current user: public

If you have questions about the server, please let us know.

Query: gi|30260215|ref|NP_842592.1| recombination protein RecR (BA_0021) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGGIGPEDINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDLEYADEVTLSKALEGRREVLast
1 -91.600[L] COG0353 Recombinational DNA repair protein (RecF pathway)  ali follow..  41  1MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDVCNICSNPRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLASEKISELILATNPTVEGEATANYIAELCAEAGVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKI 199
2 -8.960[K] COG2093 DNA-directed RNA polymerase, subunit E``  ali follow..  24  1....................................................TEKACRNCHYITTEDQCPVCGSRDLSEELVIIIDVENSEIAKKIGAKVPGKYAV............................................................................................ 57
3 -8.510[L] COG2816 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding  ali follow..  14  86................................VDEALFLAASKAVQYGHMSQTIRFCPQCGGRNYLNQCHDCRTPRIFPCIIVAVRKQQQILLAQHPRHRNGMYTVIAGFVEV-----------ETLEQCVAREVLEETGIVVT-------NIRYFGSQPWAFPSSMMMAFLADYDTGELK-PDYSELSDA....... 235
4 -8.210[L] COG1658 Small primase-like proteins (Toprim domain)  ali follow..  17  3..........................................................................EKQKINEVIVVEGRDDTANLKRYFDCE---------TYETGGSSIDDRDLERLKRLEDK---RGIIVFTDPDFQGERIRKIIMQAVP--NAKHAFLNRDEARPKGVEHANFEALNQALAEVFGG 117
5 -6.880[L] KOG3084 NADH pyrophosphatase I of the Nudix family of hydrolases  ali follow..  13  149.......................RSIFTEQYQLSASDSGACAFARSILDWISRYRFCPGCGKRNMGGTKLVCSDVLLNDDIMVILSHDMQHILLGRALRHKGLYACLAGFLEP-----------ESLEEAVVRETYEESGVDVE-------KVLYYASQ--PQSLMLACFGIARK-NAKIQRDKDLELEDV--SREEV 333
6 -6.670[R] COG0603 Predicted PP-loop superfamily ATPase  ali follow..  13  131..YPDCRDEFVKVLNHAVSLGMAKDIRFETPLMWIDKAETWALADYYGKLDLVRNETLTCYNGIKGDGCGHCAACNLRANGL--HYLADKPTVMAAMKQKTGL............................................................................................... 230
7 -6.550[J] KOG4080 Mitochondrial ribosomal protein L32  ali follow..  15  58.............LWAVP------KHRRSVEKRLKRKFGYPEYNWKPLREKRNLRSCLQCGHDHEMGLCPFCYQKVLKETE----TLGLDPVDKEVIVLYEGE-------------------KAEQSTDDLKNKRIVEMKKPRPMWFTKNLLQKSTQQLSETKEVKPSDLA........................... 195
8 -6.440[J] COG1491 Predicted RNA-binding protein  ali follow..  15  105FNEAGPISTRLHQLELLPGIGKKHMWDILKAREEKPFESFEDIKNRVPMLSDPVKLIV............................................................................................................................................ 162
9 -6.420[R] COG1244 Predicted Fe-S oxidoreductase  ali follow..  15  26...........................................................CYRYRIGKPCYMCSYPAQAPKKT-ILSHFLEAVHKIKGKDDRFSIRIFTSGSFFDSAEVRRDTRIRIFREISKLDNVYEVVVETRSEIIREDWVRELAEMVEDKWFEVA-------IG--LESANDDIADVSINKGSTF 158
10 -6.400[C] COG1614 CO dehydrogenase/acetyl-CoA synthase beta subunit  ali follow..  13  140.........FIEKCDVTIITDPEKVKEELEKAREIYNKRDEKTKALHEEDVDVFYGCVMCQSFAPTHVCVITPDR--DARAAAKIDPNGPIFEIPKGECLLGIYSGVNEVVRERSQGTVEEVTLHSALEKPCTSGCFEAIVFYIPEVDGFGIAHRGYKGETPMGIPFSTLAGQCSGGKQVP................. 323

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24