDFLTE-TGSVVFPQAELKIFLTAESKIRAERRAKQIGIPCEGLAFERILSDIEARDEADRNRKVAPLLLLDTSRLTIEETVKKVLDWYRKV............ 218
25 -15.300[F] KOG3079 Uridylate kinase/adenylate kinase  ali follow..  10  33.........MKPLVVFVLGGPGAGKGTQCARIVEKYGYERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLID---------FPRNQDNLQGWNKT---------------DGKADVSFVLFFDCNNEICIERCLERGKSSGR--SDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKE..... 227
26 -14.500[E] COG0703 Shikimate kinase  ali follow..  16  63...SSTEKMAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYIEKRTGADVGWVFDLEGEEGFRDREEKVINELTEKQGIVLATGGGSVKSRE----------------------------------TRNRLSARGVVVYLETTIEKQLARTQRDKKRPLLHVETPPREVLEALANERNPLYEEIADVTIRTDD-------QSAKVVANQIIHMLES...... 239
27 -14.400[H] COG1072 Panthothenate kinase  ali follow..  16  73....GTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVE----TDGFLHPNQVLK-SYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDDILILEGLNVLQSGMDYPHDPHHVFVSDFV---------DFSIYVDAPEDLLQTWYINRKEEAIKTAMTLWKEINWLNLKQNILPTRERASLILTKSANHAVEE....................... 303
28 -14.000[R] COG4639 Predicted kinase  ali follow..  14  2.....KITIPELSLVVLIGASGAGKSTFARKHFQPF------EVISSDFCRGLVSNDENSQSASRDAFDVLH--YITTKRLAAGKLTVIDAT----------------NVQPEDRKTLLQMAKQYHCFT------VAIVFDLPEELCHERNQQRS---DRQFGSHVVRRHTQMLRRS-----LRSLEKEGFRYVYTLKSPEEIANVAIELQPLWNNKKH... 177
29 -13.200[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  12  3.............LVVITGLPASGKSTRARQLRDHFGRKVHLISENEAVPKAGFGKNSHTGDSQKEKVVRSDLKSEASRHLNQEDLVILDAGNYIKGY-----------------------YELYCMSKVSRTTQCTVFTCIPQEEAWTFNSQRTAPDELPGDSERVQPVDNSDVPY............................................. 147
30 -12.900[R] KOG4622 Predicted nucleotide kinase  ali follow..  13  7IRGTGSDGPRKRGLCVLCGLPAAGKSTFARALAHRLQQEVAYDDVMPDAFLAGARARPAPSQWKLLRQELLKYLEYFLMAVINGCQMSVPPNRTEAMWEDFITCLKDQDLIFSAAFEAQSCYLLTKTAVSRPLFLVLLFLDCPLETCLQRNGQR----PQALPPETIHLMGRKLEK--KNAWEHNSLTIPSPACASEASLEVTDLLLTALENPVKYAE.... 255
31 -12.500[F] COG0194 Guanylate kinase  ali follow..  14  37...GNCRMKERGLLIVLSGPSGVGKGTVRQAIFSQEDTKFEYSISVTTRSPREGEVNGVDYFFKTRDEF---------EQMIADNKLLEWAEYVGNYYGTPVDYVEQTLQDGKDVFLEIEVQGALQVRNAFPEGLFIFLAPPSLSELKNRIVTRGTETDALIE----NRMKAAKAE-----------IEMMDAYDYVVENDNVETACDKIKAIVLAEH.... 227
32 -12.200[S] COG2326 Uncharacterized conserved protein  ali follow..  14  54......KKTGARIVIVFEGRDAAGKGGVIKRITERVSPRVFRDREKTQIYMQRYIQ----------------------QFPAAGEVVIFDRSWYNRPGVERVMGFCSEKKAKRFLEIAPRFEAAMIESGIVL---LKYFLDVSEEEQDRRFRQRINDPLRQ-SYRRWWDYTRAYDEMIRDTDDAPWWIVPSDNKKQAR--NCIAHILSSIPYERVK...... 255
33 -11.900[S] COG5324 Uncharacterized conserved protein  ali follow..  10  381.IDYDKVDERTKFLIFPISVIGCGKTTTSQTLVNLFPGHIQNDDITGKDKSQLMKK------------------SLELLSKKEIKCVIVDRN----------------NHQFRERKQLFEWLNELKEDYLVYDTNIKVILSEIRDITLQRVIKRGNNHQSGIMNGFLKRYQPVNLDKSPDNMFDLMIELDFGQAD--SSLTNAKQILNEIHK.......... 579
34 -11.900[F] KOG3078 Adenylate kinase  ali follow..  15  6..PAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLD---------FPRTVRQAEMLDD-------------LMEKRKEKLDSVIEFSIPDSLLIRRITGR-----------IHPKSGRSYHEEFNPPKEPMKDDITGEPL-IRRSDDNEKALKIRLQAYHTQTTPLIE 199
35 -11.700[P] KOG0635 Adenosine 5`-phosphosulfate kinase  ali follow..  18  104RCDRQQLLQQKGCVVWITGLSGSGKSTVACALSKAL--------FERGKLTYTLDGDNVRHGLNRDLTF-IRRIGEVAKLFADVGVICIASLI-----YRRDRDACRSLLPDGDF--------------------VEVFMDVPLHVCESRLYKLARAGK----IKGFTGIDDPYEA-----PVNCEVVLKHTGDDE---SCSPRQMAENIISYLQNKGYL.. 291
36 -11.600[F] COG0563 Adenylate kinase and related kinases  ali follow..  11  3..............LILMGLPGAGKGTQAEKIIEKYGIDMFRAAMKNETELGLKAKSYMDAGELVPDEVTIGIVRDRLSQDDCQNGFLLD---------FPRTVAQAEALED-------------ILASLDKKLDYVINIDVPEQLLMDRLTGRRDDDKPETVKKRLEVNQKQAQPLIDFYSEKGYLQ--------INGDQDISRVFEDINELLKGLS.... 216
37 -11.200[R] COG3910 Predicted ATPase  ali follow..  35..........KTPITFFAGNNGSGKSTLLEGLAAGMTAYYLQHAETVAKAFYFARKKYPKIRMFLRAEDVLGYIRRQNENALDDFRWEREKALKKGEDFPEETEIFRGIVRNNSLDRRSHGEGFLDIMHRRLHGAGLYFLDEPESPLSPQKQLELAAIIRQAADSGGQLIIATHSPVLLAIPEATIYYFDEDGITERLYDEL--ENIAFLRRFLDRPSKYLD 257
38 -11.100[F] COG1618 Predicted nucleotide kinase  ali follow..  13  1..MRIEGKEKTMLRIAVTGSPGVGKSTVVAKTAEKLAEKP---------RTAEIRKEGHREGFSIRD---LATGKTGILSHVKGSGPRLGKYHVNLDDLERIGANAVRNALACDLVVIDEI------------------MELISQSFVSAVEE-------ESDKPVLAVLHHSSRHPLAQRFRKGFEVLTVDK---GNRDELPEKITNRFLRKLG....... 184
39 -11.000[P] COG0529 Adenylylsulfate kinase and related kinases  ali follow..  18  1.........QKPAVLWFTGLSASGKSTIANRLEQRL--------HALGKHTYLLDGDNVRHGLNSDLGF-ADRVENIRRVGE-----------------VARLMADAGLITPVSFISPFREERDQVRARLPEGEFIEIFIDTPIEECMARDPKGLYAQALRGEIKAFTGIDSPYEP-----PVAPELRLNTAGRTV-------DELIAEVENYLAERGVIGS 177
40 -10.900[F] KOG0707 Guanylate kinase  ali follow..  14  135.........NAEKPIVISGPSGVGKGTLISMLMKEFPSMFGFS-------VSHTTRSPRSMEMDGVHYHFADKKVMEKEIKDGK---FLEFASVHGNLYGTSIESVEAVTDSGKRCILDIDVQGARSVRASSLDAIFIFVCPSMKELEDRLRARGTETEEQIQ----KRLRNAEAEIKEGISS--------GIFGLILYNDNLEECYKKLKVNHLLLI.... 322
41 -10.800[L] KOG2134 Polynucleotide kinase 3` phosphatase  ali follow..  12  4.PESIEADKAKQIVVLLIGPPGSGKSTFCDTAMRSSHRP--WSRICQDIVNNGKAGTKAQ-------------LKMATDSLREGKSVFIDRC----------------NLDREQRSEFIKLGGPEF-------EVHAVVLELPAQVCISRSVKREGNLQGGRAAAVVNKMLQSKELPKVNEGFSRIMFCYSDA............................. 161
42 -10.800[R] COG4240 Predicted kinase  ali follow..  14  80...AQHQQLKRPFIQGILGSQGTGKTTMSLVIQLILQHLGYRTLSLS---LDDLYKTYSDRL-THDIDLGLNVLEQIRQGKSPVIVPRFDKSAHADILIFTDEDKAFARDMNLRLNHYLPLWEKLDSLILLYPTDYRCSLEWRKQAEQKMIAAGKTGMSNTQIEEFVNYFWRSLHPELFIQPLSQVVEIHPDH............................. 325
43 -10.500[R] KOG2878 Predicted kinase  ali follow..  16  17...KQPKPEGRPFILGISGPQGSGKSTLASALDTELTRKNESVVKFS---LDDFYLTHAEQV-THDVTFLNNVLNAFVKGSDEEVSIFYDKSKFGTYVIFEGWMVGFEPLDSCMLSVYQPIFQKIDSLVELEAQEINYVYRWRLQQEHALKARIHKGMSDEEVIEFVNHYMPQYVFYLGTLSNKVEIILDENR............................. 271
44 -10.200[J] KOG1384 tRNA delta(2)-isopentenylpyrophosphate transferase  ali follow..  13  57...QSRSRNRKDKVVVILGATGAGKSRLSVDLATRFPSEIINSDKIQHHLLGVINPEHGELTAG---EFRSAASNVVKEITSRQKVPI----IAGGSNSFVHALLAQRFDPKFDPFSSGSCLISSDLRYEC----CFIWVDVSETVLYEYLLRR---VDEMMDSGMFEELSRFYDPVKSGLETRGYFKEYPPEKKMIKWDALRKAAYDKAVDDIKNTWTLAK 296
45 -9.820[H] COG0237 Dephospho-CoA kinase  ali follow..  10  3............LVIGLTGGIASGKSTVANMLIE-KGITVIDADIIAKQAVEKGMPAYRQIIDEFGEDILLS--KKLGALVFTNEQKRLALNAIVHPAVRQEMLNRRDEAVANREAFVVLDIPLLFESKLESLVDKIIVVSVTKELQLERLMKRNQLTEEEAVSRIRSQMPLEEKTARADQ------VID-NSGTLEETKRQLDEIMNSW............ 196
46 -9.530[H] COG3840 ABC-type thiamine transport system, ATPase component  ali follow..  19.....SLTVERGEQVAILGPSGAGKSTLLNLIA--FLTPASGALTIDGVDHTTTPPSRRPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNAVQQEKM-IARQMGIDNLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQQQMTLLMVSHSVEDAARIATRSVVVADGRIAWQGMTNELLSGKASASALLGITG.... 232
47 -9.520[R] COG0802 Predicted ATPase or kinase  ali follow..  24  17FAQKLADKLLAGDVITLEGDLGAGKTSFTKGLALGLGIK---RVVKSPTFTIIREYKGRLPLYHMDVYRLNEEEEDLDEYFHGDGVTVVE.................................................................................................................................... 105
48 -9.520[R] COG4136 ABC-type uncharacterized transport system, ATPase component  ali follow..  11  21.....NFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAEQF--ELWLNEQRIDILPTAQRQIGILFQDALLFDQFSVGQNLLLALPATLKGNARRNAVNDALERSGLEGAFHQDPATLSGGQRARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEVRALIPVVQVTHDL.............................................. 194
49 -9.320[H] KOG3220 Similar to bacterial dephospho-CoA kinase  ali follow..  2............FIVAVTGGIATGKSTISKVFERVFGDEVLLPSINRAVLGKMIFEDKELRGKLNKITIHRKIFWQVCKLLVTGHAWIV---------LDLPLLFETGVLMD----------------------HKIVCVTCDSDKQLERLIARNELSESEARHRVDSQMPLDKKCEKSHF------VID-NNGSVEEAESSAMSIYNLMRDSKQH...... 202
50 -9.170[E] COG1126 ABC-type polar amino acid transport system, ATPase component  ali follow..  12  21.....NLNITQGEVVVIIGPSGSGKSTLLRCINVITRGQLIVDGLDVNSPNIDERQIRLEAGMVFQQFYLFPHLTALENVA---GPTKVRGTSKEEAKKQALALLSKVGLEDRAHHYPAELQRVAIARALAVKPKLML-FDEPTSALDPELRHEVLTVMKDLAEEGMTMVIVTHEVGFAQKVASRLIFIDKGRIAEDGDPDSL................... 223

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24